Citrus Sinensis ID: 010740


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MGMASASASLSFSSSLLPSPLPHPHDTKTNKHRAQVPNFNLIHCSVTSTNKHTSFSSESAVAAKKRLWKEGEYPGVSETSIPGYRSKRTPIKNLKKKLERKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQMLLEASGHWQQNI
ccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccc
ccccccHHHHHHHHHHHHHccHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccEHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEcc
mgmasasaslsfsssllpsplphphdtktnkhraqvpnfnlihcsvtstnkhtsfssESAVAAKKRLWkegeypgvsetsipgyrskrtpikNLKKKLERKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEMlkeqpfyqpkegTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQmktlpncqpdvyTYSTLIKACVDAMRFELIETLYQdmdersvtpntvtqnivlggygkagmfDQMERVLSGMlesatckpdvwtmNTILSVFANKGQVDMMERWYEKFRnfgidpetrTFNILIGAYGKKRMYDKMSSVMEYMRKLqfpwtsstYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYKRMKekhcrpdsetfSIMTEAYAKEGMNDKVYALEQEKLQMLLEASGHWQQNI
MGMASASASLSFSSSLLPSPLPHPHDTKTNKHRAQVPNFNLIHCSVTStnkhtsfssESAVAAKKRlwkegeypgvsetsipgyrskrtpiknlkkkleRKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYqdmdersvtpnTVTQNIVLGGYGKAGMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFrnfgidpetrtfNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYKRMkekhcrpdsetfSIMTEAYAKEGMNDKVYALEQEKLQMLLEAsghwqqni
MGMasasaslsfsssllpsplpHPHDTKTNKHRAQVPNFNLIHCSVTSTNKHTSFSSESAVAAKKRLWKEGEYPGVSETSIPGYRSKRTPIknlkkklerkakakaWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQMLLEASGHWQQNI
*************************************NFNLIHCSV********************************************************KAKAWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYKR************FSIMTEAYAK**MNDKVYAL*******************
***************LL********************NFNLIHCSVTSTNKHTSFSSESAVAAKKRLWKEGEYPGVSETSIPGYRSKRTPIKNLKKKLERKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQMLLEASGHWQQNI
*************SSLLPSPLPHPHDTKTNKHRAQVPNFNLIHCSVTS***************KKRLWKEGEYPGVSETSIPGYRSKRTPIKNLKKKLERKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQMLLEA********
**MASASASLSFSSSLLPSPLPHPHDTKTNKHRAQVPNFNLIHCSVTSTNKHTSFSSESAVAAKKRLWKEGEYPGVSETSIPGYRSKRTPIKNLKKKLERKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQMLLEASGHWQQNI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMASASASLSFSSSLLPSPLPHPHDTKTNKHRAQVPNFNLIHCSVTSTNKHTSFSSESAVAAKKRLWKEGEYPGVSETSIPGYRSKRTPIKNLKKKLERKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQMLLEASGHWQQNI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query502 2.2.26 [Sep-21-2011]
Q9SQU6486 Pentatricopeptide repeat- yes no 0.904 0.934 0.685 0.0
Q9FKC3508 Pentatricopeptide repeat- no no 0.808 0.799 0.411 5e-90
Q9SCP4447 Pentatricopeptide repeat- no no 0.782 0.879 0.387 3e-87
Q9SV96563 Pentatricopeptide repeat- no no 0.695 0.619 0.288 6e-42
Q9LYZ9 819 Pentatricopeptide repeat- no no 0.683 0.418 0.320 2e-41
Q9LW84642 Pentatricopeptide repeat- no no 0.675 0.528 0.272 2e-32
Q9S7Q2 862 Pentatricopeptide repeat- no no 0.743 0.432 0.242 9e-32
Q9ASZ8621 Pentatricopeptide repeat- no no 0.659 0.533 0.256 7e-31
O64624 822 Pentatricopeptide repeat- no no 0.673 0.411 0.285 3e-30
Q6NQ83619 Pentatricopeptide repeat- no no 0.750 0.609 0.246 6e-30
>sp|Q9SQU6|PP216_ARATH Pentatricopeptide repeat-containing protein At3g06430, chloroplastic OS=Arabidopsis thaliana GN=EMB2750 PE=2 SV=1 Back     alignment and function desciption
 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/468 (68%), Positives = 388/468 (82%), Gaps = 14/468 (2%)

Query: 24  PHDTKTNKHRAQVPNFNLIHCSVTSTNKHTSFSSESAVAAKKRLWKEGEYPGVSETSIPG 83
           P   +  +HR    +  ++ C + ++       S      KKRLWK+GE+PG++E     
Sbjct: 18  PEGKRRFRHR----DVGIVRCVLAASK------SSPGSVTKKRLWKDGEFPGITEP---- 63

Query: 84  YRSKRTPIKNLKKKLERKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPK 143
              +RTPIKN+KKKL+R++KA  WVNTV ET SD + KKQW QAL+VF+ML+EQ FYQPK
Sbjct: 64  VNQRRTPIKNVKKKLDRRSKANGWVNTVTETLSDLIAKKQWLQALEVFDMLREQTFYQPK 123

Query: 144 EGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLN 203
           EGTYMKLLVLLGKSGQP  A+K+F+EM+EEG+EPT ELYTALLAAY R++LID+AF  L+
Sbjct: 124 EGTYMKLLVLLGKSGQPNRAQKLFDEMLEEGLEPTVELYTALLAAYTRSNLIDDAFSILD 183

Query: 204 QMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKA 263
           +MK+ P CQPDV+TYSTL+KACVDA +F+L+++LY++MDER +TPNTVTQNIVL GYG+ 
Sbjct: 184 KMKSFPQCQPDVFTYSTLLKACVDASQFDLVDSLYKEMDERLITPNTVTQNIVLSGYGRV 243

Query: 264 GMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRT 323
           G FDQME+VLS ML S  CKPDVWTMN ILSVF N G++DMME WYEKFRNFGI+PETRT
Sbjct: 244 GRFDQMEKVLSDMLVSTACKPDVWTMNIILSVFGNMGKIDMMESWYEKFRNFGIEPETRT 303

Query: 324 FNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMH 383
           FNILIG+YGKKRMYDKMSSVMEYMRKL+FPWT+STYNN+IEAF+D+GDAK+ME TF+QM 
Sbjct: 304 FNILIGSYGKKRMYDKMSSVMEYMRKLEFPWTTSTYNNIIEAFADVGDAKNMELTFDQMR 363

Query: 384 AEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLM 443
           +EGMKADTKTFCCLINGYANAGLFHKVISSV+LA+K +I EN +FYNAVISAC KADDL+
Sbjct: 364 SEGMKADTKTFCCLINGYANAGLFHKVISSVQLAAKFEIPENTAFYNAVISACAKADDLI 423

Query: 444 EMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQML 491
           EMERVY RMKE+ C  DS TF IM EAY KEGMNDK+Y LEQE+ +++
Sbjct: 424 EMERVYIRMKERQCVCDSRTFEIMVEAYEKEGMNDKIYYLEQERQKLM 471





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FKC3|PP424_ARATH Pentatricopeptide repeat-containing protein At5g48730, chloroplastic OS=Arabidopsis thaliana GN=At5g48730 PE=2 SV=2 Back     alignment and function description
>sp|Q9SCP4|PP279_ARATH Pentatricopeptide repeat-containing protein At3g53170 OS=Arabidopsis thaliana GN=At3g53170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SV96|PP358_ARATH Pentatricopeptide repeat-containing protein At4g39620, chloroplastic OS=Arabidopsis thaliana GN=EMB2453 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 Back     alignment and function description
>sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 Back     alignment and function description
>sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940 OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query502
255556562491 pentatricopeptide repeat-containing prot 0.910 0.930 0.734 0.0
224112076434 predicted protein [Populus trichocarpa] 0.854 0.988 0.780 0.0
225432159498 PREDICTED: pentatricopeptide repeat-cont 0.852 0.859 0.784 0.0
147820978525 hypothetical protein VITISV_025315 [Viti 0.848 0.811 0.788 0.0
449441652496 PREDICTED: pentatricopeptide repeat-cont 0.910 0.921 0.726 0.0
356565453488 PREDICTED: pentatricopeptide repeat-cont 0.944 0.971 0.704 0.0
356564951488 PREDICTED: pentatricopeptide repeat-cont 0.944 0.971 0.702 0.0
15230719486 pentatricopeptide repeat-containing prot 0.904 0.934 0.685 0.0
297833394486 EMB2750 [Arabidopsis lyrata subsp. lyrat 0.910 0.940 0.683 0.0
357479161496 Pentatricopeptide repeat-containing prot 0.926 0.937 0.687 0.0
>gi|255556562|ref|XP_002519315.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541630|gb|EEF43179.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/471 (73%), Positives = 394/471 (83%), Gaps = 14/471 (2%)

Query: 21  LPHPHDTKTNKHRAQVPNFNLIHCSVTSTNKHTSFSSESAVAAKKRLWKEGEYPGVSETS 80
           L   ++    K R+  P   L+ C+   T          + + KK+ WK+GE+PG +ETS
Sbjct: 21  LAQSNNNCNTKPRSHQPKHTLVLCAYAPT----------STSPKKKHWKQGEFPGFTETS 70

Query: 81  IPGYRSKRTPIKNLKKKLERKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFY 140
            P    +RTPIKN+KKKL+RK KAKAWVNTV E  SD +LKKQWFQAL+VFEMLKEQPFY
Sbjct: 71  PP----RRTPIKNIKKKLDRKNKAKAWVNTVTEALSDRILKKQWFQALEVFEMLKEQPFY 126

Query: 141 QPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFV 200
            PKEGTYMKLLVLLG++GQP+ A ++F+EMVEEGIEPT ELYTALLAAYCRN L DEAF 
Sbjct: 127 HPKEGTYMKLLVLLGRTGQPQRAHQLFDEMVEEGIEPTAELYTALLAAYCRNHLTDEAFS 186

Query: 201 TLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGY 260
            L QMKTLP C PDVYTYSTL+KACVDA RFEL+E LYQ+M ER +TPNTVTQNIVL GY
Sbjct: 187 ILQQMKTLPRCLPDVYTYSTLLKACVDASRFELVEALYQEMGERLITPNTVTQNIVLSGY 246

Query: 261 GKAGMFDQMERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPE 320
           GKAGM+DQMERVLSGMLES  CKPDVWTMN ILSVF NKGQ+D+ME+WYEKFR+FGI+PE
Sbjct: 247 GKAGMYDQMERVLSGMLESTECKPDVWTMNIILSVFGNKGQIDLMEKWYEKFRSFGIEPE 306

Query: 321 TRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFE 380
           TRTFNILIGAYGKKRMYDKMSSVME+MRKLQFPWT+STYNNVIEAF+  GD KHMEYTF+
Sbjct: 307 TRTFNILIGAYGKKRMYDKMSSVMEFMRKLQFPWTTSTYNNVIEAFAVAGDVKHMEYTFD 366

Query: 381 QMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKAD 440
           QM AEGMKADTKTFCCLINGYANAGLFHKVISSV+LA+K +I EN +FYNA+ISAC KA+
Sbjct: 367 QMRAEGMKADTKTFCCLINGYANAGLFHKVISSVQLATKFEIPENTTFYNAIISACAKAE 426

Query: 441 DLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQML 491
           DLMEMERV+KRMK+  C+PDS T+SIM EAY +EGMNDKVY LEQEK  M+
Sbjct: 427 DLMEMERVFKRMKDNQCQPDSTTYSIMVEAYKREGMNDKVYYLEQEKQGMV 477




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224112076|ref|XP_002316075.1| predicted protein [Populus trichocarpa] gi|222865115|gb|EEF02246.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225432159|ref|XP_002274904.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
>gi|147820978|emb|CAN74604.1| hypothetical protein VITISV_025315 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441652|ref|XP_004138596.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Cucumis sativus] gi|449522692|ref|XP_004168360.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356565453|ref|XP_003550954.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356564951|ref|XP_003550709.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|15230719|ref|NP_187294.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207273|sp|Q9SQU6.1|PP216_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g06430, chloroplastic; AltName: Full=Protein EMBRYO DEFECTIVE 2750; Flags: Precursor gi|6437546|gb|AAF08573.1|AC011623_6 unknown protein [Arabidopsis thaliana] gi|20466300|gb|AAM20467.1| unknown protein [Arabidopsis thaliana] gi|30387593|gb|AAP31962.1| At3g06430 [Arabidopsis thaliana] gi|332640870|gb|AEE74391.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297833394|ref|XP_002884579.1| EMB2750 [Arabidopsis lyrata subsp. lyrata] gi|297330419|gb|EFH60838.1| EMB2750 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357479161|ref|XP_003609866.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510921|gb|AES92063.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query502
TAIR|locus:2081041486 PPR2 "pentatricopeptide repeat 0.898 0.927 0.685 1e-171
TAIR|locus:2122561563 EMB2453 "EMBRYO DEFECTIVE 2453 0.693 0.618 0.288 1.5e-42
TAIR|locus:2151281 819 AT5G02860 [Arabidopsis thalian 0.683 0.418 0.323 1.6e-41
TAIR|locus:2093472642 AT3G16010 [Arabidopsis thalian 0.675 0.528 0.272 9e-34
TAIR|locus:2044430 822 AT2G18940 [Arabidopsis thalian 0.699 0.427 0.285 4.9e-31
TAIR|locus:2195047621 AT1G12620 [Arabidopsis thalian 0.717 0.579 0.254 5.6e-31
TAIR|locus:2027166 862 PTAC2 "plastid transcriptional 0.737 0.429 0.233 1.2e-29
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.677 0.553 0.244 2.2e-29
TAIR|locus:2061310 918 GUN1 "AT2G31400" [Arabidopsis 0.611 0.334 0.279 3.3e-29
TAIR|locus:2034760637 AT1G12300 [Arabidopsis thalian 0.701 0.552 0.254 5.4e-29
TAIR|locus:2081041 PPR2 "pentatricopeptide repeat 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1669 (592.6 bits), Expect = 1.0e-171, P = 1.0e-171
 Identities = 316/461 (68%), Positives = 378/461 (81%)

Query:    31 KHRAQVPNFNLIHCSVTSTNKHTSFSSESAVAAKKRLWKEGEYPGVSETSIPGYRSKRTP 90
             K R +  +  ++ C V + +K    SS  +V  KKRLWK+GE+PG++E   P    +RTP
Sbjct:    21 KRRFRHRDVGIVRC-VLAASK----SSPGSVT-KKRLWKDGEFPGITE---P-VNQRRTP 70

Query:    91 IXXXXXXXXXXXXXXXWVNTVAETFSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKL 150
             I               WVNTV ET SD + KKQW QAL+VF+ML+EQ FYQPKEGTYMKL
Sbjct:    71 IKNVKKKLDRRSKANGWVNTVTETLSDLIAKKQWLQALEVFDMLREQTFYQPKEGTYMKL 130

Query:   151 LVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLPN 210
             LVLLGKSGQP  A+K+F+EM+EEG+EPT ELYTALLAAY R++LID+AF  L++MK+ P 
Sbjct:   131 LVLLGKSGQPNRAQKLFDEMLEEGLEPTVELYTALLAAYTRSNLIDDAFSILDKMKSFPQ 190

Query:   211 CQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQME 270
             CQPDV+TYSTL+KACVDA +F+L+++LY++MDER +TPNTVTQNIVL GYG+ G FDQME
Sbjct:   191 CQPDVFTYSTLLKACVDASQFDLVDSLYKEMDERLITPNTVTQNIVLSGYGRVGRFDQME 250

Query:   271 RVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGA 330
             +VLS ML S  CKPDVWTMN ILSVF N G++DMME WYEKFRNFGI+PETRTFNILIG+
Sbjct:   251 KVLSDMLVSTACKPDVWTMNIILSVFGNMGKIDMMESWYEKFRNFGIEPETRTFNILIGS 310

Query:   331 YGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKAD 390
             YGKKRMYDKMSSVMEYMRKL+FPWT+STYNN+IEAF+D+GDAK+ME TF+QM +EGMKAD
Sbjct:   311 YGKKRMYDKMSSVMEYMRKLEFPWTTSTYNNIIEAFADVGDAKNMELTFDQMRSEGMKAD 370

Query:   391 TKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISACIKADDLMEMERVYK 450
             TKTFCCLINGYANAGLFHKVISSV+LA+K +I EN +FYNAVISAC KADDL+EMERVY 
Sbjct:   371 TKTFCCLINGYANAGLFHKVISSVQLAAKFEIPENTAFYNAVISACAKADDLIEMERVYI 430

Query:   451 RMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQML 491
             RMKE+ C  DS TF IM EAY KEGMNDK+Y LEQE+ +++
Sbjct:   431 RMKERQCVCDSRTFEIMVEAYEKEGMNDKIYYLEQERQKLM 471


GO:0005739 "mitochondrion" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0048868 "pollen tube development" evidence=IMP
GO:0009507 "chloroplast" evidence=IDA
GO:0009553 "embryo sac development" evidence=IMP
GO:0009555 "pollen development" evidence=IMP
GO:0009790 "embryo development" evidence=IMP
GO:0019843 "rRNA binding" evidence=IDA
TAIR|locus:2122561 EMB2453 "EMBRYO DEFECTIVE 2453" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093472 AT3G16010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044430 AT2G18940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195047 AT1G12620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027166 PTAC2 "plastid transcriptionally active 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061310 GUN1 "AT2G31400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SQU6PP216_ARATHNo assigned EC number0.68580.90430.9341yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.X.786.1
hypothetical protein (434 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query502
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-17
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-14
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-09
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-07
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-06
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.003
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 85.7 bits (212), Expect = 2e-17
 Identities = 80/344 (23%), Positives = 155/344 (45%), Gaps = 14/344 (4%)

Query: 142 PKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVT 201
           P   T+  L+ +   S   + A +V   + E G++   +LYT L++   ++  +D  F  
Sbjct: 435 PTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEV 494

Query: 202 LNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYG 261
            ++M      + +V+T+  LI  C  A +       Y  M  ++V P+ V  N ++   G
Sbjct: 495 FHEMVN-AGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACG 553

Query: 262 KAGMFDQMERVLSGM-LESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPE 320
           ++G  D+   VL+ M  E+    PD  T+  ++   AN GQVD  +  Y+    + I   
Sbjct: 554 QSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGT 613

Query: 321 TRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHMEYTFE 380
              + I + +  +K  +D   S+ + M+K         ++ +++     G A  ++  FE
Sbjct: 614 PEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDV---AGHAGDLDKAFE 670

Query: 381 ---QMHAEGMKADTKTFCCLINGYANAGLFHK---VISSVRLASKLQIAENVSFYNAVIS 434
                  +G+K  T ++  L+   +NA  + K   +   ++ + KL+    VS  NA+I+
Sbjct: 671 ILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIK-SIKLR--PTVSTMNALIT 727

Query: 435 ACIKADDLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMND 478
           A  + + L +   V   MK     P++ T+SI+  A  ++   D
Sbjct: 728 ALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDAD 771


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 502
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.92
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
PRK14574 822 hmsH outer membrane protein; Provisional 99.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.83
PRK14574 822 hmsH outer membrane protein; Provisional 99.82
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.8
KOG2076 895 consensus RNA polymerase III transcription factor 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.77
KOG2003 840 consensus TPR repeat-containing protein [General f 99.76
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.76
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.74
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.73
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.7
KOG0547606 consensus Translocase of outer mitochondrial membr 99.69
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.68
KOG2076 895 consensus RNA polymerase III transcription factor 99.68
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.67
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.67
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.66
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.66
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.65
KOG1126638 consensus DNA-binding cell division cycle control 99.65
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.64
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.64
KOG2003 840 consensus TPR repeat-containing protein [General f 99.63
KOG1126638 consensus DNA-binding cell division cycle control 99.63
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.62
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.6
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.52
KOG1129478 consensus TPR repeat-containing protein [General f 99.49
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.49
PRK12370553 invasion protein regulator; Provisional 99.48
PRK12370553 invasion protein regulator; Provisional 99.48
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.48
KOG0547606 consensus Translocase of outer mitochondrial membr 99.48
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.47
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.47
KOG1129478 consensus TPR repeat-containing protein [General f 99.46
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.44
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.44
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.43
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.42
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.37
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.36
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.36
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.36
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.35
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.35
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.34
PF1304150 PPR_2: PPR repeat family 99.34
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.33
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.31
PRK11189296 lipoprotein NlpI; Provisional 99.31
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.3
PF1304150 PPR_2: PPR repeat family 99.29
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.28
PRK11189296 lipoprotein NlpI; Provisional 99.27
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.27
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.26
PRK04841 903 transcriptional regulator MalT; Provisional 99.21
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.21
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.18
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.17
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.16
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.15
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.11
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.07
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.07
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.07
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.03
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.02
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.02
PRK04841903 transcriptional regulator MalT; Provisional 99.0
KOG1125579 consensus TPR repeat-containing protein [General f 98.99
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.99
KOG1125579 consensus TPR repeat-containing protein [General f 98.98
PLN02789320 farnesyltranstransferase 98.96
KOG1128777 consensus Uncharacterized conserved protein, conta 98.92
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.89
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.88
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.88
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.88
PLN02789320 farnesyltranstransferase 98.87
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 98.87
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.85
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.84
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.81
PF1285434 PPR_1: PPR repeat 98.8
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.8
PRK10370198 formate-dependent nitrite reductase complex subuni 98.8
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.76
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.75
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.73
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.73
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.72
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.71
PRK15359144 type III secretion system chaperone protein SscB; 98.7
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.69
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.69
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.65
PF1285434 PPR_1: PPR repeat 98.65
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.65
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.63
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.61
PRK15359144 type III secretion system chaperone protein SscB; 98.61
PRK10370198 formate-dependent nitrite reductase complex subuni 98.6
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.59
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.58
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.56
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.52
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.51
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.49
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.48
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.44
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.42
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.24
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.22
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.21
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.19
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.18
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.16
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.14
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.07
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.06
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.06
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.04
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.03
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.0
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.98
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.98
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.96
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.95
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.94
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.93
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.93
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.93
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.92
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.89
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.88
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.86
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.86
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.85
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.83
COG4700251 Uncharacterized protein conserved in bacteria cont 97.82
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.81
KOG0553304 consensus TPR repeat-containing protein [General f 97.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.8
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.79
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.79
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.76
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.74
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.74
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.74
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.74
KOG0553304 consensus TPR repeat-containing protein [General f 97.73
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.72
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.72
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.71
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.71
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.7
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.68
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.67
COG4700251 Uncharacterized protein conserved in bacteria cont 97.66
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.66
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.64
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.62
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.61
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.6
PF12688120 TPR_5: Tetratrico peptide repeat 97.55
PF12688120 TPR_5: Tetratrico peptide repeat 97.52
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.5
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.48
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.47
COG3898531 Uncharacterized membrane-bound protein [Function u 97.42
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.39
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.39
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.39
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.34
PRK10803263 tol-pal system protein YbgF; Provisional 97.32
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.25
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.25
PF1337173 TPR_9: Tetratricopeptide repeat 97.24
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.17
PRK15331165 chaperone protein SicA; Provisional 97.14
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.14
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.13
PRK10803263 tol-pal system protein YbgF; Provisional 97.12
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.12
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.09
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.02
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.9
PRK15331165 chaperone protein SicA; Provisional 96.87
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.85
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.81
PF1337173 TPR_9: Tetratricopeptide repeat 96.81
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.68
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.65
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.64
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.64
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.57
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.57
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.55
KOG3941406 consensus Intermediate in Toll signal transduction 96.55
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.45
KOG4555175 consensus TPR repeat-containing protein [Function 96.42
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.38
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.35
PF1342844 TPR_14: Tetratricopeptide repeat 96.34
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.32
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.3
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 96.3
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.29
smart00299140 CLH Clathrin heavy chain repeat homology. 96.26
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.25
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.23
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.21
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.18
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.15
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.11
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.03
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.02
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.96
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.94
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.92
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.92
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.89
PF13512142 TPR_18: Tetratricopeptide repeat 95.86
KOG1258 577 consensus mRNA processing protein [RNA processing 95.85
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.77
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.76
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.73
KOG3941 406 consensus Intermediate in Toll signal transduction 95.69
smart00299140 CLH Clathrin heavy chain repeat homology. 95.67
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.65
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.63
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.62
PF13512142 TPR_18: Tetratricopeptide repeat 95.6
PRK11906458 transcriptional regulator; Provisional 95.58
KOG1585308 consensus Protein required for fusion of vesicles 95.53
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.26
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.22
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.19
KOG4555175 consensus TPR repeat-containing protein [Function 95.19
KOG1585308 consensus Protein required for fusion of vesicles 95.19
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.13
PRK11906458 transcriptional regulator; Provisional 95.09
PF1342844 TPR_14: Tetratricopeptide repeat 95.08
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.94
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.78
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.75
PF13929292 mRNA_stabil: mRNA stabilisation 94.73
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.5
KOG1550552 consensus Extracellular protein SEL-1 and related 94.4
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.34
COG3629280 DnrI DNA-binding transcriptional activator of the 94.34
KOG1550552 consensus Extracellular protein SEL-1 and related 93.93
COG3629280 DnrI DNA-binding transcriptional activator of the 93.8
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.77
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.69
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.62
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.49
KOG1258 577 consensus mRNA processing protein [RNA processing 93.44
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.07
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.06
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.98
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.92
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.83
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.6
KOG4570 418 consensus Uncharacterized conserved protein [Funct 92.56
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.27
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 92.08
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 91.95
KOG4570 418 consensus Uncharacterized conserved protein [Funct 91.86
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.82
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.75
PF1343134 TPR_17: Tetratricopeptide repeat 91.75
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.72
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 91.67
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.66
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.57
PF1343134 TPR_17: Tetratricopeptide repeat 91.44
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 91.22
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.17
KOG2063 877 consensus Vacuolar assembly/sorting proteins VPS39 91.11
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 91.11
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 91.04
KOG4234271 consensus TPR repeat-containing protein [General f 90.6
COG1747 711 Uncharacterized N-terminal domain of the transcrip 90.55
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.89
PRK09687280 putative lyase; Provisional 89.77
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.65
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 89.63
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 89.6
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.47
COG4455273 ImpE Protein of avirulence locus involved in tempe 89.42
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.33
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 89.22
PRK11619 644 lytic murein transglycosylase; Provisional 89.22
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.88
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 88.54
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 88.1
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.57
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 87.17
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.83
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 86.57
COG3947361 Response regulator containing CheY-like receiver a 86.46
COG4455 273 ImpE Protein of avirulence locus involved in tempe 86.06
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.96
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.84
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 85.47
KOG2297412 consensus Predicted translation factor, contains W 85.4
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 85.3
COG3947361 Response regulator containing CheY-like receiver a 85.24
PF13929292 mRNA_stabil: mRNA stabilisation 84.92
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.53
KOG2168 835 consensus Cullins [Cell cycle control, cell divisi 84.51
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 83.43
COG5159 421 RPN6 26S proteasome regulatory complex component [ 83.41
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.3
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.51
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 82.49
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 82.17
KOG4648536 consensus Uncharacterized conserved protein, conta 82.09
KOG4648 536 consensus Uncharacterized conserved protein, conta 81.52
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 81.39
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 81.12
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 80.03
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.1e-59  Score=472.75  Aligned_cols=374  Identities=21%  Similarity=0.322  Sum_probs=354.1

Q ss_pred             HHHHHhhhcHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCC
Q 010740          115 FSDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSL  194 (502)
Q Consensus       115 l~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~  194 (502)
                      +..+.+.|..++|+.+|+.|.     .||..+|+.++.+|++.|+++.|.++|++|.+.|+.||..+|+.+|.+|++.|+
T Consensus       413 i~~~~~~g~~~eAl~lf~~M~-----~pd~~Tyn~LL~a~~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~  487 (1060)
T PLN03218        413 FKACKKQRAVKEAFRFAKLIR-----NPTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGK  487 (1060)
T ss_pred             HHHHHHCCCHHHHHHHHHHcC-----CCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcC
Confidence            344445555555555555443     278899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhcCCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhccCChHHHHHHHH
Q 010740          195 IDEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQMERVLS  274 (502)
Q Consensus       195 ~~~a~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~l~~~~~~~g~~~~a~~~~~  274 (502)
                      +++|.++|++|.+. |+.||..+|+.||.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|+
T Consensus       488 vd~A~~vf~eM~~~-Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~  566 (1060)
T PLN03218        488 VDAMFEVFHEMVNA-GVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLA  566 (1060)
T ss_pred             HHHHHHHHHHHHHc-CCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHH
Confidence            99999999999986 88999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHc-CCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCcHHHHHHHHHHHHHcCCC
Q 010740          275 GMLES-ATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFP  353 (502)
Q Consensus       275 ~~~~~-~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~  353 (502)
                      +|... .++.||..+|+.++.+|++.|++++|.++|++|.+.|+.|+..+|+.+|.+|++.|++++|.++|++|.+.|+.
T Consensus       567 eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~  646 (1060)
T PLN03218        567 EMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVK  646 (1060)
T ss_pred             HHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCC
Confidence            99753 57899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CChHHHHHHHHHHHhcCCHhHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhcCCCCChHHHHHHH
Q 010740          354 WTSSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVI  433 (502)
Q Consensus       354 ~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~  433 (502)
                      ||..+|+.++.+|++.|++++|.++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|.+.|+.||..+|+.||
T Consensus       647 PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI  726 (1060)
T PLN03218        647 PDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALI  726 (1060)
T ss_pred             CCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCcHHHHHHHHHHHHhhhhc
Q 010740          434 SACIKADDLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQMLLEA  494 (502)
Q Consensus       434 ~~~~~~g~~~~a~~~~~~~~~~g~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~  494 (502)
                      .+|++.|++++|.++|++|.+.|+.||..||+.++.+|++.|+.++|.+++++|.+.+..+
T Consensus       727 ~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k~G~le~A~~l~~~M~k~Gi~p  787 (1060)
T PLN03218        727 TALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKP  787 (1060)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCC
Confidence            9999999999999999999999999999999999999999999999999999999976544



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2297 consensus Predicted translation factor, contains W2 domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2168 consensus Cullins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query502
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-18
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 87.2 bits (214), Expect = 4e-18
 Identities = 30/268 (11%), Positives = 75/268 (27%), Gaps = 8/268 (2%)

Query: 95  KKKLERKAKAKAWVNTVAETFSDHVLKKQWFQALQVFEML---KEQPFYQPKEGTYMKLL 151
            ++L+ K +         +  +  +  +    + Q+   L     Q    P E    +LL
Sbjct: 41  MQRLKAKLQMPFQSGE-FKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLL 99

Query: 152 VLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAFVTLNQMKTLP-- 209
                    ++ +    +  +  +    +   A          +  A   L         
Sbjct: 100 QEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQK 159

Query: 210 NCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQM 269
                +  Y+ ++        F+ +  +   + +  +TP+ ++    L   G+       
Sbjct: 160 RKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGT 219

Query: 270 -ERVLSGMLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILI 328
            ER L  M +       +     +LS       +  + +    F      P     + L+
Sbjct: 220 IERCLEQMSQEGLKLQAL-FTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLL 278

Query: 329 GAYGKKRMYDKMSSVMEYMRKLQFPWTS 356
                K        +   ++ LQ  +  
Sbjct: 279 RDVYAKDGRVSYPKLHLPLKTLQCLFEK 306


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query502
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.92
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.86
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.84
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.84
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.84
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.83
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.82
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.8
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.74
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.74
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.74
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.72
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.72
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.72
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.72
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.71
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.71
3u4t_A272 TPR repeat-containing protein; structural genomics 99.69
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.69
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.69
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.68
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.67
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.67
3u4t_A272 TPR repeat-containing protein; structural genomics 99.67
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.67
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.67
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.64
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.64
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.64
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.62
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.61
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.6
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.6
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.6
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.58
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.58
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.58
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.57
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.55
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.55
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.55
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.53
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.52
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.51
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.51
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.51
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.51
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.49
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.45
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.44
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.44
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.41
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.38
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.37
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.36
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.34
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.33
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.32
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.22
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.22
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.2
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.18
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.18
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.18
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.17
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.16
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.13
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.12
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.12
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.09
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.08
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.08
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.07
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.06
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.06
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.06
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.04
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.03
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.02
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.02
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.02
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.99
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.99
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.94
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.94
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.93
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.9
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.89
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.89
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.88
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.86
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.86
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.86
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.83
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.8
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.8
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.8
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.8
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.79
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.77
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.75
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.74
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.73
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.72
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.71
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.71
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.7
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.7
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.7
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.7
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.69
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.68
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.68
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.68
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.66
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.66
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.65
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.65
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.64
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.62
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.58
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.58
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.58
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.57
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.56
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.53
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.51
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.49
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.49
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.48
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.48
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.48
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.47
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.45
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.44
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.44
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.41
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.41
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.38
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.37
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.36
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.35
3k9i_A117 BH0479 protein; putative protein binding protein, 98.33
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.32
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.31
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.28
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.27
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.25
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.24
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.23
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.22
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.21
3k9i_A117 BH0479 protein; putative protein binding protein, 98.17
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.17
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.16
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.14
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.11
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.1
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.07
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.04
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.01
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.0
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.98
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.9
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.85
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.84
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.83
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.8
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.78
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.76
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.71
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.63
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.42
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.35
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.33
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.3
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.26
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.25
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.25
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.2
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.17
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.15
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.98
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.98
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.85
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.85
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.78
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.76
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.28
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.2
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.07
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.04
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.99
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.86
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.84
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.65
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.51
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.92
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.61
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.56
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 94.26
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.24
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.07
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.07
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.96
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.67
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 93.43
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.38
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.32
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.26
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.05
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.68
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.56
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.29
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 90.03
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 89.76
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.38
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 89.34
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 89.01
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.61
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 88.42
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 88.16
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 88.02
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 87.02
2p58_C116 Putative type III secretion protein YSCG; type III 85.15
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 84.86
2uwj_G115 Type III export protein PSCG; virulence, chaperone 83.71
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 82.77
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 82.33
3bbn_U190 Ribosomal protein S21; small ribosomal subunit, sp 81.98
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.97
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 80.08
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 80.02
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3.5e-35  Score=293.53  Aligned_cols=246  Identities=11%  Similarity=-0.020  Sum_probs=163.2

Q ss_pred             CCHHHHHHHHHHHhccCChHHHHHHHHHHHHcCC--------------------------------CCCCHHHHHHHHHH
Q 010740          248 PNTVTQNIVLGGYGKAGMFDQMERVLSGMLESAT--------------------------------CKPDVWTMNTILSV  295 (502)
Q Consensus       248 ~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~--------------------------------~~~~~~~~~~l~~~  295 (502)
                      ++..+++.++..|.+.|++++|.++|+++++...                                .+.+..+++.++..
T Consensus       303 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~  382 (597)
T 2xpi_A          303 KSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGIY  382 (597)
T ss_dssp             GCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTSHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCcccHHHHHHHHHH
Confidence            4455555555666666666666666665544321                                12345566666777


Q ss_pred             HHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCcHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHhHH
Q 010740          296 FANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWTSSTYNNVIEAFSDMGDAKHM  375 (502)
Q Consensus       296 ~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a  375 (502)
                      |.+.|++++|.++|+++.+.. +.+..+|+.++..|.+.|++++|.++|+++.+.+.. +..+|..++.+|.+.|++++|
T Consensus       383 ~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A  460 (597)
T 2xpi_A          383 YLCVNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQG-THLPYLFLGMQHMQLGNILLA  460 (597)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTT-CSHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHhccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCcc-chHHHHHHHHHHHHcCCHHHH
Confidence            777777777777777766543 445666777777777777777777777777665443 666777777777777777777


Q ss_pred             HHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhc----CCCCC--hHHHHHHHHHHHHcCCHHHHHHHH
Q 010740          376 EYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKL----QIAEN--VSFYNAVISACIKADDLMEMERVY  449 (502)
Q Consensus       376 ~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~----~~~~~--~~~~~~l~~~~~~~g~~~~a~~~~  449 (502)
                      .++|+++.+.. +.+..+|..++..|.+.|++++|.++++.+.+.    +..|+  ..+|..++.+|.+.|++++|.++|
T Consensus       461 ~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~  539 (597)
T 2xpi_A          461 NEYLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDAL  539 (597)
T ss_dssp             HHHHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHH
Confidence            77777776653 335667777777777777777777777776665    44555  567777777777777777777777


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHHhcCCcHHHHHHHHHHHHhhhhcccc
Q 010740          450 KRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQMLLEASGH  497 (502)
Q Consensus       450 ~~~~~~g~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~  497 (502)
                      +++.+.+ +.+..+|..+..+|.+.|++++|.+.++++++..|++...
T Consensus       540 ~~~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~  586 (597)
T 2xpi_A          540 NQGLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMA  586 (597)
T ss_dssp             HHHHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             HHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHH
Confidence            7777654 2366777777777777777777777777777776665543



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bbn_U Ribosomal protein S21; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query502
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.71
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.69
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.39
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.35
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.33
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.33
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.33
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.26
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.26
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.25
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.23
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.2
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.79
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.73
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.71
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.7
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.7
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.62
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.57
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.57
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.52
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.51
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.5
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.46
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.38
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.35
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.28
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.27
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.24
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.18
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.16
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.06
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.05
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.02
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.97
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.94
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.91
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.91
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.88
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.87
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.85
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.84
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.74
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.36
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.34
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.06
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.87
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.7
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.48
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.88
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.37
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.11
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.85
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 91.34
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 91.27
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 90.66
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=3.8e-23  Score=192.18  Aligned_cols=370  Identities=13%  Similarity=0.094  Sum_probs=311.3

Q ss_pred             HHHHhhhcHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCH
Q 010740          116 SDHVLKKQWFQALQVFEMLKEQPFYQPKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLI  195 (502)
Q Consensus       116 ~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~  195 (502)
                      ..+.+.|++++|++.|+.+.+..  +-+..++..+..++.+.|++++|...|+++++.. +-+..+|..+..+|...|++
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~   83 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhccc
Confidence            44567899999999999998763  5578899999999999999999999999999875 55688999999999999999


Q ss_pred             HHHHHHHHHhhcCCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhccCChHHHHHHHHH
Q 010740          196 DEAFVTLNQMKTLPNCQPDVYTYSTLIKACVDAMRFELIETLYQDMDERSVTPNTVTQNIVLGGYGKAGMFDQMERVLSG  275 (502)
Q Consensus       196 ~~a~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~  275 (502)
                      ++|++.+....+..  +.+...+..........+....+............. ...............+....+...+..
T Consensus        84 ~~A~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (388)
T d1w3ba_          84 QEAIEHYRHALRLK--PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPD-LYCVRSDLGNLLKALGRLEEAKACYLK  160 (388)
T ss_dssp             HHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTT-CTHHHHHHHHHHHTTSCHHHHHHHHHH
T ss_pred             cccccccccccccc--cccccccccccccccccccccccccccccccccccc-cccccccccccccccchhhhhHHHHHH
Confidence            99999999998743  566666666666777777777777766666555333 455566666777888888888888888


Q ss_pred             HHHcCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCcHHHHHHHHHHHHHcCCCCC
Q 010740          276 MLESATCKPDVWTMNTILSVFANKGQVDMMERWYEKFRNFGIDPETRTFNILIGAYGKKRMYDKMSSVMEYMRKLQFPWT  355 (502)
Q Consensus       276 ~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~  355 (502)
                      .....  +.+...+..+...+...|++++|...+++..+.. +.+...+..+...+...|++++|...+......... +
T Consensus       161 ~~~~~--~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~-~  236 (388)
T d1w3ba_         161 AIETQ--PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN-H  236 (388)
T ss_dssp             HHHHC--TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT-C
T ss_pred             hhccC--cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhh-H
Confidence            87653  3466788888899999999999999999988754 556778899999999999999999999999887665 7


Q ss_pred             hHHHHHHHHHHHhcCCHhHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhcCCCCChHHHHHHHHH
Q 010740          356 SSTYNNVIEAFSDMGDAKHMEYTFEQMHAEGMKADTKTFCCLINGYANAGLFHKVISSVRLASKLQIAENVSFYNAVISA  435 (502)
Q Consensus       356 ~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~  435 (502)
                      ...+..+...+.+.|++++|...|++..+.. +-+..++..+...+...|++++|.+.++...... +.+...+..+...
T Consensus       237 ~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~  314 (388)
T d1w3ba_         237 AVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANI  314 (388)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHH
Confidence            7888889999999999999999999998863 3356788999999999999999999999888864 6778889999999


Q ss_pred             HHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCcHHHHHHHHHHHHhhhhccccc
Q 010740          436 CIKADDLMEMERVYKRMKEKHCRPDSETFSIMTEAYAKEGMNDKVYALEQEKLQMLLEASGHW  498 (502)
Q Consensus       436 ~~~~g~~~~a~~~~~~~~~~g~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~  498 (502)
                      +...|++++|++.|++..+... -+..++..+..+|.+.|++++|++.|+++++..|+....|
T Consensus       315 ~~~~~~~~~A~~~~~~al~~~p-~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~  376 (388)
T d1w3ba_         315 KREQGNIEEAVRLYRKALEVFP-EFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAY  376 (388)
T ss_dssp             HHTTTCHHHHHHHHHHHTTSCT-TCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHH
T ss_pred             HHHCCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHH
Confidence            9999999999999999987532 2577899999999999999999999999999988766544



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure