Citrus Sinensis ID: 010881


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MKQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSLCFFDDGNEVATEGGSLLDCQKGW
ccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccEEEHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHcccc
cHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccEEEEcHHHHHHHHccc
MKQIKQIQSHLtvsgtlwdpfaVGKIIGfcsasdigdlshgyRLFVCLQYRTTFIWNTMIrgfaeknePIKAFALYKQMLrsdflpnnytfSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATcncmdparklfdmsvnrdVISWTSLINGYAKSGQISIARQMFdkmpeknaVSWSAMINGYVQVDLFKEALEHFNymqlcgfrpnhagIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETacsvfdsmpnrdvFAYTSLISGLANHDQSASAIELFMRMQlegvvpnesmseiygiepgvqhYGCLVDLLGRAGMLEAAKKVVRempiepdnYVLGALLNACRvhgdvdlgKETVESLVERSLDHEGVHVLLSNIYASTEQWNGVEKVRRgmednevrkvpgcslievDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKslcffddgnevateggslldcqkgw
MKQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSniyasteqwnGVEKVRrgmednevrkvpgcslievDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSLCFFDDGNevateggslldcqkgw
MKQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSLCFFDDGNEVATEGGSLLDCQKGW
********SHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSLCFFDDGNEVAT************
MKQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSLCFFDDGNEVATEGGSLLDC****
********SHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSLCFFDDGNEVATEGGSLLDCQKGW
MKQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSLCFFDDGNEVATEGGSLLD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSLCFFDDGNEVATEGGSLLDCQKGW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query498 2.2.26 [Sep-21-2011]
Q9FJY7620 Pentatricopeptide repeat- yes no 0.923 0.741 0.404 1e-107
Q9FI80646 Pentatricopeptide repeat- no no 0.949 0.732 0.364 2e-98
Q9FG16622 Pentatricopeptide repeat- no no 0.901 0.721 0.359 1e-94
Q9FND7612 Putative pentatricopeptid no no 0.947 0.771 0.365 1e-94
Q9SIL5534 Pentatricopeptide repeat- no no 0.921 0.859 0.355 4e-92
Q9SJG6559 Pentatricopeptide repeat- no no 0.931 0.830 0.366 7e-90
Q683I9573 Pentatricopeptide repeat- no no 0.861 0.748 0.379 1e-89
Q9LSB8687 Putative pentatricopeptid no no 0.969 0.703 0.347 6e-89
O82380738 Pentatricopeptide repeat- no no 0.877 0.592 0.362 1e-85
Q9LXF2548 Pentatricopeptide repeat- no no 0.885 0.804 0.372 2e-85
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function desciption
 Score =  389 bits (1000), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/485 (40%), Positives = 298/485 (61%), Gaps = 25/485 (5%)

Query: 2   KQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGD-LSHGYRLFVCLQYRTTFIWNTMI 60
           +++KQI + +  +G + D +A+ K + FC +S   D L +   +F       TF+WN MI
Sbjct: 28  EELKQIHARMLKTGLMQDSYAITKFLSFCISSTSSDFLPYAQIVFDGFDRPDTFLWNLMI 87

Query: 61  RGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWE 120
           RGF+  +EP ++  LY++ML S    N YTF  +L+AC++ S        HAQ+ +LG+E
Sbjct: 88  RGFSCSDEPERSLLLYQRMLCSSAPHNAYTFPSLLKACSNLSAFEETTQIHAQITKLGYE 147

Query: 121 SYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKM 180
           +  + +N L++ YA       A  LFD     D +SW S+I GY K+G++ IA  +F KM
Sbjct: 148 NDVYAVNSLINSYAVTGNFKLAHLLFDRIPEPDDVSWNSVIKGYVKAGKMDIALTLFRKM 207

Query: 181 PEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGR 240
            EKNA+SW+ MI+GYVQ D+ KEAL+ F+ MQ     P++  +  AL+ACA LGAL+QG+
Sbjct: 208 AEKNAISWTTMISGYVQADMNKEALQLFHEMQNSDVEPDNVSLANALSACAQLGALEQGK 267

Query: 241 WIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHD 300
           WIH+Y+++  I +D +LG  +IDMYAKCG +E A  VF ++  + V A+T+LISG A H 
Sbjct: 268 WIHSYLNKTRIRMDSVLGCVLIDMYAKCGEMEEALEVFKNIKKKSVQAWTALISGYAYHG 327

Query: 301 QSASAIELFMRMQLEGVVPN------------------------ESMSEIYGIEPGVQHY 336
               AI  FM MQ  G+ PN                         SM   Y ++P ++HY
Sbjct: 328 HGREAISKFMEMQKMGIKPNVITFTAVLTACSYTGLVEEGKLIFYSMERDYNLKPTIEHY 387

Query: 337 GCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSL 396
           GC+VDLLGRAG+L+ AK+ ++EMP++P+  + GALL ACR+H +++LG+E  E L+    
Sbjct: 388 GCIVDLLGRAGLLDEAKRFIQEMPLKPNAVIWGALLKACRIHKNIELGEEIGEILIAIDP 447

Query: 397 DHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNV 456
            H G +V  +NI+A  ++W+   + RR M++  V KVPGCS I ++G   EF++G+R++ 
Sbjct: 448 YHGGRYVHKANIHAMDKKWDKAAETRRLMKEQGVAKVPGCSTISLEGTTHEFLAGDRSHP 507

Query: 457 LMEEI 461
            +E+I
Sbjct: 508 EIEKI 512





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q9FND7|PP410_ARATH Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana GN=PCMP-H14 PE=3 SV=1 Back     alignment and function description
>sp|Q9SIL5|PP165_ARATH Pentatricopeptide repeat-containing protein At2g20540 OS=Arabidopsis thaliana GN=PCMP-E78 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E75 PE=2 SV=1 Back     alignment and function description
>sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containing protein At3g15930 OS=Arabidopsis thaliana GN=PCMP-E51 PE=3 SV=2 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protein At5g15300 OS=Arabidopsis thaliana GN=PCMP-E40 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query498
225466196537 PREDICTED: pentatricopeptide repeat-cont 0.969 0.899 0.706 0.0
296085795512 unnamed protein product [Vitis vinifera] 0.969 0.943 0.706 0.0
227462996532 pentatricopeptide repeat protein [Gossyp 0.963 0.902 0.650 0.0
224134663540 predicted protein [Populus trichocarpa] 0.961 0.887 0.629 0.0
255570475491 pentatricopeptide repeat-containing prot 0.889 0.902 0.649 1e-180
225425100 622 PREDICTED: pentatricopeptide repeat-cont 0.949 0.760 0.398 1e-111
413939596524 hypothetical protein ZEAMMB73_269656 [Ze 0.819 0.778 0.472 1e-110
147832325 622 hypothetical protein VITISV_030261 [Viti 0.949 0.760 0.396 1e-110
242063604514 hypothetical protein SORBIDRAFT_04g03830 0.845 0.819 0.449 1e-109
296088765595 unnamed protein product [Vitis vinifera] 0.947 0.793 0.381 1e-107
>gi|225466196|ref|XP_002265420.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/507 (70%), Positives = 410/507 (80%), Gaps = 24/507 (4%)

Query: 1   MKQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMI 60
           M  IKQIQSHLTVSGTL+DPFA G+II FC+ S  GD+SH Y LF+ L  RT+FIWNTM+
Sbjct: 26  MAHIKQIQSHLTVSGTLFDPFAAGRIISFCAVSAQGDISHAYLLFLSLPRRTSFIWNTML 85

Query: 61  RGFAEKNEPIKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWE 120
           R F +K EP    +LYK ML + FLPNNYTFSF+L+ACA  S L  G++ HAQ +RLGWE
Sbjct: 86  RAFTDKKEPATVLSLYKYMLSTGFLPNNYTFSFLLQACAQLSDLSFGILLHAQAVRLGWE 145

Query: 121 SYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKM 180
           +YDFV NGLLHLYA+CNCMD AR+LFD SVNRDV++WT++INGYAKSGQ+ +ARQ+FD+M
Sbjct: 146 AYDFVQNGLLHLYASCNCMDSARRLFDGSVNRDVVTWTAVINGYAKSGQVVVARQLFDEM 205

Query: 181 PEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGR 240
           PEKNAVSWSAMI GY Q+ LF+EALE FN MQ+ GFRPNH  IVGALTACAFLGALDQGR
Sbjct: 206 PEKNAVSWSAMITGYAQIGLFREALELFNDMQIAGFRPNHGAIVGALTACAFLGALDQGR 265

Query: 241 WIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHD 300
           WIHAYVDRN + LD ILGTA+IDMYAKCGC+ETAC VFD M +RDVFA+TSLISGLANH 
Sbjct: 266 WIHAYVDRNRMVLDRILGTALIDMYAKCGCVETACRVFDEMLDRDVFAFTSLISGLANHG 325

Query: 301 QSASAIELFMRMQLEGVVPNE------------------------SMSEIYGIEPGVQHY 336
            SA+AIE+F RMQ EGV PNE                        SM+ IYGIEP VQHY
Sbjct: 326 HSATAIEMFTRMQNEGVCPNEVTFICLLSACSRVGLVEEGLRIFKSMTNIYGIEPVVQHY 385

Query: 337 GCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSL 396
           GCLVDLLGRAGMLE AK+VVREMP+EPD+YVLGALLNACRVHGDV+LGKETVE L ERSL
Sbjct: 386 GCLVDLLGRAGMLEDAKRVVREMPLEPDSYVLGALLNACRVHGDVELGKETVECLAERSL 445

Query: 397 DHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNV 456
           DH GVHVLLSN+YAS  QW  V KVR+GME+ +V+KVPGCSLIEVDG V EFV+G+ ++V
Sbjct: 446 DHGGVHVLLSNMYASANQWEDVAKVRKGMEEKKVKKVPGCSLIEVDGAVFEFVAGDMSHV 505

Query: 457 LMEEIVLLLFGIDKHLKSLCFFDDGNE 483
            M+EIVLLL GIDKHLKSL   DD N+
Sbjct: 506 FMDEIVLLLLGIDKHLKSLWSEDDDND 532




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296085795|emb|CBI31119.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|227462996|gb|ACP39950.1| pentatricopeptide repeat protein [Gossypium hirsutum] gi|227462998|gb|ACP39951.1| pentatricopeptide repeat protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224134663|ref|XP_002327460.1| predicted protein [Populus trichocarpa] gi|222836014|gb|EEE74435.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255570475|ref|XP_002526196.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534500|gb|EEF36200.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225425100|ref|XP_002272744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|413939596|gb|AFW74147.1| hypothetical protein ZEAMMB73_269656 [Zea mays] Back     alignment and taxonomy information
>gi|147832325|emb|CAN66581.1| hypothetical protein VITISV_030261 [Vitis vinifera] Back     alignment and taxonomy information
>gi|242063604|ref|XP_002453091.1| hypothetical protein SORBIDRAFT_04g038305 [Sorghum bicolor] gi|241932922|gb|EES06067.1| hypothetical protein SORBIDRAFT_04g038305 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|296088765|emb|CBI38215.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query498
TAIR|locus:1009023396612 AT5G40405 "AT5G40405" [Arabido 0.640 0.521 0.373 2.4e-89
TAIR|locus:2161018530 AT5G56310 "AT5G56310" [Arabido 0.640 0.601 0.349 2.2e-78
TAIR|locus:2121055559 AT4G38010 "AT4G38010" [Arabido 0.325 0.289 0.417 6.2e-75
TAIR|locus:2154855620 AT5G66520 "AT5G66520" [Arabido 0.640 0.514 0.421 2.2e-66
TAIR|locus:2159238499 AT5G61800 "AT5G61800" [Arabido 0.672 0.671 0.323 6.8e-65
TAIR|locus:2094812600 AT3G29230 "AT3G29230" [Arabido 0.391 0.325 0.370 7.1e-65
TAIR|locus:2045580559 AT2G42920 [Arabidopsis thalian 0.817 0.728 0.351 4.7e-64
TAIR|locus:2195296484 AT1G09190 "AT1G09190" [Arabido 0.638 0.657 0.307 6.1e-64
TAIR|locus:2150936623 AT5G15340 [Arabidopsis thalian 0.630 0.504 0.288 8.2e-64
TAIR|locus:2080898530 AT3G51320 [Arabidopsis thalian 0.624 0.586 0.312 8.8e-61
TAIR|locus:1009023396 AT5G40405 "AT5G40405" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 596 (214.9 bits), Expect = 2.4e-89, Sum P(2) = 2.4e-89
 Identities = 120/321 (37%), Positives = 190/321 (59%)

Query:     2 KQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIR 61
             K+++QI + L V GTL D   VG  +   + SD   L +  ++    +  T F  N+MIR
Sbjct:    20 KEVRQIHAKLYVDGTLKDDHLVGHFVKAVALSDHKYLDYANQILDRSEKPTLFALNSMIR 79

Query:    62 GFAEKNEPIKAFALYKQMLRS--DFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGW 119
                +   P K+F  Y+++L S  D  P+NYT +F+++AC        GL  H   IR G+
Sbjct:    80 AHCKSPVPEKSFDFYRRILSSGNDLKPDNYTVNFLVQACTGLRMRETGLQVHGMTIRRGF 139

Query:   120 ESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDK 179
             ++   V  GL+ LYA   C+D   K+F+     D +  T+++   A+ G +  AR++F+ 
Sbjct:   140 DNDPHVQTGLISLYAELGCLDSCHKVFNSIPCPDFVCRTAMVTACARCGDVVFARKLFEG 199

Query:   180 MPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQG 239
             MPE++ ++W+AMI+GY QV   +EAL  F+ MQL G + N   ++  L+AC  LGALDQG
Sbjct:   200 MPERDPIAWNAMISGYAQVGESREALNVFHLMQLEGVKVNGVAMISVLSACTQLGALDQG 259

Query:   240 RWIHAYVDRNGIELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANH 299
             RW H+Y++RN I++ + L T ++D+YAKCG +E A  VF  M  ++V+ ++S ++GLA +
Sbjct:   260 RWAHSYIERNKIKITVRLATTLVDLYAKCGDMEKAMEVFWGMEEKNVYTWSSALNGLAMN 319

Query:   300 DQSASAIELFMRMQLEGVVPN 320
                   +ELF  M+ +GV PN
Sbjct:   320 GFGEKCLELFSLMKQDGVTPN 340


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2161018 AT5G56310 "AT5G56310" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121055 AT4G38010 "AT4G38010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159238 AT5G61800 "AT5G61800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094812 AT3G29230 "AT3G29230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045580 AT2G42920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195296 AT1G09190 "AT1G09190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150936 AT5G15340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080898 AT3G51320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query498
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-88
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-71
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-42
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-38
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-31
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-29
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-27
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-05
pfam0153531 pfam01535, PPR, PPR repeat 8e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-05
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 5e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  287 bits (737), Expect = 3e-88
 Identities = 155/480 (32%), Positives = 240/480 (50%), Gaps = 62/480 (12%)

Query: 27  IGFCSA-----SDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLR 81
           +  C++       +G      ++F  ++ +    W  MI G+ +   P KA   Y  M +
Sbjct: 323 VSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQ 382

Query: 82  SDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDP 141
            +  P+  T + +L ACA    L VG+  H    R G  SY  V N L+ +Y+ C C+D 
Sbjct: 383 DNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDK 442

Query: 142 ARKLFDMSVNRDVISWTSLINGYAKSGQISIARQMFDKMPEKNAVSWSAMINGYVQVDLF 201
           A                                ++F  +PEK+ +SW+++I G    +  
Sbjct: 443 AL-------------------------------EVFHNIPEKDVISWTSIIAGLRLNNRC 471

Query: 202 KEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAI 261
            EAL  F  M L   +PN   ++ AL+ACA +GAL  G+ IHA+V R GI  D  L  A+
Sbjct: 472 FEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNAL 530

Query: 262 IDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNE 321
           +D+Y +CG +  A + F+S   +DV ++  L++G   H + + A+ELF RM   GV P+E
Sbjct: 531 LDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDE 589

Query: 322 ------------------------SMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVR 357
                                   SM E Y I P ++HY C+VDLLGRAG L  A   + 
Sbjct: 590 VTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFIN 649

Query: 358 EMPIEPDNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYASTEQWNG 417
           +MPI PD  V GALLNACR+H  V+LG+   + + E   +  G ++LL N+YA   +W+ 
Sbjct: 650 KMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDE 709

Query: 418 VEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKSLCF 477
           V +VR+ M +N +   PGCS +EV G V  F++ + ++  ++EI  +L G  + +K+   
Sbjct: 710 VARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGL 769


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 498
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.88
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.81
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.76
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.74
PRK14574 822 hmsH outer membrane protein; Provisional 99.74
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.73
KOG0547606 consensus Translocase of outer mitochondrial membr 99.72
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.65
KOG2076 895 consensus RNA polymerase III transcription factor 99.64
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.63
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.63
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.61
KOG1126638 consensus DNA-binding cell division cycle control 99.61
KOG2003840 consensus TPR repeat-containing protein [General f 99.6
KOG2076 895 consensus RNA polymerase III transcription factor 99.59
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.58
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.58
KOG1915677 consensus Cell cycle control protein (crooked neck 99.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.55
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.55
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.53
KOG2003840 consensus TPR repeat-containing protein [General f 99.53
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.52
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.51
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.51
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.5
KOG1126638 consensus DNA-binding cell division cycle control 99.5
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.46
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.42
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.41
KOG1129478 consensus TPR repeat-containing protein [General f 99.39
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.38
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.37
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.33
PF1304150 PPR_2: PPR repeat family 99.32
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.31
PF1304150 PPR_2: PPR repeat family 99.31
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.3
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.29
PRK12370553 invasion protein regulator; Provisional 99.28
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.28
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.26
PRK12370553 invasion protein regulator; Provisional 99.24
KOG0547606 consensus Translocase of outer mitochondrial membr 99.24
KOG1129478 consensus TPR repeat-containing protein [General f 99.23
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.21
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.2
PRK11189296 lipoprotein NlpI; Provisional 99.17
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.15
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.15
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.14
KOG2376652 consensus Signal recognition particle, subunit Srp 99.14
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.14
KOG1125579 consensus TPR repeat-containing protein [General f 99.12
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.11
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.07
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.06
KOG2376652 consensus Signal recognition particle, subunit Srp 99.05
PRK11189296 lipoprotein NlpI; Provisional 99.04
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.01
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.01
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.0
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.0
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.97
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.97
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.96
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.95
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.94
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.92
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.91
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.9
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.87
PRK10370198 formate-dependent nitrite reductase complex subuni 98.87
PRK15359144 type III secretion system chaperone protein SscB; 98.82
PRK04841903 transcriptional regulator MalT; Provisional 98.8
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.79
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.76
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.76
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.71
PRK15359144 type III secretion system chaperone protein SscB; 98.71
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.71
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.68
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.67
PLN02789320 farnesyltranstransferase 98.65
KOG1128777 consensus Uncharacterized conserved protein, conta 98.65
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.64
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.63
PF1285434 PPR_1: PPR repeat 98.61
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.59
PRK04841903 transcriptional regulator MalT; Provisional 98.58
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.57
PF1285434 PPR_1: PPR repeat 98.57
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.57
KOG1125579 consensus TPR repeat-containing protein [General f 98.57
PRK10370198 formate-dependent nitrite reductase complex subuni 98.55
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.53
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.51
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.5
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.47
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.46
PLN02789320 farnesyltranstransferase 98.45
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.43
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.41
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.41
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.41
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.38
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.36
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.36
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.33
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.31
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.29
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.24
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.23
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.18
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.18
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.16
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.15
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.09
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.09
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.07
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.05
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.05
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.04
KOG0553304 consensus TPR repeat-containing protein [General f 98.04
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.03
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.02
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.02
KOG0553304 consensus TPR repeat-containing protein [General f 98.01
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.99
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.97
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.94
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.93
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.91
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.91
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.86
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.86
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.86
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.85
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.84
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.79
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.77
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.77
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.77
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.76
PRK15331165 chaperone protein SicA; Provisional 97.75
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.72
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.72
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.71
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.67
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.67
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.66
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.63
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.62
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.6
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.6
PF1337173 TPR_9: Tetratricopeptide repeat 97.58
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.58
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.58
PF12688120 TPR_5: Tetratrico peptide repeat 97.53
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.52
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.51
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.5
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.5
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.41
COG4700251 Uncharacterized protein conserved in bacteria cont 97.39
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.34
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.33
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.32
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.29
PRK10803263 tol-pal system protein YbgF; Provisional 97.27
PF1337173 TPR_9: Tetratricopeptide repeat 97.27
PF12688120 TPR_5: Tetratrico peptide repeat 97.26
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.25
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.21
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.2
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.18
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.16
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.14
PF1343134 TPR_17: Tetratricopeptide repeat 97.13
PF1342844 TPR_14: Tetratricopeptide repeat 97.13
PRK10803263 tol-pal system protein YbgF; Provisional 97.1
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.1
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.1
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.07
COG4700251 Uncharacterized protein conserved in bacteria cont 97.03
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.99
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.98
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.98
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.96
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.93
PF13512142 TPR_18: Tetratricopeptide repeat 96.92
KOG20411189 consensus WD40 repeat protein [General function pr 96.88
COG3898531 Uncharacterized membrane-bound protein [Function u 96.86
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.81
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.78
KOG4555175 consensus TPR repeat-containing protein [Function 96.6
PRK11906458 transcriptional regulator; Provisional 96.47
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.46
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.45
KOG1585308 consensus Protein required for fusion of vesicles 96.44
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.41
KOG20411189 consensus WD40 repeat protein [General function pr 96.37
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.36
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.33
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.31
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.3
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.11
PRK11906458 transcriptional regulator; Provisional 96.02
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.97
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.93
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.89
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.89
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.76
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.76
PRK15331165 chaperone protein SicA; Provisional 95.76
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.72
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.7
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.67
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.58
KOG3941406 consensus Intermediate in Toll signal transduction 95.57
smart00299140 CLH Clathrin heavy chain repeat homology. 95.52
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.51
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.45
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.32
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.31
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.3
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.27
KOG3941406 consensus Intermediate in Toll signal transduction 95.14
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.95
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.93
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.89
KOG4234271 consensus TPR repeat-containing protein [General f 94.88
smart00299140 CLH Clathrin heavy chain repeat homology. 94.73
COG3898531 Uncharacterized membrane-bound protein [Function u 94.72
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.67
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.64
KOG4555175 consensus TPR repeat-containing protein [Function 94.54
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.45
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 94.41
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.38
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.03
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.93
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.7
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.67
KOG1258577 consensus mRNA processing protein [RNA processing 93.65
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.57
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.51
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.49
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.48
PRK09687280 putative lyase; Provisional 93.37
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 93.33
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.13
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.86
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 92.81
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.74
COG3629280 DnrI DNA-binding transcriptional activator of the 92.73
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 92.7
PF1342844 TPR_14: Tetratricopeptide repeat 92.69
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 92.57
PF13512142 TPR_18: Tetratricopeptide repeat 92.53
PRK09687280 putative lyase; Provisional 92.37
KOG1585308 consensus Protein required for fusion of vesicles 92.15
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.02
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.02
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.99
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.93
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.92
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.84
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 91.64
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.47
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.23
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.21
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.18
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.91
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.88
KOG4648 536 consensus Uncharacterized conserved protein, conta 90.87
COG3629280 DnrI DNA-binding transcriptional activator of the 90.28
KOG4570418 consensus Uncharacterized conserved protein [Funct 89.97
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.92
COG4105254 ComL DNA uptake lipoprotein [General function pred 89.63
KOG1586288 consensus Protein required for fusion of vesicles 89.54
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.48
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.32
KOG4234271 consensus TPR repeat-containing protein [General f 89.0
KOG3364149 consensus Membrane protein involved in organellar 88.76
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.6
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.25
PF1343134 TPR_17: Tetratricopeptide repeat 88.1
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.06
KOG4570418 consensus Uncharacterized conserved protein [Funct 87.87
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 87.84
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.79
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 87.77
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 87.05
PRK11619 644 lytic murein transglycosylase; Provisional 87.03
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 87.0
PRK10941269 hypothetical protein; Provisional 87.0
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.63
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 85.99
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 85.93
KOG1550552 consensus Extracellular protein SEL-1 and related 85.89
COG1747 711 Uncharacterized N-terminal domain of the transcrip 85.76
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 85.75
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 85.66
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 85.19
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 84.8
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.76
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 84.44
KOG1258577 consensus mRNA processing protein [RNA processing 84.22
PF13762145 MNE1: Mitochondrial splicing apparatus component 84.2
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 84.11
COG3947361 Response regulator containing CheY-like receiver a 84.1
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 83.96
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 83.74
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.49
cd0881988 CARD_MDA5_2 Caspase activation and recruitment dom 83.41
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 83.28
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.26
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 83.22
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 82.65
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 82.61
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.37
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 82.05
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 81.93
PF06552186 TOM20_plant: Plant specific mitochondrial import r 81.92
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 81.86
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.36
PF06552186 TOM20_plant: Plant specific mitochondrial import r 81.03
COG5159 421 RPN6 26S proteasome regulatory complex component [ 80.79
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 80.69
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 80.43
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 80.01
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=9.2e-75  Score=605.59  Aligned_cols=482  Identities=34%  Similarity=0.588  Sum_probs=452.1

Q ss_pred             chHhHHHHHHHHhCCCCChhHHHHHHHHhhcCCCCChhHHHHHhhhcCCCCcchHHHHHHHHHhCCCchHHHHHHHHhHH
Q 010881            2 KQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEPIKAFALYKQMLR   81 (498)
Q Consensus         2 ~~~~~~~~~~~~~g~~~~~~~~~~l~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~   81 (498)
                      +.++++|..+.+.|+.||+.++|+|+.+|+++  |+++.|.++|+.|+.+|+.+||++|.+|++.|++++|+++|++|.+
T Consensus       204 ~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~--g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~  281 (857)
T PLN03077        204 ARGREVHAHVVRFGFELDVDVVNALITMYVKC--GDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRE  281 (857)
T ss_pred             hhHHHHHHHHHHcCCCcccchHhHHHHHHhcC--CCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHH
Confidence            45788999999999999999999999999999  9999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcchHHHHHHHHHccCCcHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhCCChhhHHHHhhccCCCChhhHHHHH
Q 010881           82 SDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMSVNRDVISWTSLI  161 (498)
Q Consensus        82 ~~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~li  161 (498)
                      .|+.||..||+.++.+|++.|+++.+.+++..+.+.|+.||..+|++|+.+|+++|++++|.++|++|..||..+|+.+|
T Consensus       282 ~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li  361 (857)
T PLN03077        282 LSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMI  361 (857)
T ss_pred             cCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999888888888777


Q ss_pred             HHHHccCCHHHHHHHHhhC-------------------------------------------------------------
Q 010881          162 NGYAKSGQISIARQMFDKM-------------------------------------------------------------  180 (498)
Q Consensus       162 ~~~~~~~~~~~A~~~~~~~-------------------------------------------------------------  180 (498)
                      .+|++.|++++|.++|++|                                                             
T Consensus       362 ~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~  441 (857)
T PLN03077        362 SGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCID  441 (857)
T ss_pred             HHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHH
Confidence            7776666666555555554                                                             


Q ss_pred             ---------CCCChhHHHHHHHHHHhCCCHhHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHhCC
Q 010881          181 ---------PEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGI  251 (498)
Q Consensus       181 ---------~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~  251 (498)
                               .++|..+|+.+|.+|++.|+.++|+.+|++|.. ++.||..||+.++.+|++.|+++.+.+++..+.+.|+
T Consensus       442 ~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~  520 (857)
T PLN03077        442 KALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGI  520 (857)
T ss_pred             HHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCC
Confidence                     445666777777777777777777888888875 5899999999999999999999999999999999999


Q ss_pred             CCChhHHHHHHHHHHhcCCHHHHHHHHhhCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCc----------
Q 010881          252 ELDIILGTAIIDMYAKCGCIETACSVFDSMPNRDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNE----------  321 (498)
Q Consensus       252 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~----------  321 (498)
                      .++..++++|+++|+++|++++|.++|+.+ .+|..+||+||.+|++.|+.++|+++|++|.+.|+.||.          
T Consensus       521 ~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~  599 (857)
T PLN03077        521 GFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCAC  599 (857)
T ss_pred             CccceechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHH
Confidence            999999999999999999999999999999 899999999999999999999999999999999999998          


Q ss_pred             --------------hhhhhhCCCCChHHHHHHHHHHhhcCCHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHH
Q 010881          322 --------------SMSEIYGIEPGVQHYGCLVDLLGRAGMLEAAKKVVREMPIEPDNYVLGALLNACRVHGDVDLGKET  387 (498)
Q Consensus       322 --------------~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~  387 (498)
                                    .|...+|+.|+..+|+.++++|++.|++++|.+++++|+++||..+|++|+.+|..+|+.+.++..
T Consensus       600 ~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~  679 (857)
T PLN03077        600 SRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELA  679 (857)
T ss_pred             hhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHH
Confidence                          566688999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCCCchHHHHHHHHhHhcCCcchHHHHHHhhhhCCccccCceeEEEECCEEEEEeeCCCCCcchHHHHHHHHH
Q 010881          388 VESLVERSLDHEGVHVLLSNIYASTEQWNGVEKVRRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFG  467 (498)
Q Consensus       388 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  467 (498)
                      .+++.+++|+++..|..|+++|...|+|++|.++.+.|+++|+++.||+||+++++.+|.|..++.+||+.++|+..|+.
T Consensus       680 a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~  759 (857)
T PLN03077        680 AQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEG  759 (857)
T ss_pred             HHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCcccCCcccccc
Q 010881          468 IDKHLKSLCFFDDGNEVATE  487 (498)
Q Consensus       468 ~~~~~~~~g~~~~~~~~~~~  487 (498)
                      +.++|++.||.||+..|++.
T Consensus       760 l~~~~~~~g~~~~~~~~~~~  779 (857)
T PLN03077        760 FYEKMKASGLAGSESSSMDE  779 (857)
T ss_pred             HHHHHHhCCcCCCcchhccc
Confidence            99999999999999988753



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>cd08819 CARD_MDA5_2 Caspase activation and recruitment domain found in MDA5, second repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query498
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-06
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 54.9 bits (131), Expect = 5e-08
 Identities = 71/404 (17%), Positives = 119/404 (29%), Gaps = 129/404 (31%)

Query: 14  SGTLWDPFAVG-KII---GFCSASDIGDLSHGYRLFVCLQYRTTFIWNTMIRGFAEKNEP 69
           +   W+ F +  KI+    F   +D    +    + +          +         +E 
Sbjct: 255 NAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISL----------DHHSMTL-TPDEV 303

Query: 70  IKAFALYKQMLRSDFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLG---WESYDFV- 125
                 Y      D LP              T+   + +I  A+ IR G   W+++  V 
Sbjct: 304 KSLLLKYLDCRPQD-LPR--------EVL-TTNPRRLSII--AESIRDGLATWDNWKHVN 351

Query: 126 LNGLLHLYATC-NCMDPA--RKLF-DMSV-NRDV--------ISWT-------------- 158
            + L  +  +  N ++PA  RK+F  +SV             + W               
Sbjct: 352 CDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKL 411

Query: 159 ---SLINGYAKSGQISIARQMFD-KMPEKNAVSWSAMINGYVQVDLFKEALEHFNYMQLC 214
              SL+    K   ISI     + K+  +N            +  L +  ++H  Y    
Sbjct: 412 HKYSLVEKQPKESTISIPSIYLELKVKLEN------------EYALHRSIVDH--YNIPK 457

Query: 215 GFRPNHAGIVGALTACAFLGALDQ------GRWIHAYVDRNGIELDIILGTAIID---MY 265
            F  +                LDQ      G   H     +  E   +     +D   + 
Sbjct: 458 TFDSDDLIPP----------YLDQYFYSHIGH--HLKNIEHP-ERMTLFRMVFLDFRFLE 504

Query: 266 AKCGCIETACSVFDSMPN--RDVFAYTSLISGLANH---DQSASAIELFMRMQLEGVVPN 320
            K     TA +   S+ N  + +  Y   I    N    ++  +AI  F+          
Sbjct: 505 QKIRHDSTAWNASGSILNTLQQLKFYKPYIC--DNDPKYERLVNAILDFLP--------- 553

Query: 321 ESMSEIYGIEPGVQHYGCLVDLLGRAGM-------LEAAKKVVR 357
                   IE  +       DLL  A M        EA K+V R
Sbjct: 554 -------KIEENLICSKYT-DLLRIALMAEDEAIFEEAHKQVQR 589


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query498
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.84
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.82
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.82
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.78
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.77
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.76
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.75
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.73
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.69
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
3u4t_A272 TPR repeat-containing protein; structural genomics 99.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.63
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.62
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.62
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.61
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.61
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.61
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.6
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.6
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.6
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.58
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.57
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.56
3u4t_A272 TPR repeat-containing protein; structural genomics 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.56
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.55
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.54
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.52
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.51
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.49
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.48
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.48
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.47
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.46
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.44
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.43
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.43
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.41
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.4
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.39
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.33
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.32
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.32
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.31
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.31
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.3
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.29
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.29
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.23
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.2
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.18
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.16
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.14
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.12
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.12
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.11
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.09
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.09
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.08
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.06
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.05
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.0
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.0
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.99
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.99
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.98
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.97
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.96
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.94
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.94
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.94
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.9
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.89
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.88
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.87
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.86
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.86
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.86
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.85
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.83
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.83
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.82
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.82
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.81
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.8
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.78
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.77
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.76
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.75
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.75
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.74
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.73
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.72
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.72
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.72
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.71
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.7
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.68
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.68
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.68
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.66
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.65
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.64
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.63
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.62
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.6
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.6
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.6
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.59
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.58
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.58
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.58
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.57
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.54
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.51
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.51
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.51
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.5
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.49
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.49
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.47
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.46
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.45
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.43
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.41
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.41
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.41
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.38
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.36
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.35
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.34
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.34
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.34
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.33
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.32
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.31
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.31
3k9i_A117 BH0479 protein; putative protein binding protein, 98.3
3k9i_A117 BH0479 protein; putative protein binding protein, 98.27
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.27
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.27
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.27
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.26
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.25
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.25
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.23
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.2
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.2
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.15
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.14
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.07
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.05
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.04
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.02
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.01
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.98
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.95
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.87
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.81
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.79
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.74
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.73
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.72
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.69
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.68
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.53
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.51
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.5
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.48
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.47
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.41
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.41
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.39
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.28
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.16
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.13
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.97
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.93
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.93
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.9
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.81
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.78
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.71
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.46
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.32
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.17
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.09
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.97
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.44
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.38
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.26
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.14
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.88
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.41
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.4
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.98
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 93.86
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.2
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.2
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.49
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.38
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.16
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.11
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.68
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 89.78
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 89.57
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 89.43
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 88.98
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.59
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 88.49
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 88.02
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 87.95
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 87.48
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.44
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 87.44
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.29
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 86.98
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.08
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 85.76
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 85.53
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 85.49
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 85.48
2uwj_G115 Type III export protein PSCG; virulence, chaperone 84.56
2p58_C116 Putative type III secretion protein YSCG; type III 84.04
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 81.75
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 81.61
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 80.89
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 80.88
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=2.2e-37  Score=314.16  Aligned_cols=408  Identities=9%  Similarity=-0.075  Sum_probs=353.3

Q ss_pred             chHhHHHHHHHHhCCCCChhHHHHHHHHhhcCCCCChhHHHHHhhhc--CCCCcchHHHHHHHHHhCCCchHHHHHHHHh
Q 010881            2 KQIKQIQSHLTVSGTLWDPFAVGKIIGFCSASDIGDLSHGYRLFVCL--QYRTTFIWNTMIRGFAEKNEPIKAFALYKQM   79 (498)
Q Consensus         2 ~~~~~~~~~~~~~g~~~~~~~~~~l~~~~~~~~~g~~~~A~~~~~~~--~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m   79 (498)
                      ++|.+++..+.+.  .|+..++..++.+|.+.  |++++|..+|+.+  ..+++.+++.++.+|.+.|++++|+.+|+++
T Consensus       101 ~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~--g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~  176 (597)
T 2xpi_A          101 KCAAFVGEKVLDI--TGNPNDAFWLAQVYCCT--GDYARAKCLLTKEDLYNRSSACRYLAAFCLVKLYDWQGALNLLGET  176 (597)
T ss_dssp             HHHHHHHHHHHHH--HCCHHHHHHHHHHHHHT--TCHHHHHHHHHHTCGGGTCHHHHHHHHHHHHHTTCHHHHHHHHCSS
T ss_pred             hHHHHHHHHHHhh--CCCchHHHHHHHHHHHc--CcHHHHHHHHHHHhccccchhHHHHHHHHHHHHhhHHHHHHHHhcc
Confidence            4577788888754  57888889999999999  9999999999988  4678899999999999999999999999853


Q ss_pred             HHC---------------CCCCCcchHHHHHHHHHccCCcHHHHHHHHHHHHhCCCCchhHHH-----------------
Q 010881           80 LRS---------------DFLPNNYTFSFILRACADTSCLFVGLICHAQVIRLGWESYDFVLN-----------------  127 (498)
Q Consensus        80 ~~~---------------~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~-----------------  127 (498)
                      ...               +..++..+|+.++.+|.+.|++++|..+|+++.+.++. +...+.                 
T Consensus       177 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~~~~~~l~~~~~~~~~~~~~~~  255 (597)
T 2xpi_A          177 NPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CYEAFDQLVSNHLLTADEEWDLV  255 (597)
T ss_dssp             CTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHTTCSCHHHHHHHH
T ss_pred             CCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hhHHHHHHHHhhcccchhHHHHH
Confidence            221               22335778999999999999999999999999987643 223222                 


Q ss_pred             ---------------------HHHHHHHhCCChhhHHHHhhccCC--CChhhHHHHHHHHHccCCHHHHHHHHhhCCC--
Q 010881          128 ---------------------GLLHLYATCNCMDPARKLFDMSVN--RDVISWTSLINGYAKSGQISIARQMFDKMPE--  182 (498)
Q Consensus       128 ---------------------~l~~~~~~~g~~~~a~~~~~~~~~--~~~~~~~~li~~~~~~~~~~~A~~~~~~~~~--  182 (498)
                                           .++..|.+.|++++|.++|+++..  ++..+|+.++.+|.+.|++++|.++|+++.+  
T Consensus       256 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  335 (597)
T 2xpi_A          256 LKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID  335 (597)
T ss_dssp             HHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC
T ss_pred             HhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC
Confidence                                 225556678899999999999886  7889999999999999999999999998852  


Q ss_pred             -CChhHHHHHHHHHHhCCCHhHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHhCCCCChhHHHHH
Q 010881          183 -KNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDIILGTAI  261 (498)
Q Consensus       183 -~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l  261 (498)
                       .+..+++.++.++.+.|++++|..+++++.+.. +.+..++..++..|.+.|++++|..+|+.+.+.. +.+..+++.+
T Consensus       336 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l  413 (597)
T 2xpi_A          336 PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-PQFGPAWIGF  413 (597)
T ss_dssp             TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHH
T ss_pred             cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-CCCHHHHHHH
Confidence             367889999999999999999999999998653 5567889999999999999999999999998875 5678899999


Q ss_pred             HHHHHhcCCHHHHHHHHhhCCC---CChhHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCchhhhhhCCCCChHHHHH
Q 010881          262 IDMYAKCGCIETACSVFDSMPN---RDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGVQHYGC  338 (498)
Q Consensus       262 ~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~~~~~~~~~~~~~  338 (498)
                      +.+|.+.|++++|.++|+++.+   .+..+|+.++.+|.+.|++++|..+|+++.+.  .|+           +..+|+.
T Consensus       414 ~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~-----------~~~~~~~  480 (597)
T 2xpi_A          414 AHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYAL--FQY-----------DPLLLNE  480 (597)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHH--CCC-----------CHHHHHH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCC-----------ChHHHHH
Confidence            9999999999999999998753   47789999999999999999999999999875  232           6889999


Q ss_pred             HHHHHhhcCCHHHHHHHHHhC-------CCCCC--HHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCchHHHHHHHHh
Q 010881          339 LVDLLGRAGMLEAAKKVVREM-------PIEPD--NYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIY  409 (498)
Q Consensus       339 l~~~~~~~g~~~~A~~~~~~~-------~~~p~--~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~  409 (498)
                      ++.+|.+.|++++|.++|+++       +..|+  ..+|..++.+|.+.|++++|.+.++++++.+|+++.++..++.+|
T Consensus       481 l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~  560 (597)
T 2xpi_A          481 LGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVY  560 (597)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHH
T ss_pred             HHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHH
Confidence            999999999999999999988       44777  789999999999999999999999999999999999999999999


Q ss_pred             HhcCCcchHHHHHHhhhhCC
Q 010881          410 ASTEQWNGVEKVRRGMEDNE  429 (498)
Q Consensus       410 ~~~g~~~~a~~~~~~m~~~~  429 (498)
                      .+.|++++|.++++++.+..
T Consensus       561 ~~~g~~~~A~~~~~~~l~~~  580 (597)
T 2xpi_A          561 LHKKIPGLAITHLHESLAIS  580 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHC
T ss_pred             HHhCCHHHHHHHHHHHHhcC
Confidence            99999999999999998643



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query498
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.66
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.6
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.26
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.22
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.2
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.18
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.13
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.08
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.08
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.06
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.97
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.94
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.76
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.75
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.74
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.72
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.71
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.66
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.65
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.55
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.48
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.42
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.41
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.4
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.36
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.35
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.33
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.29
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.23
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.22
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.2
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.2
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.13
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.03
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.96
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.89
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.82
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.77
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.72
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.62
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.46
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.39
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.38
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.32
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.3
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.25
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.58
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.44
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.96
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.84
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.81
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.34
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.79
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.93
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.35
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 84.66
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=9.9e-22  Score=184.91  Aligned_cols=368  Identities=13%  Similarity=0.050  Sum_probs=293.9

Q ss_pred             HHHhhcCCCCChhHHHHHhhhcC--C-CCcchHHHHHHHHHhCCCchHHHHHHHHhHHCCCCC-CcchHHHHHHHHHccC
Q 010881           27 IGFCSASDIGDLSHGYRLFVCLQ--Y-RTTFIWNTMIRGFAEKNEPIKAFALYKQMLRSDFLP-NNYTFSFILRACADTS  102 (498)
Q Consensus        27 ~~~~~~~~~g~~~~A~~~~~~~~--~-~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~~~~p-~~~~~~~ll~~~~~~g  102 (498)
                      ...+-+.  |++++|.+.++++.  . .++.++..+...+.+.|++++|+..|+++.+.  .| +..++..+..++...|
T Consensus         6 a~~~~~~--G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~--~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           6 AHREYQA--GDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ--NPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             HHHHHHH--TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHc--CCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHhhhhc
Confidence            3445566  99999999998865  2 36778888999999999999999999999874  34 4567888889999999


Q ss_pred             CcHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhCCChhhHHHHhhcc---CCCChhhHHHHHHHHHccCCHHHHHHHHhh
Q 010881          103 CLFVGLICHAQVIRLGWESYDFVLNGLLHLYATCNCMDPARKLFDMS---VNRDVISWTSLINGYAKSGQISIARQMFDK  179 (498)
Q Consensus       103 ~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~---~~~~~~~~~~li~~~~~~~~~~~A~~~~~~  179 (498)
                      ++++|...+....+..+. +..............+....+.......   ..................+....+...+..
T Consensus        82 ~~~~A~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLK  160 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHH
T ss_pred             cccccccccccccccccc-cccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHH
Confidence            999999999999988754 3334444444455555555554444332   234555566666667777777777777665


Q ss_pred             CCC---CChhHHHHHHHHHHhCCCHhHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHhCCCCChh
Q 010881          180 MPE---KNAVSWSAMINGYVQVDLFKEALEHFNYMQLCGFRPNHAGIVGALTACAFLGALDQGRWIHAYVDRNGIELDII  256 (498)
Q Consensus       180 ~~~---~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~  256 (498)
                      ...   .+...+..+...+...|++++|...+++..+.. +-+...+..+...+...|++++|...+....... +.+..
T Consensus       161 ~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~  238 (388)
T d1w3ba_         161 AIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAV  238 (388)
T ss_dssp             HHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHH
T ss_pred             hhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHH
Confidence            542   256778888889999999999999999988753 2345577888888999999999999999988876 56777


Q ss_pred             HHHHHHHHHHhcCCHHHHHHHHhhCCC---CChhHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCchhhhhhCCCCCh
Q 010881          257 LGTAIIDMYAKCGCIETACSVFDSMPN---RDVFAYTSLISGLANHDQSASAIELFMRMQLEGVVPNESMSEIYGIEPGV  333 (498)
Q Consensus       257 ~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~~~~~~~~  333 (498)
                      .+..+..+|.+.|++++|...|+++.+   .+..+|..+...+...|++++|...++.....  .|           .+.
T Consensus       239 ~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~--~~-----------~~~  305 (388)
T d1w3ba_         239 VHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL--CP-----------THA  305 (388)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH--CT-----------TCH
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc--CC-----------ccc
Confidence            888899999999999999999987643   46678899999999999999999999998774  22           357


Q ss_pred             HHHHHHHHHHhhcCCHHHHHHHHHhC-CCCC-CHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCchHHHHHHHHhHh
Q 010881          334 QHYGCLVDLLGRAGMLEAAKKVVREM-PIEP-DNYVLGALLNACRVHGDVDLGKETVESLVERSLDHEGVHVLLSNIYAS  411 (498)
Q Consensus       334 ~~~~~l~~~~~~~g~~~~A~~~~~~~-~~~p-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~  411 (498)
                      ..+..+..++...|++++|...|++. ...| +..++..+...|...|++++|+..|+++++++|+++.++..++.+|.+
T Consensus       306 ~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~  385 (388)
T d1w3ba_         306 DSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE  385 (388)
T ss_dssp             HHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHH
T ss_pred             hhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHH
Confidence            88899999999999999999999987 6667 577888899999999999999999999999999999999999999988


Q ss_pred             cCC
Q 010881          412 TEQ  414 (498)
Q Consensus       412 ~g~  414 (498)
                      .|+
T Consensus       386 ~~D  388 (388)
T d1w3ba_         386 MQD  388 (388)
T ss_dssp             TCC
T ss_pred             cCC
Confidence            775



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure