Citrus Sinensis ID: 011254
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 490 | ||||||
| 118486313 | 539 | unknown [Populus trichocarpa] | 0.932 | 0.847 | 0.681 | 1e-173 | |
| 224105359 | 457 | predicted protein [Populus trichocarpa] | 0.928 | 0.995 | 0.683 | 1e-173 | |
| 255543747 | 501 | ATP binding protein, putative [Ricinus c | 0.981 | 0.960 | 0.635 | 1e-172 | |
| 225428414 | 488 | PREDICTED: ATP-dependent zinc metallopro | 0.946 | 0.950 | 0.605 | 1e-166 | |
| 225428416 | 494 | PREDICTED: ATP-dependent zinc metallopro | 0.959 | 0.951 | 0.605 | 1e-165 | |
| 255561048 | 528 | ATP binding protein, putative [Ricinus c | 0.963 | 0.893 | 0.559 | 1e-162 | |
| 225431310 | 522 | PREDICTED: uncharacterized protein LOC10 | 0.918 | 0.862 | 0.557 | 1e-154 | |
| 449520948 | 480 | PREDICTED: uncharacterized protein LOC10 | 0.918 | 0.937 | 0.558 | 1e-150 | |
| 449520946 | 501 | PREDICTED: uncharacterized protein LOC10 | 0.918 | 0.898 | 0.558 | 1e-150 | |
| 449464546 | 480 | PREDICTED: uncharacterized protein LOC10 | 0.918 | 0.937 | 0.556 | 1e-149 |
| >gi|118486313|gb|ABK94998.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 615 bits (1586), Expect = e-173, Method: Compositional matrix adjust.
Identities = 314/461 (68%), Positives = 381/461 (82%), Gaps = 4/461 (0%)
Query: 2 SLNTTQMLSTTTIVSAAASAAATAMVIRSITHDYLPFEVRAYFAVKLKSLLARFSSELTL 61
S + TQ+ S T++SAAASAAAT ++ RS+ ++LP+E ++Y KLK+L+ FSSE TL
Sbjct: 4 SSSATQIPSAKTMISAAASAAATIVLFRSLVKEHLPYEFQSYIFYKLKTLINSFSSEFTL 63
Query: 62 VINEYDDGLNQNVLFKAAKLYLEPRIPPYVKRIKINLPNKETKISCSVEKDEEIVDVFNG 121
VI EYD+ LN N LFKAA+LYLEP IPP K++KI+L KE+K S S+++++EIVD FNG
Sbjct: 64 VIEEYDN-LNHNNLFKAAELYLEPIIPPDAKKLKISLTKKESKFSFSLDRNQEIVDTFNG 122
Query: 122 VQLKWRFSSKQVPTEMVHHPDHYNPVVKSEDRCFELSFHKKYKQVVMDSYIPHVLKQSKE 181
+ LKW+F SKQVP + + PD++N + KSED+ FELSFHKK+K VV+D Y+ HV+++SKE
Sbjct: 123 ITLKWKFISKQVPIKYIPSPDNFNSMPKSEDKFFELSFHKKHKDVVIDVYLKHVIEKSKE 182
Query: 182 TSTQKKTLKLFTLRYDRMHGMRGDVWQSVNLDHPATFDTLAMDSDMKQMIMDDLERFVKR 241
T +KK+LKLF+LR+DRM G RGDVWQSVNL HPATFDTLAMD + K++IM+DLERFVKR
Sbjct: 183 TKEEKKSLKLFSLRHDRMSGRRGDVWQSVNLHHPATFDTLAMDMEGKRVIMEDLERFVKR 242
Query: 242 KEFYRNVGKAWKRGYLLYGPPGTGKSSLIAAMANYLNFDVYDLELTNLRGNMELRNLLIA 301
+EFYR VGKAWKRGYLL+GPPGTGKSSLIAA+ANYL FD+YDLELT+LR N ELRNLLI+
Sbjct: 243 REFYRRVGKAWKRGYLLFGPPGTGKSSLIAAIANYLKFDIYDLELTDLRTNSELRNLLIS 302
Query: 302 TENKSILVVEDIDCSIELQDRFAKAKATNAMDLNVIQPVMNLNQVPQVTLSGMLNFIDGL 361
TENKS+LVVEDIDCSIELQDR A+A+ AM + P N QVTLSG+LNF+DGL
Sbjct: 303 TENKSVLVVEDIDCSIELQDRLAQAR---AMMPSRHHPPYNQANQYQVTLSGLLNFVDGL 359
Query: 362 WSSCGDERIIIFTTNHKDRLDPAFLRPGRMDVHIHMSYCTSCGFKMLASSYLGITEHPLF 421
WSSCGDERIIIFTTNHK+RLDPA LRPGRMDVHIHMSYCT CGFK+LAS+YLG TEHPLF
Sbjct: 360 WSSCGDERIIIFTTNHKERLDPALLRPGRMDVHIHMSYCTPCGFKLLASNYLGFTEHPLF 419
Query: 422 LEVEGLIEKAKVTPADVAEQLMRNEVPEIALRELIQFLEIK 462
VE LIEKA+VTPA+V EQL+R E PE A+ LI+FLE K
Sbjct: 420 PCVEALIEKARVTPAEVGEQLLRYEEPESAITGLIEFLEDK 460
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224105359|ref|XP_002313783.1| predicted protein [Populus trichocarpa] gi|222850191|gb|EEE87738.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255543747|ref|XP_002512936.1| ATP binding protein, putative [Ricinus communis] gi|223547947|gb|EEF49439.1| ATP binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225428414|ref|XP_002283754.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225428416|ref|XP_002283761.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255561048|ref|XP_002521536.1| ATP binding protein, putative [Ricinus communis] gi|223539214|gb|EEF40807.1| ATP binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225431310|ref|XP_002269184.1| PREDICTED: uncharacterized protein LOC100241950 [Vitis vinifera] gi|147815615|emb|CAN63838.1| hypothetical protein VITISV_041357 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449520948|ref|XP_004167494.1| PREDICTED: uncharacterized protein LOC101229933 isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449520946|ref|XP_004167493.1| PREDICTED: uncharacterized protein LOC101229933 isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449464546|ref|XP_004149990.1| PREDICTED: uncharacterized protein LOC101205613 isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 490 | ||||||
| TAIR|locus:2077997 | 576 | BCS1 "cytochrome BC1 synthesis | 0.885 | 0.753 | 0.536 | 3.4e-128 | |
| TAIR|locus:2078007 | 451 | AT3G50940 [Arabidopsis thalian | 0.855 | 0.929 | 0.503 | 3.3e-111 | |
| TAIR|locus:1005716649 | 495 | AT2G18193 [Arabidopsis thalian | 0.840 | 0.832 | 0.486 | 3.2e-104 | |
| TAIR|locus:2053109 | 494 | AT2G18190 [Arabidopsis thalian | 0.848 | 0.842 | 0.461 | 1e-98 | |
| TAIR|locus:2175986 | 505 | AT5G17760 [Arabidopsis thalian | 0.851 | 0.825 | 0.462 | 2e-97 | |
| TAIR|locus:2175956 | 533 | AT5G17740 [Arabidopsis thalian | 0.867 | 0.797 | 0.452 | 1.4e-96 | |
| TAIR|locus:2175946 | 470 | AT5G17730 [Arabidopsis thalian | 0.857 | 0.893 | 0.434 | 7.6e-96 | |
| TAIR|locus:505006520 | 506 | AT4G25835 [Arabidopsis thalian | 0.883 | 0.855 | 0.409 | 3.9e-83 | |
| TAIR|locus:2098658 | 530 | AT3G28510 [Arabidopsis thalian | 0.887 | 0.820 | 0.396 | 1.7e-82 | |
| TAIR|locus:2095512 | 500 | AT3G28580 [Arabidopsis thalian | 0.842 | 0.826 | 0.412 | 4.5e-82 |
| TAIR|locus:2077997 BCS1 "cytochrome BC1 synthesis" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1221 (434.9 bits), Expect = 3.4e-128, Sum P(2) = 3.4e-128
Identities = 237/442 (53%), Positives = 314/442 (71%)
Query: 26 MVIRSITHDYLPFEVRAYFAVKLKSLLARFSSELTLVINEYDDGLNQNVLFKAAKLYLEP 85
M+ RS+ DYLP EV Y + +S+ FSS++T++I E++ G N +F+AA+ YL
Sbjct: 73 MLARSLVQDYLPDEVHHYISYGFRSIFGYFSSQMTIIIEEFE-GFAHNEVFEAAEAYLAT 131
Query: 86 RIPPYVKRIKINLPNKETKISCSVEKDEEIVDVFNGVQLKWRFSSKQVPTEMVHHPDHYN 145
+I P KRIK++ KE + +VE+DEE+VD +NGV+ +W + V ++ H+P N
Sbjct: 132 KISPSNKRIKVSKHEKENNYNVTVERDEEVVDTYNGVKFQWILHCRHVESKHFHNPRDLN 191
Query: 146 PVVKSEDRCFELSFHKKYKQVVMDSYIPHVXXXXXXXXXXXXXXXXFTLRYDRMHGMRGD 205
++SE R FEL+FHKK+K V ++SY+P + FTL + M+G D
Sbjct: 192 STLRSEVRSFELNFHKKFKDVALESYLPFMVKRATLMKQEKKTLKIFTLSPENMYGNYSD 251
Query: 206 VWQSVNLDHPATFDTLAMDSDMKQMIMDDLERFVKRKEFYRNVGKAWKRGYLLYGPPGTG 265
W SV LDHP+TF TLAMDSD+K +M+DL++FVKR++FY+ VGKAWKRGYLLYGPPGTG
Sbjct: 252 AWTSVTLDHPSTFKTLAMDSDVKTSVMEDLDKFVKRRDFYKRVGKAWKRGYLLYGPPGTG 311
Query: 266 KSSLIAAMANYLNFDVYDLELTNLRGNMELRNLLIATENKSILVVEDIDCSIELQDRFAK 325
KSSLIAAMAN+LNFD+YDLELT + N ELR LLIAT N+SIL+VEDIDCS+EL+DR +
Sbjct: 312 KSSLIAAMANHLNFDIYDLELTAVNNNSELRRLLIATANRSILIVEDIDCSLELKDRTSD 371
Query: 326 AKATNAMDLNVIQPVMNLNQVPQVTLSGMLNFIDGLWSSCGDERIIIFTTNHKDRLDPAF 385
+ D+ P + +VTLSG+LNFIDGLWSSCGDERIIIFTTN+K++LD A
Sbjct: 372 EPPRESDDIE--DP-----RYKKVTLSGLLNFIDGLWSSCGDERIIIFTTNYKEKLDAAL 424
Query: 386 LRPGRMDVHIHMSYCTSCGFKMLASSYLGITEHPLFLEVEGLIEKAKVTPADVAEQLMRN 445
LRPGRMD+HIHMSYCT FK LA +YL I EH LF ++E IE +VTPA+VAEQLMRN
Sbjct: 425 LRPGRMDMHIHMSYCTPSTFKALALNYLEIKEHRLFSKIEEGIEATEVTPAEVAEQLMRN 484
Query: 446 EVPEIALRELIQFLEIKRRESD 467
+ + L LI+FL++K+ E++
Sbjct: 485 DSVDKVLEGLIEFLKVKKIENE 506
|
|
| TAIR|locus:2078007 AT3G50940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716649 AT2G18193 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053109 AT2G18190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175986 AT5G17760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175956 AT5G17740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175946 AT5G17730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006520 AT4G25835 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098658 AT3G28510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2095512 AT3G28580 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.IX.1704.1 | SubName- Full=Putative uncharacterized protein; (457 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 490 | |||
| pfam14363 | 100 | pfam14363, AAA_assoc, Domain associated at C-termi | 4e-26 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 5e-19 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 2e-15 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 3e-11 | |
| CHL00176 | 638 | CHL00176, ftsH, cell division protein; Validated | 7e-10 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 8e-10 | |
| PTZ00361 | 438 | PTZ00361, PTZ00361, 26 proteosome regulatory subun | 1e-09 | |
| TIGR01242 | 364 | TIGR01242, 26Sp45, 26S proteasome subunit P45 fami | 3e-09 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 3e-09 | |
| TIGR03689 | 512 | TIGR03689, pup_AAA, proteasome ATPase | 5e-09 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 6e-09 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 1e-08 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 3e-08 | |
| TIGR01241 | 495 | TIGR01241, FtsH_fam, ATP-dependent metalloprotease | 5e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-06 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 1e-05 | |
| COG0465 | 596 | COG0465, HflB, ATP-dependent Zn proteases [Posttra | 3e-05 | |
| PRK08116 | 268 | PRK08116, PRK08116, hypothetical protein; Validate | 6e-04 | |
| PRK13342 | 413 | PRK13342, PRK13342, recombination factor protein R | 7e-04 | |
| PRK08939 | 306 | PRK08939, PRK08939, primosomal protein DnaI; Revie | 0.001 | |
| PRK06851 | 367 | PRK06851, PRK06851, hypothetical protein; Provisio | 0.002 | |
| pfam13207 | 114 | pfam13207, AAA_17, AAA domain | 0.002 | |
| COG2256 | 436 | COG2256, MGS1, ATPase related to the helicase subu | 0.002 | |
| COG1484 | 254 | COG1484, DnaC, DNA replication protein [DNA replic | 0.002 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 0.003 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 0.003 |
| >gnl|CDD|222710 pfam14363, AAA_assoc, Domain associated at C-terminal with AAA | Back alignment and domain information |
|---|
Score = 101 bits (254), Expect = 4e-26
Identities = 38/101 (37%), Positives = 60/101 (59%), Gaps = 4/101 (3%)
Query: 35 YLPFEVRAYFAVKLKSLLA-RFSSELTLVINEYDDGLNQNVLFKAAKLYLEPRIPPYVKR 93
LP E+R Y + L+ L RFS LT+VI+EYD G ++N L+ AA+ YL +I P +R
Sbjct: 1 LLPHELREYLSSLLRRLFGSRFSPYLTIVIDEYD-GFSRNQLYDAAEAYLSTKISPSARR 59
Query: 94 IKINLP--NKETKISCSVEKDEEIVDVFNGVQLKWRFSSKQ 132
+K + +K + + S++ EE+ DVF GV++ W +
Sbjct: 60 LKASKAKKSKNSSLVLSLDDGEEVTDVFEGVKVWWTSVVTE 100
|
This domain is found in association with the AAA family, pfam00004. Length = 100 |
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236353 PRK08939, PRK08939, primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235878 PRK06851, PRK06851, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221983 pfam13207, AAA_17, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 490 | |||
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 100.0 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 100.0 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 100.0 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 100.0 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 100.0 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 100.0 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 100.0 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 100.0 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 100.0 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 100.0 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 100.0 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 100.0 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 100.0 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.98 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 99.98 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.98 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.97 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.97 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 99.97 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.97 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.97 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.97 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 99.97 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.97 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.97 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 99.96 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 99.96 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.96 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.96 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.96 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.95 | |
| PF14363 | 98 | AAA_assoc: Domain associated at C-terminal with AA | 99.95 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 99.94 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.94 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 99.93 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 99.93 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 99.92 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 99.89 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 99.84 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 99.83 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 99.78 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 99.77 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.76 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 99.75 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 99.74 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.73 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 99.72 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 99.71 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 99.71 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 99.71 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 99.68 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 99.67 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 99.67 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 99.67 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 99.65 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 99.65 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 99.64 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 99.64 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 99.63 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 99.63 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 99.63 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 99.62 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.61 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 99.61 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 99.6 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 99.6 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 99.6 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 99.6 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 99.6 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 99.6 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 99.59 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 99.59 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 99.59 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 99.58 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 99.58 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 99.58 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 99.58 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 99.58 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 99.57 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 99.57 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 99.57 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 99.57 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 99.56 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 99.56 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 99.55 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 99.54 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 99.54 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 99.53 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 99.53 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.53 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 99.53 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 99.53 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 99.53 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 99.52 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 99.52 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 99.52 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 99.51 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 99.51 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.51 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 99.51 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.5 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.5 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.5 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 99.5 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.49 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 99.49 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 99.48 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 99.48 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 99.48 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 99.48 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 99.48 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.47 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 99.46 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 99.46 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 99.46 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 99.46 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.44 | |
| PRK08727 | 233 | hypothetical protein; Validated | 99.44 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 99.43 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.43 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 99.42 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 99.42 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 99.41 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.41 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 99.39 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 99.38 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 99.38 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 99.37 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.36 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 99.36 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 99.36 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 99.36 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 99.35 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 99.35 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 99.34 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 99.32 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.32 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 99.32 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 99.31 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 99.3 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 99.29 | |
| PRK06620 | 214 | hypothetical protein; Validated | 99.29 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 99.28 | |
| PHA02244 | 383 | ATPase-like protein | 99.28 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 99.28 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.27 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 99.27 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 99.27 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 99.26 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.24 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.23 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 99.21 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 99.21 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.2 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 99.2 | |
| PRK09087 | 226 | hypothetical protein; Validated | 99.19 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 99.18 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 99.15 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 99.15 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 99.13 | |
| PRK08116 | 268 | hypothetical protein; Validated | 99.12 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 99.11 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 99.1 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 99.09 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 99.07 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 99.06 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 99.05 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 99.04 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 99.04 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 99.04 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 99.03 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 99.03 | |
| PRK12377 | 248 | putative replication protein; Provisional | 99.03 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 99.01 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 99.0 | |
| PRK08181 | 269 | transposase; Validated | 98.99 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 98.95 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 98.93 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 98.91 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 98.9 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 98.9 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 98.89 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 98.88 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 98.88 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 98.88 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 98.85 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 98.85 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 98.84 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 98.82 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 98.82 | |
| PRK06526 | 254 | transposase; Provisional | 98.81 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 98.79 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 98.78 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 98.78 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 98.78 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 98.77 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 98.76 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 98.76 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 98.76 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 98.76 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 98.76 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 98.74 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 98.73 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 98.71 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 98.69 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 98.66 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 98.62 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 98.61 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 98.6 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 98.6 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.59 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 98.59 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.58 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 98.57 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 98.57 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 98.54 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 98.53 | |
| PHA02624 | 647 | large T antigen; Provisional | 98.52 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.52 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 98.51 | |
| PRK05818 | 261 | DNA polymerase III subunit delta'; Validated | 98.51 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 98.5 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 98.48 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 98.45 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 98.43 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 98.41 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 98.4 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.4 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 98.4 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 98.39 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 98.38 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 98.38 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 98.37 | |
| KOG0990 | 360 | consensus Replication factor C, subunit RFC5 [Repl | 98.37 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 98.35 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 98.33 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.31 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 98.26 | |
| KOG1968 | 871 | consensus Replication factor C, subunit RFC1 (larg | 98.22 | |
| KOG0478 | 804 | consensus DNA replication licensing factor, MCM4 c | 98.22 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 98.21 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 98.2 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 98.2 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.16 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 98.15 | |
| PHA02774 | 613 | E1; Provisional | 98.14 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 98.14 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 98.12 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 98.11 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 98.07 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 98.06 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.04 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 98.03 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 97.96 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.95 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 97.92 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 97.92 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 97.9 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.89 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 97.88 | |
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 97.87 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 97.83 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 97.83 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 97.82 | |
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 97.82 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 97.8 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.76 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.75 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 97.73 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.73 | |
| COG1241 | 682 | MCM2 Predicted ATPase involved in replication cont | 97.71 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.7 | |
| KOG2680 | 454 | consensus DNA helicase TIP49, TBP-interacting prot | 97.69 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.67 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 97.67 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.65 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.65 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 97.63 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.62 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.61 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 97.61 | |
| PRK03839 | 180 | putative kinase; Provisional | 97.59 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 97.59 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.58 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.58 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 97.57 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 97.57 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.56 | |
| PF08740 | 187 | BCS1_N: BCS1 N terminal; InterPro: IPR014851 AAA A | 97.55 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 97.55 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 97.54 | |
| PF05272 | 198 | VirE: Virulence-associated protein E; InterPro: IP | 97.53 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 97.53 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 97.53 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.52 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 97.48 | |
| COG3604 | 550 | FhlA Transcriptional regulator containing GAF, AAA | 97.48 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 97.47 | |
| COG1485 | 367 | Predicted ATPase [General function prediction only | 97.46 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 97.44 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.44 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 97.44 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 97.44 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 97.44 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.43 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 97.43 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 97.43 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.42 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 97.41 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 97.39 | |
| PRK06217 | 183 | hypothetical protein; Validated | 97.39 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 97.39 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 97.39 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 97.39 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.38 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 97.38 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 97.37 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 97.37 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 97.37 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 97.36 | |
| PTZ00202 | 550 | tuzin; Provisional | 97.36 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.36 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.34 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 97.33 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 97.32 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 97.31 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 97.3 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 97.3 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 97.29 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 97.29 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 97.26 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 97.25 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 97.24 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 97.24 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 97.23 | |
| PRK06581 | 263 | DNA polymerase III subunit delta'; Validated | 97.23 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 97.2 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 97.2 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.2 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 97.19 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 97.19 | |
| KOG0480 | 764 | consensus DNA replication licensing factor, MCM6 c | 97.19 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 97.19 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 97.19 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 97.18 | |
| PF13479 | 213 | AAA_24: AAA domain | 97.17 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 97.17 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 97.16 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 97.16 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 97.16 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.15 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.14 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 97.13 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.13 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 97.13 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 97.13 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 97.12 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 97.11 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.09 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.08 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.08 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 97.07 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 97.07 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 97.07 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 97.06 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 97.04 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 97.04 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.02 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 97.0 | |
| PLN02200 | 234 | adenylate kinase family protein | 97.0 | |
| COG4650 | 531 | RtcR Sigma54-dependent transcription regulator con | 97.0 | |
| PRK13764 | 602 | ATPase; Provisional | 97.0 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.0 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 97.0 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.0 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 96.98 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 96.97 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.96 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 96.95 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 96.95 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 96.94 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 96.93 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 96.93 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 96.93 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.92 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 96.91 | |
| KOG0482 | 721 | consensus DNA replication licensing factor, MCM7 c | 96.91 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 96.91 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 96.91 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 96.9 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 96.89 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 96.89 | |
| PLN02199 | 303 | shikimate kinase | 96.89 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 96.89 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 96.88 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 96.88 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 96.87 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 96.87 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 96.86 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.86 | |
| PF06431 | 417 | Polyoma_lg_T_C: Polyomavirus large T antigen C-ter | 96.85 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 96.85 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 96.84 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.83 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 96.82 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 96.8 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 96.79 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 96.78 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 96.78 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 96.78 | |
| TIGR01613 | 304 | primase_Cterm phage/plasmid primase, P4 family, C- | 96.78 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 96.78 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 96.77 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 96.76 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 96.75 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 96.74 | |
| KOG2383 | 467 | consensus Predicted ATPase [General function predi | 96.72 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 96.72 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 96.69 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.68 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 96.68 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 96.67 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 96.67 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 96.66 | |
| KOG0477 | 854 | consensus DNA replication licensing factor, MCM2 c | 96.65 | |
| COG3378 | 517 | Phage associated DNA primase [General function pre | 96.63 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 96.63 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 96.63 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 96.61 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.6 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 96.6 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 96.6 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 96.57 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 96.56 | |
| PF10236 | 309 | DAP3: Mitochondrial ribosomal death-associated pro | 96.55 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 96.55 | |
| PF00488 | 235 | MutS_V: MutS domain V C-terminus.; InterPro: IPR00 | 96.55 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 96.55 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.54 | |
| KOG3354 | 191 | consensus Gluconate kinase [Carbohydrate transport | 96.53 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 96.53 | |
| PLN02674 | 244 | adenylate kinase | 96.52 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 96.52 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.49 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.48 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 96.47 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 96.47 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 96.46 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 96.46 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 96.46 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 96.45 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.44 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 96.44 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 96.42 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 96.42 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 96.41 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 96.41 | |
| PHA00350 | 399 | putative assembly protein | 96.4 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 96.4 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 96.4 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 96.4 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 96.39 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 96.39 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.39 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 96.38 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.37 | |
| PLN02459 | 261 | probable adenylate kinase | 96.37 | |
| PF00519 | 432 | PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 | 96.37 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 96.36 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 96.34 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 96.34 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 96.32 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 96.32 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 96.32 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 96.31 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.31 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 96.31 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 96.29 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 96.29 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 96.27 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 96.26 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 96.26 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 96.25 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 96.25 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 96.25 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 96.24 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 96.23 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 96.23 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.22 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 96.22 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 96.21 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 96.21 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 96.21 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 96.19 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 96.19 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.17 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 96.16 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 96.16 |
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-105 Score=808.89 Aligned_cols=436 Identities=50% Similarity=0.843 Sum_probs=408.1
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHhcccCCceEEEEeecCCCCCccHHHHHHHHHhCCCCCcccc
Q 011254 13 TIVSAAASAAATAMVIRSITHDYLPFEVRAYFAVKLKSLLARFSSELTLVINEYDDGLNQNVLFKAAKLYLEPRIPPYVK 92 (490)
Q Consensus 13 ~~~~~~~S~~a~~~~~~~~~~~~~P~~l~~~~~~~~~~l~~~~~~~~ti~i~e~~~~~~~N~ly~a~~~YL~t~~~~~~~ 92 (490)
++|+++||++|++||+|+|+++++|.+++.||.+++++|++.+++|.++.|.|+ +|+.+|++|.|+|.||++++++.++
T Consensus 2 ~~~~~~~s~~~~~~~~~~~~~~~~p~~~~~y~~~~~~~l~g~~s~~~~~~~~e~-~g~~~n~~~~aie~yl~~k~~~~~~ 80 (457)
T KOG0743|consen 2 SVFTAYASLLGSLMFIKSMLQDIIPPSINPYFISALRGLFGVFSSYALIRIGEQ-DGVFRNQLYVAIEVYLSSKSSAIAK 80 (457)
T ss_pred CccchhHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHhhccCcccEEEEeehh-ccchHHHHHHHHHHhhhccchhhhh
Confidence 578999999999999999999999999999999999999999999999999999 7899999999999999999999999
Q ss_pred eeEeecCCCCCceEEeccCCCeEEEeecCeEEEEEEEEecCCCCccCCCCCCCCCCCCCceEEEEEecccchHHHHHHhH
Q 011254 93 RIKINLPNKETKISCSVEKDEEIVDVFNGVQLKWRFSSKQVPTEMVHHPDHYNPVVKSEDRCFELSFHKKYKQVVMDSYI 172 (490)
Q Consensus 93 rl~~~~~~~~~~~~~~~~~~~~v~D~f~G~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~f~~~~~~~v~~~yl 172 (490)
||+.+...+++++++.++++++|.|+|+||+++|.+++..++.+.+. ....+.|+|+|+|+++||+.|+.+||
T Consensus 81 rl~~~~~~~s~~~~l~~~~~~~i~d~f~gv~~~w~~~~~~~~~~~~~-------~~~~~~r~~~L~f~k~~~e~V~~syl 153 (457)
T KOG0743|consen 81 RLTQNLSKNSKSLVLGLDDNEEISDEFEGVPVKWRHFVDYNEKWIFV-------EREREKRYFELTFHKKPRELVTLSYL 153 (457)
T ss_pred hhhhhhccccccceEEecCCcEEEEEEeceEEEEEEEEEecCccccc-------ccCCcceEEEEEecCccHHHhHHhHH
Confidence 99999999999999999999999999999999999998876665433 13468999999999999999999999
Q ss_pred HHHHHhchhhhcccceEEEEeecccc-ccCCCCCcceecccCCCCCccccccChhHHHHHHHHHHHHHHcHHHHHHhCCC
Q 011254 173 PHVLKQSKETSTQKKTLKLFTLRYDR-MHGMRGDVWQSVNLDHPATFDTLAMDSDMKQMIMDDLERFVKRKEFYRNVGKA 251 (490)
Q Consensus 173 ~~v~~~~~~i~~~~~~~~l~~~~~~~-~~~~~~~~w~~~~~~~~~~f~~l~g~~~~k~~i~~~l~~~l~~~~~y~~~g~~ 251 (490)
+++..++++|..+++.+++|+++.+. +++..+..|+++.|+||+||++|+|++++|++|++|+..|+++++||+++|+|
T Consensus 154 ~~v~~~~k~I~~~~r~~kl~t~~~~~~~~~~~~~~W~~v~f~HpstF~TlaMd~~~K~~I~~Dl~~F~k~k~~YkrvGka 233 (457)
T KOG0743|consen 154 PYVVSKAKEILEENRELKLYTNSGKTVIYTAKGGEWRSVGFPHPSTFETLAMDPDLKERIIDDLDDFIKGKDFYKRVGKA 233 (457)
T ss_pred HHHHHHHHHHHHHHHHHHHhhcCCCcccccccCCcceecCCCCCCCccccccChhHHHHHHHHHHHHHhcchHHHhcCcc
Confidence 99999999999999999999997654 55556789999999999999999999999999999999999999999999999
Q ss_pred CCcceeeeCCCCCcHHHHHHHHHHhccCcEEEEeccccCChHHHHHHHHhccCCeEEEEeccchhhhhhhhHhhhhhccc
Q 011254 252 WKRGYLLYGPPGTGKSSLIAAMANYLNFDVYDLELTNLRGNMELRNLLIATENKSILVVEDIDCSIELQDRFAKAKATNA 331 (490)
Q Consensus 252 ~~rg~LL~GPpGtGKT~la~aiA~~l~~~~~~l~~s~~~~~~~l~~l~~~~~~~sIl~iDdiD~l~~~~~r~~~~~~~~~ 331 (490)
|+||||||||||||||||++||||+|+++||+++++++..+++|++++..++++||||||||||.+.++++..+.....
T Consensus 234 wKRGYLLYGPPGTGKSS~IaAmAn~L~ydIydLeLt~v~~n~dLr~LL~~t~~kSIivIEDIDcs~~l~~~~~~~~~~~- 312 (457)
T KOG0743|consen 234 WKRGYLLYGPPGTGKSSFIAAMANYLNYDIYDLELTEVKLDSDLRHLLLATPNKSILLIEDIDCSFDLRERRKKKKENF- 312 (457)
T ss_pred hhccceeeCCCCCCHHHHHHHHHhhcCCceEEeeeccccCcHHHHHHHHhCCCCcEEEEeecccccccccccccccccc-
Confidence 9999999999999999999999999999999999999999999999999999999999999999998887766543211
Q ss_pred ccccccccccccCCchhhHHHHHHHHhcccccCCCCcEEEEEecCCCCCCCccccCCCceeeEEEeCCCCHHHHHHHHHH
Q 011254 332 MDLNVIQPVMNLNQVPQVTLSGMLNFIDGLWSSCGDERIIIFTTNHKDRLDPAFLRPGRMDVHIHMSYCTSCGFKMLASS 411 (490)
Q Consensus 332 ~~~~~~~~~~~~~~~~~~~ls~LL~~idgl~s~~~~~~iiI~TTN~~~~LD~aLlRpGR~d~~I~~~~p~~~~r~~L~~~ 411 (490)
+...+.+|||||||++||+||+||+++||||||||+|+|||||+||||||+||+|++|++++++.|++|
T Consensus 313 -----------~~~~~~VTlSGLLNfiDGlwSscg~ERIivFTTNh~EkLDPALlRpGRmDmhI~mgyCtf~~fK~La~n 381 (457)
T KOG0743|consen 313 -----------EGDLSRVTLSGLLNFLDGLWSSCGDERIIVFTTNHKEKLDPALLRPGRMDMHIYMGYCTFEAFKTLASN 381 (457)
T ss_pred -----------cCCcceeehHHhhhhhccccccCCCceEEEEecCChhhcCHhhcCCCcceeEEEcCCCCHHHHHHHHHH
Confidence 013467999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhCCCC-CCchHHHHHhhhccCCCHHHHHHHHHcCC-CHHHHHHHHHHHHHHHhhcchh
Q 011254 412 YLGITE-HPLFLEVEGLIEKAKVTPADVAEQLMRNE-VPEIALRELIQFLEIKRRESDE 468 (490)
Q Consensus 412 ~l~~~~-~~l~~~i~~l~~~~~~tpa~i~~~l~~~~-~~~~al~~l~~~l~~~~~~~~~ 468 (490)
||+.++ |+++++|++++.++.+|||||++.||.+. |++.||+.|+++++.++.+.++
T Consensus 382 YL~~~~~h~L~~eie~l~~~~~~tPA~V~e~lm~~~~dad~~lk~Lv~~l~~~~~~~~~ 440 (457)
T KOG0743|consen 382 YLGIEEDHRLFDEIERLIEETEVTPAQVAEELMKNKNDADVALKGLVEALESKKEKRNK 440 (457)
T ss_pred hcCCCCCcchhHHHHHHhhcCccCHHHHHHHHhhccccHHHHHHHHHHHHHhhhhhhcc
Confidence 999985 99999999999999999999999999887 8999999999999999876544
|
|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PF14363 AAA_assoc: Domain associated at C-terminal with AAA | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05818 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF08740 BCS1_N: BCS1 N terminal; InterPro: IPR014851 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG1485 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06581 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF06431 Polyoma_lg_T_C: Polyomavirus large T antigen C-terminus; InterPro: IPR010932 The group of polyomaviruses is formed by the homonymous murine virus (Py) as well as other representative members such as the simian virus 40 (SV40) and the human BK and JC viruses [] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >KOG2383 consensus Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3378 Phage associated DNA primase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF00488 MutS_V: MutS domain V C-terminus | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 490 | ||||
| 4b4t_J | 405 | Near-Atomic Resolution Structural Model Of The Yeas | 2e-12 | ||
| 2r62_A | 268 | Crystal Structure Of Helicobacter Pylori Atp Depend | 7e-12 | ||
| 4b4t_K | 428 | Near-Atomic Resolution Structural Model Of The Yeas | 2e-11 | ||
| 3h4m_A | 285 | Aaa Atpase Domain Of The Proteasome- Activating Nuc | 7e-11 | ||
| 4b4t_L | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 5e-10 | ||
| 2qz4_A | 262 | Human Paraplegin, Aaa Domain In Complex With Adp Le | 3e-09 | ||
| 4b4t_M | 434 | Near-Atomic Resolution Structural Model Of The Yeas | 4e-09 | ||
| 4b4t_I | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 5e-09 | ||
| 2ce7_A | 476 | Edta Treated Length = 476 | 1e-08 | ||
| 3kds_E | 465 | Apo-ftsh Crystal Structure Length = 465 | 5e-08 | ||
| 1lv7_A | 257 | Crystal Structure Of The Aaa Domain Of Ftsh Length | 7e-08 | ||
| 4b4t_H | 467 | Near-Atomic Resolution Structural Model Of The Yeas | 8e-07 | ||
| 2dhr_A | 499 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 1e-06 | ||
| 4eiw_A | 508 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 1e-06 | ||
| 2x8a_A | 274 | Human Nuclear Valosin Containing Protein Like (Nvl) | 1e-06 | ||
| 3cf0_A | 301 | Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH | 2e-06 | ||
| 1ixz_A | 254 | Crystal Structure Of The Ftsh Atpase Domain From Th | 2e-06 | ||
| 1iy2_A | 278 | Crystal Structure Of The Ftsh Atpase Domain From Th | 2e-06 | ||
| 3cf1_A | 806 | Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len | 3e-06 | ||
| 1r7r_A | 816 | The Crystal Structure Of Murine P97VCP AT 3.6A Leng | 3e-06 | ||
| 1e32_A | 458 | Structure Of The N-Terminal Domain And The D1 Aaa D | 3e-06 | ||
| 3hu3_A | 489 | Structure Of P97 N-D1 R155h Mutant In Complex With | 3e-06 | ||
| 3hu2_A | 489 | Structure Of P97 N-D1 R86a Mutant In Complex With A | 3e-06 | ||
| 3hu1_A | 489 | Structure Of P97 N-D1 R95g Mutant In Complex With A | 3e-06 | ||
| 3vfd_A | 389 | Human Spastin Aaa Domain Length = 389 | 2e-04 | ||
| 2zam_A | 444 | Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt | 6e-04 | ||
| 1xwi_A | 322 | Crystal Structure Of Vps4b Length = 322 | 8e-04 |
| >pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 | Back alignment and structure |
|
| >pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 | Back alignment and structure |
| >pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 | Back alignment and structure |
| >pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 | Back alignment and structure |
| >pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 | Back alignment and structure |
| >pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 | Back alignment and structure |
| >pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|2CE7|A Chain A, Edta Treated Length = 476 | Back alignment and structure |
| >pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 | Back alignment and structure |
| >pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 | Back alignment and structure |
| >pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 | Back alignment and structure |
| >pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 | Back alignment and structure |
| >pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 | Back alignment and structure |
| >pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 | Back alignment and structure |
| >pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 | Back alignment and structure |
| >pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 | Back alignment and structure |
| >pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 | Back alignment and structure |
| >pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 | Back alignment and structure |
| >pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 | Back alignment and structure |
| >pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 | Back alignment and structure |
| >pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 | Back alignment and structure |
| >pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 | Back alignment and structure |
| >pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 490 | |||
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 1e-15 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 3e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 1e-13 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 3e-11 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 7e-11 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 2e-10 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 5e-08 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 2e-07 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 2e-07 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 3e-07 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 4e-07 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 1e-06 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 2e-06 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 3e-06 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 4e-06 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 3e-04 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 4e-06 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 4e-05 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 5e-06 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 1e-05 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 3e-05 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 6e-05 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 8e-04 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 9e-05 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 1e-04 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 1e-04 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 1e-04 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 1e-04 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 1e-04 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 2e-04 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 2e-04 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 5e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-04 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 6e-04 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 8e-04 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 8e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Length = 377 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Length = 305 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 490 | |||
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 100.0 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 100.0 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 100.0 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 100.0 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 100.0 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 100.0 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 100.0 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 100.0 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.97 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.97 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.96 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.96 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.96 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.96 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.95 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.95 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.95 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.94 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.94 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.94 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.94 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.94 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.93 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.93 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.92 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.92 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.92 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.92 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.89 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.82 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 99.81 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.8 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 99.79 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 99.78 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 99.75 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 99.74 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 99.73 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 99.72 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 99.71 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.7 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 99.69 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 99.69 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 99.67 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 99.65 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 99.64 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 99.64 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 99.64 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 99.63 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.63 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 99.62 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 99.62 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 99.62 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 99.62 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 99.62 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 99.61 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 99.61 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 99.59 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 99.59 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 99.58 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.57 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 99.57 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 99.57 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.56 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.56 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 99.56 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 99.56 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 99.55 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 99.55 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 99.55 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.54 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 99.53 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.5 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 99.48 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 99.47 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.38 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 99.37 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 99.36 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 99.35 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 99.32 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 99.31 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.29 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 99.29 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 99.28 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 99.24 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 99.17 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 99.15 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 99.04 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 99.02 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 99.01 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 98.98 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 98.88 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 98.86 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.82 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 98.82 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 98.8 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 98.76 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 98.73 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.72 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 98.49 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 98.37 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 98.36 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.36 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 98.27 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 98.17 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 98.07 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.9 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 97.83 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 97.69 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.67 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 97.67 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 97.66 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 97.64 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.6 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.59 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 97.57 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 97.54 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 97.53 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.51 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 97.48 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 97.47 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 97.46 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 97.46 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.45 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 97.44 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 97.42 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 97.42 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 97.42 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.41 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.41 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 97.4 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 97.4 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.39 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 97.34 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 97.33 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 97.31 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 97.3 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 97.3 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 97.3 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 97.29 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 97.26 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 97.25 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 97.24 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 97.24 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 97.23 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 97.22 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 97.22 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 97.22 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 97.22 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 97.21 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 97.2 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 97.19 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 97.18 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 97.18 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 97.15 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 97.15 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 97.15 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 97.15 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.12 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.11 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 97.1 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 97.1 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.1 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 97.08 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 97.07 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 97.07 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 97.06 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.06 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 97.04 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 97.04 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.0 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 96.99 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.99 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 96.98 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.94 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.93 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 96.91 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 96.91 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 96.9 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 96.9 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 96.89 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 96.88 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 96.87 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 96.87 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 96.86 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 96.85 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.84 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 96.82 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 96.78 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 96.77 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 96.76 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 96.75 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.75 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.65 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 96.64 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 96.64 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 96.64 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 96.63 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.62 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 96.58 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 96.54 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 96.52 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.5 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 96.49 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 96.46 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 96.46 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 96.45 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.45 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 96.45 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.44 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 96.43 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 96.42 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 96.41 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 96.4 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 96.39 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 96.38 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 96.38 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 96.34 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 96.33 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 96.33 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 96.33 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 96.31 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 96.31 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 96.3 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 96.27 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 96.23 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.21 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 96.19 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.17 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 96.15 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.15 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 96.15 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.14 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 96.12 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 96.12 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.12 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 96.11 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 96.11 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.09 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.09 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 96.06 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 96.03 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 96.03 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 96.02 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 95.99 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 95.97 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 95.97 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 95.96 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 95.96 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.96 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 95.96 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 95.95 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 95.95 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 95.95 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 95.93 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 95.92 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 95.92 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 95.91 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 95.9 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 95.88 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 95.87 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 95.86 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 95.86 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 95.85 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 95.83 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.83 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 95.81 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 95.8 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 95.79 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 95.78 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 95.78 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 95.75 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 95.74 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 95.71 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 95.71 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 95.69 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 95.69 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 95.67 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 95.65 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 95.65 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.64 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 95.64 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 95.64 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 95.62 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 95.61 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 95.58 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 95.58 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 95.58 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 95.57 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 95.56 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 95.56 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 95.56 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 95.55 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 95.54 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 95.53 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 95.53 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 95.52 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 95.51 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 95.49 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 95.47 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 95.47 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 95.43 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 95.42 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 95.4 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 95.39 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 95.38 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 95.37 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 95.37 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 95.36 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 95.35 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.32 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 95.3 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 95.28 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 95.25 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 95.25 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 95.24 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 95.24 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 95.19 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 95.16 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 95.14 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 95.14 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 95.13 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 95.13 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 95.12 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 95.11 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 95.1 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.1 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 95.08 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 95.08 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 95.07 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 95.03 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 95.01 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 94.99 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 94.98 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 94.98 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 94.96 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 94.96 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 94.95 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 94.94 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 94.88 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 94.87 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 94.87 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.87 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 94.86 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 94.84 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 94.83 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 94.78 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 94.74 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 94.74 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 94.74 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 94.72 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 94.7 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 94.68 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 94.68 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 94.66 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 94.65 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 94.65 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 94.64 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 94.64 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 94.64 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 94.63 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 94.62 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 94.61 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 94.57 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 94.57 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 94.57 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 94.56 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 94.56 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 94.56 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 94.55 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 94.52 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 94.49 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 94.49 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 94.41 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 94.41 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 94.41 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 94.4 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 94.39 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 94.39 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 94.38 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 94.36 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 94.34 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 94.34 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 94.33 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 94.3 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 94.29 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 94.28 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 94.26 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 94.19 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 94.19 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 94.18 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 94.14 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 94.11 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 94.1 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 94.1 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 94.09 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 94.04 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 94.03 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 94.0 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 94.0 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 94.0 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 93.99 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 93.99 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 93.99 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 93.98 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 93.94 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 93.94 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 93.94 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 93.94 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 93.91 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 93.9 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 93.89 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 93.88 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 93.87 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 93.85 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 93.85 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 93.83 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 93.82 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 93.82 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 93.81 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 93.8 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 93.79 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 93.76 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 93.75 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 93.72 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 93.72 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 93.71 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 93.7 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 93.7 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 93.7 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 93.69 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 93.68 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 93.67 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 93.66 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 93.66 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 93.65 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 93.65 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 93.65 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 93.64 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 93.63 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 93.62 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 93.62 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 93.61 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 93.59 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 93.57 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 93.55 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 93.55 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.53 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 93.53 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 93.52 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 93.51 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 93.5 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 93.49 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 93.47 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 93.46 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 93.46 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 93.45 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 93.45 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 93.42 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 93.41 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 93.36 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 93.34 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 93.29 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 93.25 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 93.23 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 93.2 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 93.2 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 93.17 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 93.13 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 93.05 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 93.03 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 93.01 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 92.97 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 92.97 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 92.93 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 92.91 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 92.88 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 92.85 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 92.82 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 92.79 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 92.74 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 92.68 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 92.63 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 92.61 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 92.6 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 92.59 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 92.59 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 92.56 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 92.52 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 92.45 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 92.45 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 92.4 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 92.38 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 92.36 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 92.34 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 92.32 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 92.3 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 92.29 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 92.29 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 92.25 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 92.25 |
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-42 Score=357.49 Aligned_cols=213 Identities=27% Similarity=0.340 Sum_probs=182.8
Q ss_pred CCCCCccccccChhHHHHHHHHHHHHHHcHHHHHHhCCCCCcceeeeCCCCCcHHHHHHHHHHhccCcEEEEeccccC--
Q 011254 213 DHPATFDTLAMDSDMKQMIMDDLERFVKRKEFYRNVGKAWKRGYLLYGPPGTGKSSLIAAMANYLNFDVYDLELTNLR-- 290 (490)
Q Consensus 213 ~~~~~f~~l~g~~~~k~~i~~~l~~~l~~~~~y~~~g~~~~rg~LL~GPpGtGKT~la~aiA~~l~~~~~~l~~s~~~-- 290 (490)
.+..+|++|+|.+++|++|.+.+..++.+|+.|.++|.++|+|+|||||||||||+||+|+|++++.+++.++++++.
T Consensus 142 ~p~v~~~dIgGl~~~k~~l~e~v~~Pl~~pe~f~~~gi~~prGvLL~GPPGTGKTllAkAiA~e~~~~f~~v~~s~l~sk 221 (405)
T 4b4t_J 142 VPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQK 221 (405)
T ss_dssp SCSCCGGGSCSCHHHHHHHHHHTHHHHHCHHHHHHHTCCCCCCEEEESCSSSSHHHHHHHHHHHHTCEEEEEEGGGGSCS
T ss_pred CCCCCHHHhCCHHHHHHHHHHHHHHHHhCHHHHHhCCCCCCCceEEeCCCCCCHHHHHHHHHHhhCCCceEEEhHHhhcc
Confidence 355899999999999999999999999999999999999999999999999999999999999999999999999873
Q ss_pred ----ChHHHHHHHHhcc--CCeEEEEeccchhhhhhhhHhhhhhcccccccccccccccCCchhhHHHHHHHHhcccccC
Q 011254 291 ----GNMELRNLLIATE--NKSILVVEDIDCSIELQDRFAKAKATNAMDLNVIQPVMNLNQVPQVTLSGMLNFIDGLWSS 364 (490)
Q Consensus 291 ----~~~~l~~l~~~~~--~~sIl~iDdiD~l~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~LL~~idgl~s~ 364 (490)
++..++.+|..+. .||||||||||+++..+...... .......++++||+.|||+.+.
T Consensus 222 ~vGese~~vr~lF~~Ar~~aP~IIFiDEiDai~~~R~~~~~~----------------~~~~~~~~l~~lL~~lDg~~~~ 285 (405)
T 4b4t_J 222 YIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGG----------------GDSEVQRTMLELLNQLDGFETS 285 (405)
T ss_dssp STTHHHHHHHHHHHHHHHTCSEEEEEESSSCCTTSCSCSSSG----------------GGGHHHHHHHHHHHHHHTTTCC
T ss_pred ccchHHHHHHHHHHHHHHhCCceEeeecchhhccCCCCCCCC----------------CcHHHHHHHHHHHHhhhccCCC
Confidence 4567999998875 79999999999997633221110 0234467899999999999776
Q ss_pred CCCcEEEEEecCCCCCCCccccCCCceeeEEEeCCCCHHHHHHHHHHhhCCCCCCchHHHHHhhhcc-CCCHHHHHHHHH
Q 011254 365 CGDERIIIFTTNHKDRLDPAFLRPGRMDVHIHMSYCTSCGFKMLASSYLGITEHPLFLEVEGLIEKA-KVTPADVAEQLM 443 (490)
Q Consensus 365 ~~~~~iiI~TTN~~~~LD~aLlRpGR~d~~I~~~~p~~~~r~~L~~~~l~~~~~~l~~~i~~l~~~~-~~tpa~i~~~l~ 443 (490)
.+++||+|||+|+.|||||+||||||++|+|++|+.++|.+||+.++......-..++..++..+ +||+|||.+++.
T Consensus 286 --~~V~vIaATNrpd~LDpAllRpGRfD~~I~i~lPd~~~R~~Il~~~~~~~~l~~dvdl~~lA~~t~G~SGADi~~l~~ 363 (405)
T 4b4t_J 286 --KNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCT 363 (405)
T ss_dssp --CCEEEEEEESCSSSSCHHHHSTTSSCCEEECCCCCHHHHHHHHHHHHTTSBCCSSCCHHHHHHHCCSCCHHHHHHHHH
T ss_pred --CCeEEEeccCChhhCCHhHcCCCcCceEEEcCCcCHHHHHHHHHHHhcCCCCCccCCHHHHHHHCCCCCHHHHHHHHH
Confidence 45999999999999999999999999999999999999999999998765433334567777655 599999998864
|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 490 | ||||
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 2e-26 | |
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 1e-25 | |
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 1e-23 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 2e-17 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 2e-16 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 9e-15 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 4e-12 | |
| d1sxja2 | 253 | c.37.1.20 (A:295-547) Replication factor C1 {Baker | 1e-07 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 3e-07 | |
| d1ixsb2 | 239 | c.37.1.20 (B:4-242) Holliday junction helicase Ruv | 3e-07 | |
| d2fnaa2 | 283 | c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo | 5e-07 | |
| d1in4a2 | 238 | c.37.1.20 (A:17-254) Holliday junction helicase Ru | 1e-05 | |
| d1tuea_ | 205 | c.37.1.20 (A:) Replication protein E1 helicase dom | 5e-05 | |
| d1sxje2 | 252 | c.37.1.20 (E:4-255) Replication factor C5 {Baker's | 2e-04 | |
| d2gnoa2 | 198 | c.37.1.20 (A:11-208) gamma subunit of DNA polymera | 8e-04 | |
| d1w5sa2 | 287 | c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t | 0.001 | |
| d1fnna2 | 276 | c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob | 0.002 | |
| d1ofha_ | 309 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 0.004 |
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: Membrane fusion ATPase VCP/p97 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 106 bits (264), Expect = 2e-26
Identities = 58/280 (20%), Positives = 110/280 (39%), Gaps = 29/280 (10%)
Query: 217 TFDTLAMDSDMKQMIMDDLERFVKRKEFYRNVGKAWKRGYLLYGPPGTGKSSLIAAMANY 276
T++ + D+K+ + + ++ V+ + + G +G L YGPPG GK+ L A+AN
Sbjct: 5 TWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANE 64
Query: 277 LNFDVYDLELTNL------RGNMELRNLLIATENKSILVVEDIDCSIELQDRFAKAKATN 330
+ ++ L +R + + V+ + + R
Sbjct: 65 CQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARG------- 117
Query: 331 AMDLNVIQPVMNLNQVPQVTLSGMLNFIDGLWSSCGDERIIIFTTNHKDRLDPAFLRPGR 390
+ + ++ +L +DG+ + II TN D +DPA LRPGR
Sbjct: 118 -------GNIGDGGGAADRVINQILTEMDGMSTKKN--VFIIGATNRPDIIDPAILRPGR 168
Query: 391 MDVHIHMSYCTSCGFKMLASSYLGITEHPLFLEVEGLIEKAK-VTPADVAEQLMRNEVPE 449
+D I++ + + L + +++E L + + AD+ E + +
Sbjct: 169 LDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTE--ICQRACK 226
Query: 450 IALRELIQFLEIKRRESDESKAKEVKEERAEEAESVRAIE 489
+A+RE I+ RRE + E EE + V I
Sbjct: 227 LAIRESIE--SEIRRERERQTNPSAME--VEEDDPVPEIR 262
|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Length = 205 | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 490 | |||
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 100.0 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 100.0 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 100.0 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 100.0 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.89 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.89 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 99.88 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 99.84 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.83 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 99.81 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 99.75 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 99.74 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 99.72 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.7 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 99.66 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 99.64 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 99.64 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 99.53 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 99.49 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.48 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.47 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 99.47 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.46 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 99.43 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.41 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.34 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 99.32 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 99.31 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 99.12 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.06 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.96 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.92 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 98.78 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.23 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 98.18 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 98.1 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 98.02 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 98.02 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 98.0 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.95 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.93 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 97.92 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.9 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 97.89 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.81 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.79 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.7 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 97.69 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.63 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.62 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.58 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 97.55 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 97.5 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 97.5 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 97.48 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.47 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.46 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.45 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 97.43 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 97.43 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 97.42 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.4 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 97.35 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 97.34 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 97.33 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 97.29 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.29 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.25 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.22 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.21 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 97.21 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.14 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.11 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.02 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.02 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 96.99 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 96.98 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.95 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 96.93 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.91 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 96.91 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.9 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.87 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 96.85 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.81 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.79 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.76 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 96.76 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.69 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.68 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.67 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.67 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.66 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.63 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.61 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.6 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 96.45 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.37 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 96.37 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 96.37 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 96.35 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 96.34 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.29 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 96.28 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 96.27 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.27 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 96.22 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 96.21 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 96.21 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 96.17 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.16 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 96.15 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 96.09 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 96.07 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.05 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 96.0 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 95.97 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 95.95 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 95.84 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.81 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.81 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 95.77 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 95.75 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 95.74 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 95.73 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 95.72 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 95.72 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.71 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 95.68 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.68 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 95.67 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.65 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 95.64 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 95.6 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 95.58 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 95.55 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 95.51 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 95.51 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 95.49 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 95.47 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.42 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.22 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.2 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 95.18 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 95.15 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 95.11 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 95.11 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 95.1 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 95.09 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 95.06 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 95.02 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 95.01 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 94.99 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 94.98 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 94.95 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.95 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.93 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.92 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 94.91 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 94.91 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 94.86 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 94.85 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 94.72 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 94.66 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 94.66 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 94.65 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 94.64 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 94.63 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 94.58 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 94.57 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 94.41 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 94.4 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 94.31 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 94.23 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 94.21 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 94.2 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 94.15 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 94.1 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 94.08 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.07 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 93.98 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 93.96 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 93.88 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 93.88 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 93.73 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 93.72 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 93.71 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 93.69 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 93.66 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 93.64 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 93.63 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 93.52 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 93.52 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 93.46 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 93.36 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 93.32 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 93.31 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 93.3 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 93.17 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 93.07 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 92.98 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 92.76 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 92.76 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 92.72 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 92.7 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 92.68 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 92.61 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 92.49 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 92.47 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 92.35 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 92.33 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 92.3 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 92.21 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 92.05 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 92.04 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 92.02 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 91.92 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 91.77 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 91.73 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 91.63 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 91.57 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 91.5 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 91.49 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 91.21 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 91.19 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 91.17 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 91.08 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 90.92 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 90.84 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 90.81 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 90.28 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 90.16 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 90.13 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 90.09 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 89.64 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 89.11 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 88.45 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 88.29 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 87.85 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 87.58 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 87.53 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 87.13 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 86.81 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 86.5 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 86.44 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 85.59 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 85.57 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 85.23 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 84.76 | |
| d2axpa1 | 164 | Hypothetical protein YorR {Bacillus subtilis [TaxI | 83.65 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 83.16 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 82.95 | |
| d1j3ba1 | 318 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 82.92 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 82.72 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 81.53 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 81.5 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 81.46 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 81.37 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 81.36 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 80.94 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 80.71 |
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.4e-38 Score=309.53 Aligned_cols=212 Identities=22% Similarity=0.346 Sum_probs=173.3
Q ss_pred CCCCCccccccChhHHHHHHHHHHHHHHcHHHHHHhCCCCCcceeeeCCCCCcHHHHHHHHHHhccCcEEEEecccc---
Q 011254 213 DHPATFDTLAMDSDMKQMIMDDLERFVKRKEFYRNVGKAWKRGYLLYGPPGTGKSSLIAAMANYLNFDVYDLELTNL--- 289 (490)
Q Consensus 213 ~~~~~f~~l~g~~~~k~~i~~~l~~~l~~~~~y~~~g~~~~rg~LL~GPpGtGKT~la~aiA~~l~~~~~~l~~s~~--- 289 (490)
..+.||++|+|.+++|++|.+.+ .|+.+++.|+++|..+++|+|||||||||||++|+++|++++.+++.++++++
T Consensus 6 ~~~~t~~Di~Gl~~~k~~l~e~v-~~~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~~~ 84 (256)
T d1lv7a_ 6 QIKTTFADVAGCDEAKEEVAELV-EYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEM 84 (256)
T ss_dssp SSCCCGGGSCSCHHHHHHTHHHH-HHHHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSSTTS
T ss_pred CCCCCHHHHhchHHHHHHHHHHH-HHHHCHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHhhhc
Confidence 34689999999999999998765 57889999999999999999999999999999999999999999999999887
Q ss_pred ---CChHHHHHHHHhcc--CCeEEEEeccchhhhhhhhHhhhhhcccccccccccccccCCchhhHHHHHHHHhcccccC
Q 011254 290 ---RGNMELRNLLIATE--NKSILVVEDIDCSIELQDRFAKAKATNAMDLNVIQPVMNLNQVPQVTLSGMLNFIDGLWSS 364 (490)
Q Consensus 290 ---~~~~~l~~l~~~~~--~~sIl~iDdiD~l~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~LL~~idgl~s~ 364 (490)
.++..++++|..+. .||||||||||.++..++..... ........++.||+.||++.+.
T Consensus 85 ~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~----------------~~~~~~~~~~~ll~~~d~~~~~ 148 (256)
T d1lv7a_ 85 FVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGG----------------GHDEREQTLNQMLVEMDGFEGN 148 (256)
T ss_dssp CCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCC----------------TTCHHHHHHHHHHHHHHTCCSS
T ss_pred chhHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCC----------------CcHHHHHHHHHHHHHhhCCCCC
Confidence 34678999998874 79999999999987522211100 0233456789999999999665
Q ss_pred CCCcEEEEEecCCCCCCCccccCCCceeeEEEeCCCCHHHHHHHHHHhhCCCCCCchHHHHHhhhcc-CCCHHHHHHHHH
Q 011254 365 CGDERIIIFTTNHKDRLDPAFLRPGRMDVHIHMSYCTSCGFKMLASSYLGITEHPLFLEVEGLIEKA-KVTPADVAEQLM 443 (490)
Q Consensus 365 ~~~~~iiI~TTN~~~~LD~aLlRpGR~d~~I~~~~p~~~~r~~L~~~~l~~~~~~l~~~i~~l~~~~-~~tpa~i~~~l~ 443 (490)
.+++||+|||+|+.|||+|+||||||.+|+|+.|+.++|..|++.++.........++..++..+ ++|+|||..++.
T Consensus 149 --~~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adi~~l~~ 226 (256)
T d1lv7a_ 149 --EGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVN 226 (256)
T ss_dssp --SCEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHTCTTCCHHHHHHHHH
T ss_pred --CCEEEEEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCCCcCcccCHHHHHHhCCCCCHHHHHHHHH
Confidence 45999999999999999999999999999999999999999999999766444344566676654 499999988764
|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|