Citrus Sinensis ID: 011378


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------
MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF
cHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccc
cHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccc
mvnalckdhkidSAKMFLCemeqkgvypdtvtYNTLINAYCREGFLEEAFQLMNsmsgkglkpgvfTYNSLINGLCKKGRCDRAKEVLDEMLqmglspdtatYNTLLVESCRKENMSEAEEIFCEMsrrgvapdiVSFSTLIGIFSRNGQLDRALMYFREMksaglvpdnVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMlergvfpdfytfttlihghckdgnmnkaLNLFdimtqksikpdivtYNTLIDGFCKVGEMEKANKLWADMISrkispnyisYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKgycrsgdaskADEFLSKMVsegvdpdsisynTLINGFVREENMDKAFALVSKMenqglvpdviTYNVILTGfcrqgrmhdSELILWRMIEkglnpdrstyTTLINGHVSQNNLKEAFRFHDemlqrgfvpddaf
mvnalckdhkidsAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLqmglspdtatYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVsegvdpdsisYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQrgfvpddaf
MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF
*****CKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDA*****FLSKMV**GVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEM***********
MVNALC*DHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF
MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF
MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query487 2.2.26 [Sep-21-2011]
Q9LFC5729 Pentatricopeptide repeat- yes no 1.0 0.668 0.623 0.0
Q6NQ83619 Pentatricopeptide repeat- no no 0.995 0.783 0.339 1e-89
Q0WVK7741 Pentatricopeptide repeat- no no 0.928 0.609 0.335 5e-88
Q9ASZ8621 Pentatricopeptide repeat- no no 0.991 0.777 0.324 5e-84
Q9CA58763 Putative pentatricopeptid no no 0.993 0.634 0.334 2e-83
Q9FIX3747 Pentatricopeptide repeat- no no 0.948 0.618 0.329 4e-83
Q3EDF8598 Pentatricopeptide repeat- no no 0.950 0.774 0.326 2e-82
Q9CAN5614 Pentatricopeptide repeat- no no 0.991 0.786 0.330 5e-82
Q76C99 791 Protein Rf1, mitochondria N/A no 0.942 0.580 0.321 1e-81
Q0WKV3637 Pentatricopeptide repeat- no no 0.991 0.758 0.318 1e-81
>sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 Back     alignment and function desciption
 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/489 (62%), Positives = 389/489 (79%), Gaps = 2/489 (0%)

Query: 1   MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKG 60
           MVNALCKD K++    FL ++++KGVYPD VTYNTLI+AY  +G +EEAF+LMN+M GKG
Sbjct: 241 MVNALCKDGKMEKVGTFLSQVQEKGVYPDIVTYNTLISAYSSKGLMEEAFELMNAMPGKG 300

Query: 61  LKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAE 120
             PGV+TYN++INGLCK G+ +RAKEV  EML+ GLSPD+ TY +LL+E+C+K ++ E E
Sbjct: 301 FSPGVYTYNTVINGLCKHGKYERAKEVFAEMLRSGLSPDSTTYRSLLMEACKKGDVVETE 360

Query: 121 EIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGY 180
           ++F +M  R V PD+V FS+++ +F+R+G LD+ALMYF  +K AGL+PDNV+YTI+I GY
Sbjct: 361 KVFSDMRSRDVVPDLVCFSSMMSLFTRSGNLDKALMYFNSVKEAGLIPDNVIYTILIQGY 420

Query: 181 CRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDF 240
           CR G +  A+ +R+EML++GC MDVVTYNTIL+GLC+ KML EAD LFNEM ER +FPD 
Sbjct: 421 CRKGMISVAMNLRNEMLQQGCAMDVVTYNTILHGLCKRKMLGEADKLFNEMTERALFPDS 480

Query: 241 YTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWAD 300
           YT T LI GHCK GN+  A+ LF  M +K I+ D+VTYNTL+DGF KVG+++ A ++WAD
Sbjct: 481 YTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVTYNTLLDGFGKVGDIDTAKEIWAD 540

Query: 301 MISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGD 360
           M+S++I P  ISY IL+N  CS GH+ EAFR+W EM+ K IKPT++ CN++IKGYCRSG+
Sbjct: 541 MVSKEILPTPISYSILVNALCSKGHLAEAFRVWDEMISKNIKPTVMICNSMIKGYCRSGN 600

Query: 361 ASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQ--GLVPDVITY 418
           AS  + FL KM+SEG  PD ISYNTLI GFVREENM KAF LV KME +  GLVPDV TY
Sbjct: 601 ASDGESFLEKMISEGFVPDCISYNTLIYGFVREENMSKAFGLVKKMEEEQGGLVPDVFTY 660

Query: 419 NVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQ 478
           N IL GFCRQ +M ++E++L +MIE+G+NPDRSTYT +ING VSQ+NL EAFR HDEMLQ
Sbjct: 661 NSILHGFCRQNQMKEAEVVLRKMIERGVNPDRSTYTCMINGFVSQDNLTEAFRIHDEMLQ 720

Query: 479 RGFVPDDAF 487
           RGF PDD F
Sbjct: 721 RGFSPDDKF 729





Arabidopsis thaliana (taxid: 3702)
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description
>sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 Back     alignment and function description
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description
>sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query487
224059754 610 predicted protein [Populus trichocarpa] 0.928 0.740 0.743 0.0
255572227 677 pentatricopeptide repeat-containing prot 0.913 0.657 0.753 0.0
359479250 746 PREDICTED: pentatricopeptide repeat-cont 0.928 0.605 0.735 0.0
147840312 850 hypothetical protein VITISV_001389 [Viti 0.928 0.531 0.733 0.0
296083846 589 unnamed protein product [Vitis vinifera] 0.928 0.767 0.735 0.0
357494043 716 Pentatricopeptide repeat-containing prot 0.950 0.646 0.694 0.0
449476143 749 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.963 0.626 0.655 0.0
449442579 749 PREDICTED: pentatricopeptide repeat-cont 0.963 0.626 0.655 0.0
297806115 719 pentatricopeptide repeat-containing prot 1.0 0.677 0.627 0.0
15240891 729 pentatricopeptide repeat-containing prot 1.0 0.668 0.623 0.0
>gi|224059754|ref|XP_002299984.1| predicted protein [Populus trichocarpa] gi|222847242|gb|EEE84789.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/487 (74%), Positives = 428/487 (87%)

Query: 1   MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKG 60
           MVNALCKD K D  K FL EME  G+Y D VTYNTLI AYCREG LEEAF++MNSM+ KG
Sbjct: 124 MVNALCKDGKFDDVKSFLSEMEGNGIYADMVTYNTLIGAYCREGLLEEAFEIMNSMADKG 183

Query: 61  LKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAE 120
           LKP +FTYN++INGLCKKGR  RAK +L EML +GLSPDT TYNTLLVESCR++N SEA+
Sbjct: 184 LKPSLFTYNAIINGLCKKGRYARAKGILIEMLNIGLSPDTTTYNTLLVESCRRDNFSEAK 243

Query: 121 EIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGY 180
           EIF EM R+GV PD+VSFS+LI +FSRN  LD+AL+YFR+MK  GLVPDNV+YT++++GY
Sbjct: 244 EIFGEMLRQGVVPDLVSFSSLIAVFSRNRHLDQALVYFRDMKKFGLVPDNVIYTVLMHGY 303

Query: 181 CRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDF 240
           CRNG +LEALK+RDEMLE+GCV+DV+ YNTILNGLC+ KMLT+AD LF+EM+ERG  PDF
Sbjct: 304 CRNGNMLEALKIRDEMLEQGCVLDVIAYNTILNGLCKEKMLTDADKLFDEMVERGALPDF 363

Query: 241 YTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWAD 300
           YTFTTLIHGHC+DGNM KAL+LF  MTQ++IKPDIV YNTLIDGFCKVGEMEKA++LW  
Sbjct: 364 YTFTTLIHGHCQDGNMTKALSLFGTMTQRNIKPDIVAYNTLIDGFCKVGEMEKASELWDG 423

Query: 301 MISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGD 360
           MISRKI PN+I+YGILIN YCS+GHV+EAFRLW  M+ KGIKPTLV+CNT+IKGYCRSGD
Sbjct: 424 MISRKIFPNHITYGILINAYCSVGHVSEAFRLWDVMIEKGIKPTLVTCNTVIKGYCRSGD 483

Query: 361 ASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNV 420
           +SKADEFL +M+++GV PD ISYNTLINGFVRE+NMDKAF  ++KME +GL+PD+ITYNV
Sbjct: 484 SSKADEFLGRMIAKGVAPDHISYNTLINGFVREDNMDKAFLWINKMEKEGLLPDIITYNV 543

Query: 421 ILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRG 480
           ++ GFCRQGRM ++EL+L +MIEKG+NPDRSTYT LINGHV+Q+NL EAFRFHDEMLQRG
Sbjct: 544 VMNGFCRQGRMQEAELVLRKMIEKGINPDRSTYTALINGHVTQDNLNEAFRFHDEMLQRG 603

Query: 481 FVPDDAF 487
           F PDD F
Sbjct: 604 FAPDDVF 610




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255572227|ref|XP_002527053.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533615|gb|EEF35353.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359479250|ref|XP_002275790.2| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147840312|emb|CAN63985.1| hypothetical protein VITISV_001389 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083846|emb|CBI24234.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357494043|ref|XP_003617310.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355518645|gb|AET00269.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449476143|ref|XP_004154653.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g01110-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449442579|ref|XP_004139059.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297806115|ref|XP_002870941.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316778|gb|EFH47200.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15240891|ref|NP_195731.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75174092|sp|Q9LFC5.1|PP360_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g01110 gi|6759434|emb|CAB69839.1| putative protein [Arabidopsis thaliana] gi|28973740|gb|AAO64186.1| unknown protein [Arabidopsis thaliana] gi|110736884|dbj|BAF00399.1| hypothetical protein [Arabidopsis thaliana] gi|332002917|gb|AED90300.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query487
TAIR|locus:2150024729 AT5G01110 [Arabidopsis thalian 1.0 0.668 0.623 8.9e-173
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.997 0.785 0.339 4.9e-85
TAIR|locus:2195047621 AT1G12620 [Arabidopsis thalian 0.993 0.779 0.324 1.2e-79
TAIR|locus:2019085763 AT1G74580 "AT1G74580" [Arabido 0.993 0.634 0.334 1.6e-79
TAIR|locus:2034760637 AT1G12300 [Arabidopsis thalian 0.993 0.759 0.318 3.8e-78
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.993 0.788 0.330 1.3e-77
TAIR|locus:2024296598 AT1G09900 "AT1G09900" [Arabido 0.963 0.784 0.324 3.4e-77
TAIR|locus:2168078907 AT5G59900 "AT5G59900" [Arabido 0.987 0.530 0.338 1.5e-76
TAIR|locus:2173403730 AT5G64320 "AT5G64320" [Arabido 0.983 0.656 0.351 1.9e-76
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.993 0.769 0.330 3.9e-76
TAIR|locus:2150024 AT5G01110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1679 (596.1 bits), Expect = 8.9e-173, P = 8.9e-173
 Identities = 305/489 (62%), Positives = 389/489 (79%)

Query:     1 MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKG 60
             MVNALCKD K++    FL ++++KGVYPD VTYNTLI+AY  +G +EEAF+LMN+M GKG
Sbjct:   241 MVNALCKDGKMEKVGTFLSQVQEKGVYPDIVTYNTLISAYSSKGLMEEAFELMNAMPGKG 300

Query:    61 LKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAE 120
               PGV+TYN++INGLCK G+ +RAKEV  EML+ GLSPD+ TY +LL+E+C+K ++ E E
Sbjct:   301 FSPGVYTYNTVINGLCKHGKYERAKEVFAEMLRSGLSPDSTTYRSLLMEACKKGDVVETE 360

Query:   121 EIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGY 180
             ++F +M  R V PD+V FS+++ +F+R+G LD+ALMYF  +K AGL+PDNV+YTI+I GY
Sbjct:   361 KVFSDMRSRDVVPDLVCFSSMMSLFTRSGNLDKALMYFNSVKEAGLIPDNVIYTILIQGY 420

Query:   181 CRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDF 240
             CR G +  A+ +R+EML++GC MDVVTYNTIL+GLC+ KML EAD LFNEM ER +FPD 
Sbjct:   421 CRKGMISVAMNLRNEMLQQGCAMDVVTYNTILHGLCKRKMLGEADKLFNEMTERALFPDS 480

Query:   241 YTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWAD 300
             YT T LI GHCK GN+  A+ LF  M +K I+ D+VTYNTL+DGF KVG+++ A ++WAD
Sbjct:   481 YTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVTYNTLLDGFGKVGDIDTAKEIWAD 540

Query:   301 MISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGD 360
             M+S++I P  ISY IL+N  CS GH+ EAFR+W EM+ K IKPT++ CN++IKGYCRSG+
Sbjct:   541 MVSKEILPTPISYSILVNALCSKGHLAEAFRVWDEMISKNIKPTVMICNSMIKGYCRSGN 600

Query:   361 ASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQ--GLVPDVITY 418
             AS  + FL KM+SEG  PD ISYNTLI GFVREENM KAF LV KME +  GLVPDV TY
Sbjct:   601 ASDGESFLEKMISEGFVPDCISYNTLIYGFVREENMSKAFGLVKKMEEEQGGLVPDVFTY 660

Query:   419 NVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQ 478
             N IL GFCRQ +M ++E++L +MIE+G+NPDRSTYT +ING VSQ+NL EAFR HDEMLQ
Sbjct:   661 NSILHGFCRQNQMKEAEVVLRKMIERGVNPDRSTYTCMINGFVSQDNLTEAFRIHDEMLQ 720

Query:   479 RGFVPDDAF 487
             RGF PDD F
Sbjct:   721 RGFSPDDKF 729


GO:0005739 "mitochondrion" evidence=ISM
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195047 AT1G12620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019085 AT1G74580 "AT1G74580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168078 AT5G59900 "AT5G59900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173403 AT5G64320 "AT5G64320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LFC5PP360_ARATHNo assigned EC number0.62371.00.6680yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query487
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-42
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-37
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-32
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-31
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-31
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-28
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-25
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-23
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-20
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-19
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-19
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-16
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-09
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-08
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-07
pfam0153531 pfam01535, PPR, PPR repeat 6e-07
pfam0153531 pfam01535, PPR, PPR repeat 7e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-06
pfam0153531 pfam01535, PPR, PPR repeat 6e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-05
pfam0153531 pfam01535, PPR, PPR repeat 6e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 9e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 4e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 6e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 6e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 9e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  161 bits (408), Expect = 2e-42
 Identities = 110/432 (25%), Positives = 212/432 (49%), Gaps = 14/432 (3%)

Query: 3   NALCKDHKIDSAKMFLCEMEQKGVYP-DTVTYNTLINAYCREGFLEEAFQLMNSMSGKGL 61
           N L +D +I      L +ME++G+   D + +     A  ++  ++EAF+    +     
Sbjct: 378 NRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLI----R 433

Query: 62  KPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAE- 120
            P + T+N L++        D A  VL  + + GL  D   Y TL + +C K    +A  
Sbjct: 434 NPTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTL-ISTCAKSGKVDAMF 492

Query: 121 EIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGY 180
           E+F EM   GV  ++ +F  LI   +R GQ+ +A   +  M+S  + PD V++  +I+  
Sbjct: 493 EVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISAC 552

Query: 181 CRNGFVLEALKMRDEMLEKGCVM--DVVTYNTILNGLCRAKMLTEADDLFNEMLERGV-- 236
            ++G V  A  +  EM  +   +  D +T   ++     A  +  A +++  + E  +  
Sbjct: 553 GQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKG 612

Query: 237 FPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANK 296
            P+ YT    ++   + G+ + AL+++D M +K +KPD V ++ L+D     G+++KA +
Sbjct: 613 TPEVYTIA--VNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFE 670

Query: 297 LWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYC 356
           +  D   + I    +SY  L+    +  +  +A  L+ ++    ++PT+ + N +I   C
Sbjct: 671 ILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALC 730

Query: 357 RSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVI 416
                 KA E LS+M   G+ P++I+Y+ L+    R+++ D    L+S+ +  G+ P+++
Sbjct: 731 EGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLV 790

Query: 417 TYNVILTGFCRQ 428
               I TG C +
Sbjct: 791 MCRCI-TGLCLR 801


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 487
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.87
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.83
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.82
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.82
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.75
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.73
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.73
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.72
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.72
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.72
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.7
PRK14574 822 hmsH outer membrane protein; Provisional 99.69
PRK14574 822 hmsH outer membrane protein; Provisional 99.68
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.68
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.67
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.6
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.59
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.57
KOG2076 895 consensus RNA polymerase III transcription factor 99.49
PF1304150 PPR_2: PPR repeat family 99.44
PF1304150 PPR_2: PPR repeat family 99.43
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.42
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.37
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.37
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.35
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.35
KOG2003 840 consensus TPR repeat-containing protein [General f 99.34
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.32
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.32
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.31
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.31
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.29
KOG2076 895 consensus RNA polymerase III transcription factor 99.28
KOG2003 840 consensus TPR repeat-containing protein [General f 99.21
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.16
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.11
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.09
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.08
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.05
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.04
KOG1915677 consensus Cell cycle control protein (crooked neck 99.01
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.99
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.97
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.96
KOG1126638 consensus DNA-binding cell division cycle control 98.95
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.95
PF1285434 PPR_1: PPR repeat 98.92
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.92
KOG0547606 consensus Translocase of outer mitochondrial membr 98.89
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.87
KOG1126638 consensus DNA-binding cell division cycle control 98.87
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.86
PRK12370553 invasion protein regulator; Provisional 98.86
PF1285434 PPR_1: PPR repeat 98.83
PRK12370553 invasion protein regulator; Provisional 98.79
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.77
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.77
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.72
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.7
KOG0547606 consensus Translocase of outer mitochondrial membr 98.69
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.63
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.61
KOG1129478 consensus TPR repeat-containing protein [General f 98.6
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.59
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.59
PRK04841903 transcriptional regulator MalT; Provisional 98.57
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.56
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.49
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.48
PRK04841 903 transcriptional regulator MalT; Provisional 98.48
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.46
KOG1129478 consensus TPR repeat-containing protein [General f 98.45
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.42
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.42
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.42
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.41
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.38
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.32
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.32
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.26
PRK11189296 lipoprotein NlpI; Provisional 98.26
PRK11189296 lipoprotein NlpI; Provisional 98.26
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.24
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.18
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.18
KOG2376652 consensus Signal recognition particle, subunit Srp 98.17
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.17
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.11
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.09
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.08
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.07
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.06
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.06
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.03
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.0
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.99
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.98
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.97
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.9
KOG1128777 consensus Uncharacterized conserved protein, conta 97.88
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.88
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.85
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.82
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.81
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.76
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.75
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.69
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.66
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.62
KOG1125579 consensus TPR repeat-containing protein [General f 97.62
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.59
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.46
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.44
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.4
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.4
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.34
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.33
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.33
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.32
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.32
PRK10370198 formate-dependent nitrite reductase complex subuni 97.31
PRK10370198 formate-dependent nitrite reductase complex subuni 97.29
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.25
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.24
KOG1125579 consensus TPR repeat-containing protein [General f 97.22
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.2
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.17
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.17
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.13
PRK15359144 type III secretion system chaperone protein SscB; 97.11
PRK15359144 type III secretion system chaperone protein SscB; 97.08
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.01
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.99
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 96.94
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.93
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.76
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.75
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.74
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.69
KOG20411189 consensus WD40 repeat protein [General function pr 96.66
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.61
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.57
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.55
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.54
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.53
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 96.47
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.39
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.37
KOG3941406 consensus Intermediate in Toll signal transduction 96.37
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.33
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.29
KOG3941 406 consensus Intermediate in Toll signal transduction 96.29
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.21
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.16
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.07
PLN02789320 farnesyltranstransferase 95.98
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 95.97
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.84
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.82
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.76
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.75
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.73
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.73
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.69
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 95.68
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.66
PF12688120 TPR_5: Tetratrico peptide repeat 95.51
smart00299140 CLH Clathrin heavy chain repeat homology. 95.49
PLN02789320 farnesyltranstransferase 95.48
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.45
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.37
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.37
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.34
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.34
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 95.32
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.26
smart00299140 CLH Clathrin heavy chain repeat homology. 95.1
KOG20411189 consensus WD40 repeat protein [General function pr 95.07
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.05
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 94.89
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.87
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.73
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.65
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.63
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.53
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.43
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.43
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 94.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.31
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.27
PF12688120 TPR_5: Tetratrico peptide repeat 94.07
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.03
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.0
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 93.97
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.74
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 93.57
PRK10803263 tol-pal system protein YbgF; Provisional 93.46
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 93.32
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 93.03
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.96
PF13929292 mRNA_stabil: mRNA stabilisation 92.77
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 92.7
PRK10803263 tol-pal system protein YbgF; Provisional 92.67
PF1337173 TPR_9: Tetratricopeptide repeat 92.53
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 92.46
KOG4570 418 consensus Uncharacterized conserved protein [Funct 92.32
PF1337173 TPR_9: Tetratricopeptide repeat 92.11
KOG0553304 consensus TPR repeat-containing protein [General f 92.11
KOG0553304 consensus TPR repeat-containing protein [General f 92.01
COG4700251 Uncharacterized protein conserved in bacteria cont 91.99
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 91.69
KOG4570418 consensus Uncharacterized conserved protein [Funct 91.65
PF13762145 MNE1: Mitochondrial splicing apparatus component 91.45
PF13281374 DUF4071: Domain of unknown function (DUF4071) 91.15
KOG2610 491 consensus Uncharacterized conserved protein [Funct 91.15
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 90.94
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 90.9
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 90.58
COG3629280 DnrI DNA-binding transcriptional activator of the 90.51
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.23
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.19
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 89.62
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 89.54
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.87
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 88.76
COG3629280 DnrI DNA-binding transcriptional activator of the 88.6
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 88.53
PF13762145 MNE1: Mitochondrial splicing apparatus component 88.2
COG4235287 Cytochrome c biogenesis factor [Posttranslational 88.08
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 87.58
PF13929292 mRNA_stabil: mRNA stabilisation 87.43
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 87.2
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 86.57
PF13512142 TPR_18: Tetratricopeptide repeat 86.39
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 86.2
KOG2796366 consensus Uncharacterized conserved protein [Funct 86.19
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 86.09
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 85.92
COG4235287 Cytochrome c biogenesis factor [Posttranslational 85.91
COG1729262 Uncharacterized protein conserved in bacteria [Fun 85.78
KOG2297412 consensus Predicted translation factor, contains W 85.73
PHA02875 413 ankyrin repeat protein; Provisional 85.38
PRK15331165 chaperone protein SicA; Provisional 85.35
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 85.29
PHA02875413 ankyrin repeat protein; Provisional 85.16
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 84.24
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 83.8
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.7
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.51
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 83.07
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 82.97
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 82.94
COG4700251 Uncharacterized protein conserved in bacteria cont 81.86
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 81.8
COG1729262 Uncharacterized protein conserved in bacteria [Fun 81.7
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 81.53
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.4e-79  Score=631.53  Aligned_cols=484  Identities=22%  Similarity=0.350  Sum_probs=430.8

Q ss_pred             hhhHHhcCChhhHHHHHHHHHhCCCC--------------------------------CChhhHHHHHHHHHhcCChhHH
Q 011378            2 VNALCKDHKIDSAKMFLCEMEQKGVY--------------------------------PDTVTYNTLINAYCREGFLEEA   49 (487)
Q Consensus         2 i~~~~~~~~~~~a~~~~~~~~~~g~~--------------------------------p~~~~~~~ll~~~~~~~~~~~a   49 (487)
                      ++.|++.|+++.|.++|++|.+.|+.                                ||..+|+.+|.+|++.|+++.|
T Consensus       377 y~~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~pd~~Tyn~LL~a~~k~g~~e~A  456 (1060)
T PLN03218        377 YNRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRNPTLSTFNMLMSVCASSQDIDGA  456 (1060)
T ss_pred             HHHHHHCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCCCCHHHHHHHHHHHHhCcCHHHH
Confidence            45566677777777777777776643                                7888899999999999999999


Q ss_pred             HHHHHHHhhCCCCCCccchHHHHHHHHhcCChhhHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCChhHHHHHHHHHHHC
Q 011378           50 FQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRR  129 (487)
Q Consensus        50 ~~~~~~m~~~~~~p~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~  129 (487)
                      .++|+.|.+.|+.||..+|+++|++|++.|+++.|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+.
T Consensus       457 ~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~  536 (1060)
T PLN03218        457 LRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSK  536 (1060)
T ss_pred             HHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHhHHHHHHHHHHhCCCHHHHHHHHHHHHH--CCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCcCChhh
Q 011378          130 GVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKS--AGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVT  207 (487)
Q Consensus       130 g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~--~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~  207 (487)
                      |+.||..+|+.+|.+|++.|++++|.++|++|..  .|+.||..+|++||.+|++.|++++|.++|++|.+.|+.|+..+
T Consensus       537 Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e~gi~p~~~t  616 (1060)
T PLN03218        537 NVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEV  616 (1060)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCChHH
Confidence            9999999999999999999999999999999976  67889999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCeeehHHHHHHHHc
Q 011378          208 YNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCK  287 (487)
Q Consensus       208 ~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~t~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~  287 (487)
                      ||++|.+|++.|++++|.++|++|.+.|+.||..||+++|.+|++.|++++|.++|+.|.+.|+.||..+|++||.+|++
T Consensus       617 ynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k  696 (1060)
T PLN03218        617 YTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSN  696 (1060)
T ss_pred             HHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCHHHHHHHHHHHHhCCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCChhhHHHHHHHHHhcCChHHHHHH
Q 011378          288 VGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEF  367 (487)
Q Consensus       288 ~g~~~~a~~~~~~m~~~~~~p~~~t~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~  367 (487)
                      .|++++|.++|++|...|+.||..+|+.||.+|++.|++++|.++|++|...|+.||..||+++|.+|++.|+++.|.++
T Consensus       697 ~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k~G~le~A~~l  776 (1060)
T PLN03218        697 AKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDL  776 (1060)
T ss_pred             CCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHH
Confidence            99999999999999988999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHCCCCCChhhHHHHHHHHhc----c-------------------CCHHHHHHHHHHHHhCCCCCCHhhHHHHHHH
Q 011378          368 LSKMVSEGVDPDSISYNTLINGFVR----E-------------------ENMDKAFALVSKMENQGLVPDVITYNVILTG  424 (487)
Q Consensus       368 ~~~m~~~g~~p~~~~~~~li~~~~~----~-------------------~~~~~a~~~~~~m~~~g~~p~~~~~~~li~~  424 (487)
                      +++|.+.|+.||..+|++|+..|.+    .                   +..+.|..+|++|.+.|+.||..||+.+|..
T Consensus       777 ~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l~~~v~~f~~g~~~~~n~w~~~Al~lf~eM~~~Gi~Pd~~T~~~vL~c  856 (1060)
T PLN03218        777 LSQAKEDGIKPNLVMCRCITGLCLRRFEKACALGEPVVSFDSGRPQIENKWTSWALMVYRETISAGTLPTMEVLSQVLGC  856 (1060)
T ss_pred             HHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccccccccchHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Confidence            9999999999999999999876542    1                   2346788899999999999999999999987


Q ss_pred             HHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCCCC
Q 011378          425 FCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  487 (487)
Q Consensus       425 ~~~~g~~~~a~~~~~~m~~~g~~p~~~ty~~l~~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~  487 (487)
                      +++.+..+.+..++++|...+..|+..+|+++|+++...  .++|+.++++|.+.|+.|+-.|
T Consensus       857 l~~~~~~~~~~~m~~~m~~~~~~~~~~~y~~Li~g~~~~--~~~A~~l~~em~~~Gi~p~~~~  917 (1060)
T PLN03218        857 LQLPHDATLRNRLIENLGISADSQKQSNLSTLVDGFGEY--DPRAFSLLEEAASLGVVPSVSF  917 (1060)
T ss_pred             hcccccHHHHHHHHHHhccCCCCcchhhhHHHHHhhccC--hHHHHHHHHHHHHcCCCCCccc
Confidence            788888888888888888888889999999999988533  4689999999999999998753



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2297 consensus Predicted translation factor, contains W2 domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query487
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 5e-07
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 9e-05
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 7e-04
4g23_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 2e-05
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 9/129 (6%) Query: 182 RNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEAD---------DLFNEML 232 + G VLEAL++ DE G + YN +L A+ TE+ D+F +M+ Sbjct: 38 KKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMI 97 Query: 233 ERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEME 292 V P+ TFT + A ++ M I+P + +Y + GFC+ G+ + Sbjct: 98 VDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDAD 157 Query: 293 KANKLWADM 301 KA ++ A M Sbjct: 158 KAYEVDAHM 166
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure
>pdb|4G23|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query487
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-23
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-23
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 8e-22
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-20
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-18
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score =  102 bits (255), Expect = 3e-23
 Identities = 30/199 (15%), Positives = 62/199 (31%), Gaps = 4/199 (2%)

Query: 10  KIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQL---MNSMSGKGLKPGVF 66
            +D  +    +  Q  +                   L  A  L    +    K     + 
Sbjct: 107 SLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLD 166

Query: 67  TYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEA-EEIFCE 125
            YN+++ G  ++G       VL  +   GL+PD  +Y   L    R++  +   E    +
Sbjct: 167 MYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQ 226

Query: 126 MSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGF 185
           MS+ G+    +  + L+    R   L               +P  V  + ++        
Sbjct: 227 MSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDG 286

Query: 186 VLEALKMRDEMLEKGCVMD 204
            +   K+   +    C+ +
Sbjct: 287 RVSYPKLHLPLKTLQCLFE 305


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query487
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.93
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.84
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.84
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.83
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.83
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.8
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.72
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.71
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.7
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.7
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.7
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.69
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.69
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.69
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.67
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.67
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.66
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.62
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.61
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.61
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.6
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.59
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.59
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.58
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.41
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.41
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.38
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.37
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.37
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.36
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.35
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.34
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.33
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.33
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.32
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.31
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.29
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.27
3u4t_A272 TPR repeat-containing protein; structural genomics 99.27
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.25
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.25
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.25
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.24
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.23
3u4t_A272 TPR repeat-containing protein; structural genomics 99.21
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.19
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.18
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.16
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.16
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.16
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.14
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.14
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.13
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.12
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.11
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.1
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.08
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.03
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.0
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.99
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.98
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.96
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.96
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.95
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.89
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.88
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.88
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.87
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.86
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.85
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.85
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.7
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.7
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.7
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.67
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.6
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.56
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.56
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.56
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.54
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.53
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.5
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.49
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.41
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.34
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.32
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.29
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.24
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.23
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.22
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.21
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.15
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.14
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.12
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.1
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.1
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.08
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.03
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.0
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.0
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.0
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.99
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.97
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.94
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.94
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.93
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.91
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.8
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.76
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.76
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.73
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.69
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.67
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.62
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.58
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.56
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.55
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.55
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.54
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.53
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.52
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.49
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.47
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.45
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.44
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.44
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.43
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.43
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.43
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.4
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.37
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.37
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.37
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.36
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.36
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.36
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.35
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.32
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.3
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.25
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.25
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.25
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.24
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.23
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.2
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.2
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.18
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.17
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.16
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.08
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.07
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.96
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.88
3k9i_A117 BH0479 protein; putative protein binding protein, 96.88
3k9i_A117 BH0479 protein; putative protein binding protein, 96.83
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.79
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.75
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.75
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.63
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.6
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.55
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.5
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.46
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.43
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.41
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.4
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.37
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.29
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.27
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.21
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.07
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.01
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.93
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.57
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.49
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.45
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.43
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.41
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.38
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.32
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.12
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.0
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.94
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.89
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.73
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.62
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.49
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.74
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.19
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.18
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 92.78
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 92.55
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.54
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 92.05
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 91.35
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 91.18
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.85
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 90.81
1pc2_A152 Mitochondria fission protein; unknown function; NM 90.46
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 90.37
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 89.93
1pc2_A152 Mitochondria fission protein; unknown function; NM 89.87
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 89.36
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 88.84
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 88.66
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 88.42
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 88.28
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 88.01
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.94
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 87.87
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 87.86
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 86.75
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.11
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 85.66
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 85.61
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 84.68
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 84.51
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 84.33
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 84.02
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 83.96
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 82.7
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 82.48
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 82.04
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 81.98
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 81.07
3jxi_A260 Vanilloid receptor-related osmotically activated p 80.38
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3.4e-39  Score=329.01  Aligned_cols=454  Identities=11%  Similarity=0.005  Sum_probs=383.1

Q ss_pred             cCChhhHHHHHHHHHhCCCCCChhhHHHHHHHHHhcCChhHHHHHHHHHhhCCCCCCccchHHHHHHHHhcCChhhHHHH
Q 011378            8 DHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEV   87 (487)
Q Consensus         8 ~~~~~~a~~~~~~~~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~~~~~~a~~~   87 (487)
                      .+.+..+...+..++    .++...|+.++..+.+.|++++|..+|+.|..  ..|+..++..+..+|.+.|++++|..+
T Consensus        66 ~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~  139 (597)
T 2xpi_A           66 DGSFLKERNAQNTDS----LSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCL  139 (597)
T ss_dssp             --------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             cCccCCCCCccccch----HHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHH
Confidence            344444555555443    26788999999999999999999999999974  457888999999999999999999999


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHccCChhHHHHHHHHHH-HC--------------CCCCCHhHHHHHHHHHHhCCCHH
Q 011378           88 LDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMS-RR--------------GVAPDIVSFSTLIGIFSRNGQLD  152 (487)
Q Consensus        88 ~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~m~-~~--------------g~~p~~~~~~~li~~~~~~g~~~  152 (487)
                      |+.+...  .++..+++.++.+|.+.|++++|.++|+++. ..              |..++..+|+.++.+|.+.|+++
T Consensus       140 ~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~  217 (597)
T 2xpi_A          140 LTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFD  217 (597)
T ss_dssp             HHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHH
T ss_pred             HHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHH
Confidence            9988543  6789999999999999999999999998532 22              33456889999999999999999


Q ss_pred             HHHHHHHHHHHCCCCCC-hhh--------------------------------------HHHHHHHHHhcCCHHHHHHHH
Q 011378          153 RALMYFREMKSAGLVPD-NVL--------------------------------------YTIIINGYCRNGFVLEALKMR  193 (487)
Q Consensus       153 ~a~~~~~~m~~~g~~~~-~~~--------------------------------------~~~ll~~~~~~~~~~~a~~~~  193 (487)
                      +|.++|++|.+.+  |+ ...                                      |+.++..|.+.|++++|.+++
T Consensus       218 ~A~~~~~~~~~~~--p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~  295 (597)
T 2xpi_A          218 RAKECYKEALMVD--AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYL  295 (597)
T ss_dssp             HHHHHHHHHHHHC--TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhC--chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHH
Confidence            9999999998754  32 222                                      333356677889999999999


Q ss_pred             HHHHHcCCcCChhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCC
Q 011378          194 DEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKP  273 (487)
Q Consensus       194 ~~m~~~g~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~t~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~  273 (487)
                      +++.+.  +++..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..+++.++..|.+.|+.++|..+|+.+.+.. +.
T Consensus       296 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~  371 (597)
T 2xpi_A          296 SSINGL--EKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PE  371 (597)
T ss_dssp             HTSTTG--GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TT
T ss_pred             HHhhcC--CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cc
Confidence            998765  5889999999999999999999999999998765 3477889999999999999999999999987542 44


Q ss_pred             CeeehHHHHHHHHccCCHHHHHHHHHHHHhCCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCChhhHHHHHH
Q 011378          274 DIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIK  353 (487)
Q Consensus       274 ~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~t~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~  353 (487)
                      +..+++.+...|.+.|++++|.++|.++.... +.+..+|+.++.+|.+.|++++|.++|+++...+ +.+..+|+.+..
T Consensus       372 ~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~  449 (597)
T 2xpi_A          372 KAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGM  449 (597)
T ss_dssp             SHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHH
Confidence            67789999999999999999999999987632 2357799999999999999999999999998764 457889999999


Q ss_pred             HHHhcCChHHHHHHHHHHHHCCCCCChhhHHHHHHHHhccCCHHHHHHHHHHHHhC----CCCCC--HhhHHHHHHHHHh
Q 011378          354 GYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQ----GLVPD--VITYNVILTGFCR  427 (487)
Q Consensus       354 ~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~----g~~p~--~~~~~~li~~~~~  427 (487)
                      +|.+.|+.++|.++++++.+.. +.+..+|+.+...|.+.|++++|.++|+++.+.    +..|+  ..+|..+...|.+
T Consensus       450 ~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~  528 (597)
T 2xpi_A          450 QHMQLGNILLANEYLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRK  528 (597)
T ss_dssp             HHHHHTCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHH
T ss_pred             HHHHcCCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHH
Confidence            9999999999999999998753 346889999999999999999999999999765    77888  7899999999999


Q ss_pred             cCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHC
Q 011378          428 QGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQR  479 (487)
Q Consensus       428 ~g~~~~a~~~~~~m~~~g~~p~~~ty~~l~~~~~~~~~~~~a~~~~~~m~~~  479 (487)
                      .|++++|..+++++.+.+ ..+..+|..+...|...|++++|.+.++++.+.
T Consensus       529 ~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~  579 (597)
T 2xpi_A          529 LKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLAI  579 (597)
T ss_dssp             TTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             hcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhc
Confidence            999999999999998764 347899999999999999999999999999863



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query487
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.78
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.77
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.17
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.17
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.85
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.83
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.75
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.73
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.19
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.18
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.08
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.03
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.98
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.94
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.92
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.9
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.83
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.76
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.74
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.7
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.33
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.33
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.29
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.25
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.18
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.17
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.16
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.14
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.91
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.89
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.85
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.84
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.44
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.37
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.28
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.26
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.24
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 95.76
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.32
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.32
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.2
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.1
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.01
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.84
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 94.76
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.48
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 93.83
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.82
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 92.67
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 90.37
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 89.8
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 89.55
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 87.54
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.73
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 84.97
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 84.81
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 83.65
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 80.94
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.78  E-value=3.5e-14  Score=132.92  Aligned_cols=376  Identities=14%  Similarity=0.115  Sum_probs=216.9

Q ss_pred             HhcCChhhHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCChhHHHHHHHHHHHCCCCCCHhHHHHHHHHHHhCCCHHHHH
Q 011378           76 CKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRAL  155 (487)
Q Consensus        76 ~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~  155 (487)
                      .+.|++++|.+.+++..+.. +-+...+..+-..+.+.|++++|...+++..+.. +-+..++..+..++.+.|++++|+
T Consensus        10 ~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~~A~   87 (388)
T d1w3ba_          10 YQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQEAI   87 (388)
T ss_dssp             HHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHH
T ss_pred             HHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhccccccc
Confidence            34455555555555544321 1123444444455555555555555555554431 113445555556666666666666


Q ss_pred             HHHHHHHHCCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCcCChhhHHHHHHHHHhcCCHHHHHHHHHHHHHcC
Q 011378          156 MYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERG  235 (487)
Q Consensus       156 ~~~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~  235 (487)
                      ..+......... +...+..........+....+............ ................+....+...+.......
T Consensus        88 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (388)
T d1w3ba_          88 EHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNP-DLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ  165 (388)
T ss_dssp             HHHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCT-TCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC
T ss_pred             cccccccccccc-ccccccccccccccccccccccccccccccccc-ccccccccccccccccchhhhhHHHHHHhhccC
Confidence            666655543211 122222222223333333333333322222221 222233344444455556666666555554432


Q ss_pred             CCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCC-CeeehHHHHHHHHccCCHHHHHHHHHHHHhCCCCCChhhHH
Q 011378          236 VFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKP-DIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYG  314 (487)
Q Consensus       236 ~~~~~~t~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~-~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~t~~  314 (487)
                       +-+...+..+...+...|+.++|...++...+.  .| +...+..+...+...|++++|...+....... ..+...+.
T Consensus       166 -~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~  241 (388)
T d1w3ba_         166 -PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHG  241 (388)
T ss_dssp             -TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHH
T ss_pred             -cchhHHHHhhcccccccCcHHHHHHHHHHHHHh--CcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHH
Confidence             224455666666667777777777777655442  23 23456666677777777777777776665432 23445566


Q ss_pred             HHHHHHHhcCCHHHHHHHHHHHHhCCCCCChhhHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCChhhHHHHHHHHhccC
Q 011378          315 ILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREE  394 (487)
Q Consensus       315 ~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~~  394 (487)
                      .+...+...|++++|...|+...... +-+..++..+-..+...|+.++|.+.++..... .+.+...+..+...+.+.|
T Consensus       242 ~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~~  319 (388)
T d1w3ba_         242 NLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRL-CPTHADSLNNLANIKREQG  319 (388)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH-CTTCHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc-CCccchhhhHHHHHHHHCC
Confidence            67777777788888877777765532 234556777777788888888888888776543 2345567777777888888


Q ss_pred             CHHHHHHHHHHHHhCCCCCC-HhhHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCC-HHHHHHHHHHHHhcCC
Q 011378          395 NMDKAFALVSKMENQGLVPD-VITYNVILTGFCRQGRMHDSELILWRMIEKGLNPD-RSTYTTLINGHVSQNN  465 (487)
Q Consensus       395 ~~~~a~~~~~~m~~~g~~p~-~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~-~~ty~~l~~~~~~~~~  465 (487)
                      ++++|.+.+++..+.  .|+ ...|..+...|.+.|++++|...|++..+  +.|+ ...|..+...|.+.||
T Consensus       320 ~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~--l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         320 NIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR--ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             CHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT--TCTTCHHHHHHHHHHHHHTCC
T ss_pred             CHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCC
Confidence            888888888776543  454 45677777788888888888888887654  4564 4567777777766554



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure