Citrus Sinensis ID: 011732

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MVHNKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSFKLELGETGKSMELVRVGHEQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQNSDCGSMTFCSKAGSSSQRTSPFREIVGYATEQLSSSSLCSSPDDASCDGIKLEETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENPVGVPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQLLERVHYALN
cccccEEEEEEEcccccccEEEEEccccEEEEEEEccccccccccEEEEccccccccccccccccccccccEEEEEcccEEEEEccccccccccccccccccccccEEEEEEEccccccccEEEEEEEcccccccccccEEEEEEEEcccccccccccccccEEEEEEEEcccccEEEEEEEEEccccEEEEcEEcccEEEEEEccEEEEEEEcccccccEEEEEEccccEEEEEEEEEccEEEEEEccccEEEEEEEccccEEEEEEccccccEEEEEEEEEccEEEEEcccccEEEEEEcccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEEEcccEEEEEEEccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEHHHHHHHHcccHHHHHHHHHHHccccHHHHccccccccccccHHHHHHHHHHHHHHcc
cccccEEEEEEEEccccccEEEEEccccEEEEEEEccccccccccEEEEccccccEEEcccccccccccEEEEEEEcccEEEEEEccccccccccccccccccccEEEEEEEEcccccccccEEEEccccccccccccccEEEEccHHHccccccccccccccccEEEEEcccccEEEEEEEEccccccEEHHHccccEEEEEEccEEEEEEccccccHHHHHHHcccccEEEEEEEEcccEEEEEccHccEEEEEEccccccEEEEEcccccccEEEEEEEccccEEEEcccccEEEEEccccccccccccccccEEEEEEccHHcccccccEEEEEEccccccccccccccccccEEEEEEEccEEEEEEEccHHHHHHHHHHHHHHcccccccccccccHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHHHHHHHHHc
mvhnkrlnvrkfhlggtpkkvlYHSESRLLIVMRTElnndtcssdiccvdplsgsvlSSFKlelgetgksmeLVRVGHEQVLVVGtslssgpaimpsgeaestkGRLIVLCIEHmqnsdcgsmtfcskagsssqrtspFREIVGYATEqlsssslcsspddascdgikleETETWQLRLAYSTTWPGMVLAICPYLDRYFLAsagnafyvcgfpndnpqrVRRFAVGRTRFMIMLLTAHFTRIavgdcrdgilfYSYHEDARKLEQiycdpsqrlvaDCVLMDVDTAVvsdrkgsiavlscsdrlednaspecnltpncayhmGEIAVSIRKgsfiyklpaddalGDCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIhpltapllgndhsefrsrenpvgvpkildGDMLSQFLELTSTQQEAVLSFTLgsfdtikassklppsspipvnQVVQLLERVHYALN
mvhnkrlnvrkfhlggtpkkvlyhSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSFKLELGETGKSMELVRVGHEQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQNSDCGSMTFCSKAGSSSQRTSPFREIVGYATEqlsssslcssPDDASCDGIKLEETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENPVGVPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKassklppsspipvnqvVQLLERVHYALN
MVHNKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSFKLELGETGKSMELVRVGHEQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQNSDCGSMTFCSKAGSSSQRTSPFREIVGYATEQlsssslcsspddascdGIKLEETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENPVGVPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQLLERVHYALN
********VRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSFKLELGETGKSMELVRVGHEQVLVVGTS*****************GRLIVLCIEHMQNSDCGSMTFC*************************************CDGIKLEETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGN***********VGVPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTI**************NQVVQLLERVHY***
***NKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCV*********************MELVRVGHEQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQNSDCGSMTFCSKAGSSSQRTSPFREIVGYATEQLSSSSLCSSPDDASCDGIKLEETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCS************LTPNCAYHMGEIAVSIRKGSFIYKLPADDAL*DCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENPVGVPKILDGDMLSQFLELTSTQQEAVL*********************IPVNQVVQLLERVH****
MVHNKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSFKLELGETGKSMELVRVGHEQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQNSDCGSMTFC**********SPFREIVGYATE***************CDGIKLEETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENPVGVPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQLLERVHYALN
***NKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSFKLELGETGKSMELVRVGHEQVLVVGTSLSSGPA********STKGRLIVLCIEHMQNSDCGSMTFCSKAGSSSQRTSPFREIVGYATEQLSSSSLCSSPDDASCDGIKLEETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENPVGVPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQLLERVHYALN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVHNKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSFKLELGETGKSMELVRVGHEQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQNSDCGSMTFCSKAGSSSQRTSPFREIVGYATEQLSSSSLCSSPDDASCDGIKLEETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENPVGVPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQLLERVHYALN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query478 2.2.26 [Sep-21-2011]
Q4PGM61221 Pre-mRNA-splicing factor N/A no 0.412 0.161 0.272 9e-11
Q153931217 Splicing factor 3B subuni yes no 0.359 0.141 0.268 1e-10
A0JN521217 Splicing factor 3B subuni yes no 0.359 0.141 0.268 1e-10
Q921M31217 Splicing factor 3B subuni yes no 0.359 0.141 0.268 1e-10
Q9UTT21206 Pre-mRNA-splicing factor yes no 0.508 0.201 0.235 1e-10
Q5RBI51217 Splicing factor 3B subuni yes no 0.359 0.141 0.268 1e-10
Q1LVE81217 Splicing factor 3B subuni yes no 0.361 0.142 0.237 4e-09
Q5A7S51219 Pre-mRNA-splicing factor N/A no 0.602 0.236 0.224 5e-08
Q54SA71256 Probable splicing factor yes no 0.370 0.140 0.260 9e-08
Q6BYK11256 Pre-mRNA-splicing factor yes no 0.370 0.140 0.229 2e-07
>sp|Q4PGM6|RSE1_USTMA Pre-mRNA-splicing factor RSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RSE1 PE=3 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 99/213 (46%), Gaps = 16/213 (7%)

Query: 233  IMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDR 292
            ++ L A  +RI VGD ++ I+F SY     +L     D   + V  C ++D DT   +D+
Sbjct: 993  VVSLDAQGSRIVVGDMQESIIFASYKPLENRLVTFADDVMPKFVTRCTMLDYDTVAAADK 1052

Query: 293  KGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASF 352
             G+I VL    RL+ N S   +  P     + E  V +   +    L A   +GD + S 
Sbjct: 1053 FGNIYVL----RLDGNTSRSVDEDPTGMTIVHEKPV-LMGAAHKASLVAHFFVGDIITSL 1107

Query: 353  ESS------QTTIIASTLLGSIVIFIP-ISSEEYELLEAVQARLAIHPLTAPLLGNDHSE 405
              +      +  ++ + L GSI   +P +S E+ + L  +++ L        ++G DH  
Sbjct: 1108 HRTAMVAGGREVLLYTGLSGSIGALVPFVSKEDVDTLSTLESHLRQE--NNSIVGRDHLA 1165

Query: 406  FRSRENPVGVPKILDGDMLSQFLELTSTQQEAV 438
            +RS   P  V  ++DGD+   F  L+  +Q A+
Sbjct: 1166 YRSSYAP--VKSVIDGDLCETFGLLSPAKQNAI 1196
Involved in pre-mRNA splicing and cell cycle control.
Ustilago maydis (strain 521 / FGSC 9021) (taxid: 237631)
>sp|Q15393|SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 Back     alignment and function description
>sp|A0JN52|SF3B3_BOVIN Splicing factor 3B subunit 3 OS=Bos taurus GN=SF3B3 PE=2 SV=1 Back     alignment and function description
>sp|Q921M3|SF3B3_MOUSE Splicing factor 3B subunit 3 OS=Mus musculus GN=Sf3b3 PE=2 SV=1 Back     alignment and function description
>sp|Q9UTT2|RSE1_SCHPO Pre-mRNA-splicing factor prp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp12 PE=1 SV=1 Back     alignment and function description
>sp|Q5RBI5|SF3B3_PONAB Splicing factor 3B subunit 3 OS=Pongo abelii GN=SF3B3 PE=2 SV=1 Back     alignment and function description
>sp|Q1LVE8|SF3B3_DANRE Splicing factor 3B subunit 3 OS=Danio rerio GN=sf3b3 PE=2 SV=1 Back     alignment and function description
>sp|Q5A7S5|RSE1_CANAL Pre-mRNA-splicing factor RSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RSE1 PE=3 SV=1 Back     alignment and function description
>sp|Q54SA7|SF3B3_DICDI Probable splicing factor 3B subunit 3 OS=Dictyostelium discoideum GN=sf3b3 PE=3 SV=1 Back     alignment and function description
>sp|Q6BYK1|RSE1_DEBHA Pre-mRNA-splicing factor RSE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RSE1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
297739782 1363 unnamed protein product [Vitis vinifera] 1.0 0.350 0.824 0.0
225441567 1387 PREDICTED: pre-mRNA-splicing factor rse1 1.0 0.344 0.805 0.0
449437538 1376 PREDICTED: pre-mRNA-splicing factor RSE1 0.997 0.346 0.817 0.0
297829750 1384 predicted protein [Arabidopsis lyrata su 0.997 0.344 0.728 0.0
356570929 1258 PREDICTED: uncharacterized protein LOC10 0.993 0.377 0.752 0.0
6671952 1331 hypothetical protein [Arabidopsis thalia 0.997 0.358 0.734 0.0
42564075 1379 Cleavage and polyadenylation specificity 0.997 0.345 0.734 0.0
30681985 1329 Cleavage and polyadenylation specificity 0.997 0.358 0.726 0.0
358348136 1370 Pre-mRNA-splicing factor rse1 [Medicago 0.991 0.345 0.731 0.0
255581562 1220 spliceosomal protein sap, putative [Rici 0.861 0.337 0.826 0.0
>gi|297739782|emb|CBI29964.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/484 (82%), Positives = 440/484 (90%), Gaps = 6/484 (1%)

Query: 1    MVHNKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSF 60
            MVH+KRLNV+KF+LGGTP+KVLYHSESRLL+VMRTEL+ DT SSDICCVDPLSGSVLSSF
Sbjct: 880  MVHSKRLNVQKFYLGGTPRKVLYHSESRLLLVMRTELSQDTYSSDICCVDPLSGSVLSSF 939

Query: 61   KLELGETGKSMELVRVGHEQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQNSDC 120
            KLELGETGKSMELVRV +EQVLV+GTSLSSGPA+MPSGEAESTKGRLIVLC+EHMQNSD 
Sbjct: 940  KLELGETGKSMELVRVVNEQVLVIGTSLSSGPAMMPSGEAESTKGRLIVLCLEHMQNSDS 999

Query: 121  GSMTFCSKAGSSSQRTSPFREIVGYATEQLSSSSLCSSPDDASCDGIKLEETETWQLRLA 180
            GSMTFCSKAGSSSQRTSPFREIVGYA EQLS SSLCSSPDD SCDG++LEE+E WQLRLA
Sbjct: 1000 GSMTFCSKAGSSSQRTSPFREIVGYAAEQLSGSSLCSSPDDTSCDGVRLEESEAWQLRLA 1059

Query: 181  YSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHF 240
            Y+ TWPGMVLAICPYLDRYFLASAGN+FYVCGFPNDNPQRVRRFAVGRTRFMIM LTAHF
Sbjct: 1060 YTATWPGMVLAICPYLDRYFLASAGNSFYVCGFPNDNPQRVRRFAVGRTRFMIMSLTAHF 1119

Query: 241  TRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLS 300
            TRIAVGDCRDG++FYSYHED+RKLEQ+YCDP QRLVADC+LMDVDTAVVSDRKGSIAVLS
Sbjct: 1120 TRIAVGDCRDGVVFYSYHEDSRKLEQLYCDPEQRLVADCILMDVDTAVVSDRKGSIAVLS 1179

Query: 301  CSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLAS---FESSQT 357
            CS+ LEDNASPECNLT NC+Y+MGEIA+SI+KGSF YKLPADD L  C  S    + S+ 
Sbjct: 1180 CSNHLEDNASPECNLTLNCSYYMGEIAMSIKKGSFSYKLPADDVLKGCDGSNTIIDFSEN 1239

Query: 358  TIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENPV---G 414
            +I+A TLLGSI++ IPIS EE+ELLEAVQARLA+H LTAP+LGNDH+EFRSREN V   G
Sbjct: 1240 SIMAGTLLGSIIMLIPISREEHELLEAVQARLAVHQLTAPILGNDHNEFRSRENSVRKAG 1299

Query: 415  VPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQLLERVH 474
            V KILDGDML+QFLELTS QQEAVL+  LGS +T+ +SSK    SPI VN+VVQLLERVH
Sbjct: 1300 VSKILDGDMLAQFLELTSMQQEAVLALPLGSLETVTSSSKQTLLSPISVNRVVQLLERVH 1359

Query: 475  YALN 478
            YALN
Sbjct: 1360 YALN 1363

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225441567|ref|XP_002276675.1| PREDICTED: pre-mRNA-splicing factor rse1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449437538|ref|XP_004136549.1| PREDICTED: pre-mRNA-splicing factor RSE1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297829750|ref|XP_002882757.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328597|gb|EFH59016.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356570929|ref|XP_003553635.1| PREDICTED: uncharacterized protein LOC100799711 [Glycine max] Back     alignment and taxonomy information
>gi|6671952|gb|AAF23212.1|AC016795_25 hypothetical protein [Arabidopsis thaliana] gi|10998135|dbj|BAB03106.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42564075|ref|NP_187802.2| Cleavage and polyadenylation specificity factor (CPSF) A subunit protein [Arabidopsis thaliana] gi|29824376|gb|AAP04148.1| unknown protein [Arabidopsis thaliana] gi|110739103|dbj|BAF01468.1| hypothetical protein [Arabidopsis thaliana] gi|332641608|gb|AEE75129.1| Cleavage and polyadenylation specificity factor (CPSF) A subunit protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30681985|ref|NP_850565.1| Cleavage and polyadenylation specificity factor (CPSF) A subunit protein [Arabidopsis thaliana] gi|332641609|gb|AEE75130.1| Cleavage and polyadenylation specificity factor (CPSF) A subunit protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|358348136|ref|XP_003638105.1| Pre-mRNA-splicing factor rse1 [Medicago truncatula] gi|355504040|gb|AES85243.1| Pre-mRNA-splicing factor rse1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255581562|ref|XP_002531586.1| spliceosomal protein sap, putative [Ricinus communis] gi|223528782|gb|EEF30789.1| spliceosomal protein sap, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
TAIR|locus:20815761379 AT3G11960 [Arabidopsis thalian 0.997 0.345 0.707 1.9e-179
UNIPROTKB|F1NZF7504 SF3B3 "Uncharacterized protein 0.393 0.373 0.269 2.9e-10
FB|FBgn00351621227 CG13900 [Drosophila melanogast 0.502 0.195 0.219 1.7e-09
RGD|1311636902 Sf3b3 "splicing factor 3b, sub 0.393 0.208 0.269 2.6e-09
UNIPROTKB|E9PT66920 Sf3b3 "Protein Sf3b3" [Rattus 0.393 0.204 0.269 2.8e-09
UNIPROTKB|F1P5291228 SF3B3 "Uncharacterized protein 0.393 0.153 0.269 3.4e-09
DICTYBASE|DDB_G02825691256 sf3b3 "splicing factor 3B subu 0.393 0.149 0.259 3.5e-09
UNIPROTKB|A0JN521217 SF3B3 "Splicing factor 3B subu 0.393 0.154 0.269 5.5e-09
UNIPROTKB|E2RR331217 SF3B3 "Uncharacterized protein 0.393 0.154 0.269 5.5e-09
UNIPROTKB|Q153931217 SF3B3 "Splicing factor 3B subu 0.393 0.154 0.269 5.5e-09
TAIR|locus:2081576 AT3G11960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1742 (618.3 bits), Expect = 1.9e-179, P = 1.9e-179
 Identities = 344/486 (70%), Positives = 395/486 (81%)

Query:     1 MVHNKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSF 60
             MVH+KR N +KF LGGTP+KV+YHSES+LLIVMRT+L  DTC+SDICCVDPLSGSVLSS+
Sbjct:   895 MVHSKRRNAQKFQLGGTPRKVIYHSESKLLIVMRTDLY-DTCTSDICCVDPLSGSVLSSY 953

Query:    61 KLELGETGKSMELVRVGHEQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQNSDC 120
             KL+ GETGKSMELVRVG+E VLVVGTSLSSGPAI+PSGEAESTKGR+I+LC+EH QNSD 
Sbjct:   954 KLKPGETGKSMELVRVGNEHVLVVGTSLSSGPAILPSGEAESTKGRVIILCLEHTQNSDS 1013

Query:   121 GSMTFCSKAGSSSQRTSPFREIVGYATEQXXXXXXXXXXXXXXXXGIKLEETETWQLRLA 180
             GSMT CSKA SSSQRTSPF ++VGY TE                 GIKL+E ETWQLRLA
Sbjct:  1014 GSMTICSKACSSSQRTSPFHDVVGYTTENLSSSSLCSSPDDYSYDGIKLDEAETWQLRLA 1073

Query:   181 YSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHF 240
              STTWPGMVLAICPYLD YFLASAGNAFYVCGFPND+P+R++RFAVGRTRFMI  L  +F
Sbjct:  1074 SSTTWPGMVLAICPYLDHYFLASAGNAFYVCGFPNDSPERMKRFAVGRTRFMITSLRTYF 1133

Query:   241 TRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLS 300
             TRI VGDCRDG+LFYSYHE+++KL QIYCDP+QRLVADC LMD ++  VSDRKGSIA+LS
Sbjct:  1134 TRIVVGDCRDGVLFYSYHEESKKLHQIYCDPAQRLVADCFLMDANSVAVSDRKGSIAILS 1193

Query:   301 CSDRLE------DNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDC-LA-SF 352
             C D  +      + +SPE NL  NCAY+MGEIA+SI+KG  IYKLPADD L    L+ S 
Sbjct:  1194 CKDHSDFGMKHLEYSSPESNLNLNCAYYMGEIAMSIKKGCNIYKLPADDVLRSYGLSKSI 1253

Query:   353 ESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENP 412
             +++  TIIA TLLGSI +F PISSEEYELLE VQA+L IHPLTAP+LGNDH+EFR RENP
Sbjct:  1254 DTADDTIIAGTLLGSIFVFAPISSEEYELLEGVQAKLGIHPLTAPVLGNDHNEFRGRENP 1313

Query:   413 VGVPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQLLER 472
                 KILDGDML+QFLELT+ QQE+VLS    S  T KASSK     P+ ++QVVQLLER
Sbjct:  1314 SQARKILDGDMLAQFLELTNRQQESVLSTPQPSPSTSKASSKQRSFPPLMLHQVVQLLER 1373

Query:   473 VHYALN 478
             VHYAL+
Sbjct:  1374 VHYALH 1379
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;ISS
GO:0008150 "biological_process" evidence=ND
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0010182 "sugar mediated signaling pathway" evidence=RCA
GO:0048825 "cotyledon development" evidence=RCA
UNIPROTKB|F1NZF7 SF3B3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0035162 CG13900 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1311636 Sf3b3 "splicing factor 3b, subunit 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PT66 Sf3b3 "Protein Sf3b3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P529 SF3B3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282569 sf3b3 "splicing factor 3B subunit 3" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|A0JN52 SF3B3 "Splicing factor 3B subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR33 SF3B3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15393 SF3B3 "Splicing factor 3B subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00025448001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (1363 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
pfam03178318 pfam03178, CPSF_A, CPSF A subunit region 4e-25
>gnl|CDD|217409 pfam03178, CPSF_A, CPSF A subunit region Back     alignment and domain information 
 Score =  104 bits (263), Expect = 4e-25
 Identities = 74/263 (28%), Positives = 113/263 (42%), Gaps = 17/263 (6%)

Query: 170 EETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRT 229
           E     +L+L + T   G V A+C +  R  LA  G    V     D            T
Sbjct: 70  EPETNRKLKLVHKTEVKGAVTALCEFQGR-LLAGQGQKLRVYDLGKDKLLPKAFLDTPIT 128

Query: 230 RFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQR-LVADCVLMDVDTAV 288
              ++ L     RI VGD    + F  Y E+  +L     D   R + A   L+D DT +
Sbjct: 129 Y--VVSLKVFGNRIIVGDLMKSVTFLGYDEEPYRLILFARDTQPRWVTAAEFLVDYDTIL 186

Query: 289 VSDRKGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDC 348
            +D+ G++ VL       ++   +  L     +H+G+I  S +KGS + K    ++    
Sbjct: 187 GADKFGNLHVLRYDPEAPESLDGDPRLLHRAEFHLGDIVTSFQKGSLVPKTGGAES---- 242

Query: 349 LASFESSQTTIIASTLLGSIVIFIP-ISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFR 407
                +S   I+  TL GSI + +P IS EEY  L+ +Q +L        L G D   FR
Sbjct: 243 -----TSSPQILYGTLDGSIGLLVPFISEEEYRRLQHLQQQLRDE--LPHLCGLDPRAFR 295

Query: 408 S-RENPVGVPKILDGDMLSQFLE 429
           S       V  ++DGD+L +FL+
Sbjct: 296 SYYSRSPPVKNVIDGDLLERFLD 318

This family includes a region that lies towards the C-terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit. CPSF is involved in mRNA polyadenylation and binds the AAUAAA conserved sequence in pre-mRNA. CPSF has also been found to be necessary for splicing of single-intron pre-mRNAs. The function of the aligned region is unknown but may be involved in RNA/DNA binding. Length = 318

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 478
KOG18971096 consensus Damage-specific DNA binding complex, sub 100.0
KOG18961366 consensus mRNA cleavage and polyadenylation factor 100.0
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 100.0
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 100.0
COG51611319 SFT1 Pre-mRNA cleavage and polyadenylation specifi 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 98.13
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.82
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.79
PLN00181793 protein SPA1-RELATED; Provisional 97.34
PRK11028330 6-phosphogluconolactonase; Provisional 97.3
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 97.3
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.26
KOG0282503 consensus mRNA splicing factor [Function unknown] 97.04
KOG0306888 consensus WD40-repeat-containing subunit of the 18 97.0
PRK11028330 6-phosphogluconolactonase; Provisional 96.75
KOG0315311 consensus G-protein beta subunit-like protein (con 96.69
PTZ00420568 coronin; Provisional 96.66
KOG1539 910 consensus WD repeat protein [General function pred 96.53
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 96.45
PLN00181793 protein SPA1-RELATED; Provisional 96.4
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.05
KOG0646 476 consensus WD40 repeat protein [General function pr 95.94
KOG0647347 consensus mRNA export protein (contains WD40 repea 95.88
KOG1273405 consensus WD40 repeat protein [General function pr 95.77
KOG0310487 consensus Conserved WD40 repeat-containing protein 95.74
KOG0278334 consensus Serine/threonine kinase receptor-associa 95.65
KOG0283712 consensus WD40 repeat-containing protein [Function 95.42
KOG2048 691 consensus WD40 repeat protein [General function pr 95.4
KOG2110391 consensus Uncharacterized conserved protein, conta 95.34
KOG2106626 consensus Uncharacterized conserved protein, conta 95.31
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.24
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 95.13
KOG1273405 consensus WD40 repeat protein [General function pr 95.04
KOG0296399 consensus Angio-associated migratory cell protein 94.92
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 94.84
KOG2106626 consensus Uncharacterized conserved protein, conta 94.79
KOG0289506 consensus mRNA splicing factor [General function p 94.78
KOG0772641 consensus Uncharacterized conserved protein, conta 94.54
KOG0283712 consensus WD40 repeat-containing protein [Function 94.37
KOG2048691 consensus WD40 repeat protein [General function pr 94.27
KOG2096420 consensus WD40 repeat protein [General function pr 94.16
PTZ00420568 coronin; Provisional 94.12
PTZ00421493 coronin; Provisional 93.99
KOG2321 703 consensus WD40 repeat protein [General function pr 93.92
KOG0289506 consensus mRNA splicing factor [General function p 93.73
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 93.46
KOG0278334 consensus Serine/threonine kinase receptor-associa 93.18
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 93.13
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 93.06
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.0
KOG0299479 consensus U3 snoRNP-associated protein (contains W 92.86
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 92.84
KOG0299479 consensus U3 snoRNP-associated protein (contains W 92.71
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 92.57
KOG15171387 consensus Guanine nucleotide binding protein MIP1 92.5
KOG0310487 consensus Conserved WD40 repeat-containing protein 92.45
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.32
KOG2110391 consensus Uncharacterized conserved protein, conta 92.24
KOG0646 476 consensus WD40 repeat protein [General function pr 92.05
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 91.99
KOG0308 735 consensus Conserved WD40 repeat-containing protein 91.7
KOG1539 910 consensus WD repeat protein [General function pred 91.69
KOG0279315 consensus G protein beta subunit-like protein [Sig 91.65
KOG1274 933 consensus WD40 repeat protein [General function pr 91.62
KOG3881412 consensus Uncharacterized conserved protein [Funct 91.6
KOG0288459 consensus WD40 repeat protein TipD [General functi 91.15
KOG18971096 consensus Damage-specific DNA binding complex, sub 91.06
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 90.22
KOG0282503 consensus mRNA splicing factor [Function unknown] 90.12
KOG2111346 consensus Uncharacterized conserved protein, conta 90.06
PTZ00421493 coronin; Provisional 89.61
KOG0315311 consensus G-protein beta subunit-like protein (con 89.59
KOG3881412 consensus Uncharacterized conserved protein [Funct 89.49
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 89.08
KOG0266456 consensus WD40 repeat-containing protein [General 88.55
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 88.27
PHA03098534 kelch-like protein; Provisional 87.77
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 87.68
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 87.46
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 87.39
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 87.31
KOG0263707 consensus Transcription initiation factor TFIID, s 87.17
PHA02713557 hypothetical protein; Provisional 87.1
KOG3621 726 consensus WD40 repeat-containing protein [General 86.66
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 86.38
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 86.31
KOG1274 933 consensus WD40 repeat protein [General function pr 85.68
KOG0318603 consensus WD40 repeat stress protein/actin interac 85.62
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 85.61
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 85.47
KOG0643327 consensus Translation initiation factor 3, subunit 85.46
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 85.38
KOG1407313 consensus WD40 repeat protein [Function unknown] 85.04
KOG0649325 consensus WD40 repeat protein [General function pr 84.77
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 84.7
KOG0293519 consensus WD40 repeat-containing protein [Function 84.66
KOG2055514 consensus WD40 repeat protein [General function pr 84.58
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 84.49
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 84.21
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 83.97
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 83.96
COG5276370 Uncharacterized conserved protein [Function unknow 83.7
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 83.37
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 83.28
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 82.79
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 82.67
KOG0266456 consensus WD40 repeat-containing protein [General 82.53
KOG0294362 consensus WD40 repeat-containing protein [Function 81.13
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 80.68
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=6.8e-68  Score=567.70  Aligned_cols=381  Identities=23%  Similarity=0.342  Sum_probs=344.3

Q ss_pred             CCCCCCeeeEEEeCCCCcCEEEEecCCCeEEEEEEeeCC-------CcceeEEEEEeCCCCcEEEEEECCCCCceEEEEE
Q 011732            1 MVHNKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNN-------DTCSSDICCVDPLSGSVLSSFKLELGETGKSMEL   73 (478)
Q Consensus         1 ~~~~~~l~ir~i~L~~tp~ki~y~~~~~~~~v~~~~~~~-------~~~~s~l~l~d~~t~~~i~~~~l~~~E~~~s~~~   73 (478)
                      |+++|++|+|++|++++||||+|++.+.+|+|+|.+...       +.+.++++++|++||++++.++|+++|.+.|+..
T Consensus       700 id~iqkl~irtvpl~~~prrI~~q~~sl~~~v~s~r~e~~~~~~~ee~~~s~l~vlD~nTf~vl~~hef~~~E~~~Si~s  779 (1096)
T KOG1897|consen  700 IDEIQKLHIRTVPLGESPRRICYQESSLTFGVLSNRIESSAEYYGEEYEVSFLRVLDQNTFEVLSSHEFERNETALSIIS  779 (1096)
T ss_pred             ecchhhcceeeecCCCChhheEecccceEEEEEecccccchhhcCCcceEEEEEEecCCceeEEeeccccccceeeeeee
Confidence            689999999999999999999999999999999965321       3568999999999999999999999999999999


Q ss_pred             EEECCe--eEEEEeeecCCCCCCCCCCCCcCcceEEEEEEEEecccCCCCCccccccCCCCCccCCCceeeccccccccc
Q 011732           74 VRVGHE--QVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQNSDCGSMTFCSKAGSSSQRTSPFREIVGYATEQLS  151 (478)
Q Consensus        74 ~~l~~~--~~l~VGT~~~~g~~~~~~~e~~~~~Gri~v~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  151 (478)
                      ++|.++  .|++|||++..      |+|++|..|||++|++.+                                     
T Consensus       780 ~~~~~d~~t~~vVGT~~v~------Pde~ep~~GRIivfe~~e-------------------------------------  816 (1096)
T KOG1897|consen  780 CKFTDDPNTYYVVGTGLVY------PDENEPVNGRIIVFEFEE-------------------------------------  816 (1096)
T ss_pred             eeecCCCceEEEEEEEeec------cCCCCcccceEEEEEEec-------------------------------------
Confidence            999865  79999999988      899999999999999983                                     


Q ss_pred             cCccCCCCCCCCcCCccccccccceEEEEEEEecCCceEEEeeeCCceEEEEeCCeEEEEeeCCCCcccceeeeecccce
Q 011732          152 SSSLCSSPDDASCDGIKLEETETWQLRLAYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRF  231 (478)
Q Consensus       152 ~~~~~~~~~~~~~~g~~~~~~~~~~l~l~~~~~~~G~V~ai~~~~g~~Ll~avg~~l~v~~l~~~~~~~L~~~a~~~~~~  231 (478)
                              +              .+|++++++.++|+|++++.|+|+ |+||+|+.|.+|+|..+  ++|+..+....+.
T Consensus       817 --------~--------------~~L~~v~e~~v~Gav~aL~~fngk-llA~In~~vrLye~t~~--~eLr~e~~~~~~~  871 (1096)
T KOG1897|consen  817 --------L--------------NSLELVAETVVKGAVYALVEFNGK-LLAGINQSVRLYEWTTE--RELRIECNISNPI  871 (1096)
T ss_pred             --------C--------------CceeeeeeeeeccceeehhhhCCe-EEEecCcEEEEEEcccc--ceehhhhcccCCe
Confidence                    1              489999999999999999999999 99999999999999983  6799999999999


Q ss_pred             eEEEEEEeCCEEEEeecCCcEEEEEEeccCceEEEEecCCCCceeEEEEeecCCeEEEeCCCCcEEEEecCCCcccCCCC
Q 011732          232 MIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCSDRLEDNASP  311 (478)
Q Consensus       232 ~i~sL~~~~n~IlvgD~~~Sv~ll~y~~~~~~L~~varD~~~~~vta~~~ld~~~~l~aD~~gNl~vl~~~~~~~~s~~~  311 (478)
                      ++.+|++.+|+|+|||+|+|++++.|+.+++.|+++|||+.|+|+++++++|++.++++|++||+++++++.... ...+
T Consensus       872 ~aL~l~v~gdeI~VgDlm~Sitll~y~~~eg~f~evArD~~p~Wmtaveil~~d~ylgae~~gNlf~v~~d~~~~-td~e  950 (1096)
T KOG1897|consen  872 IALDLQVKGDEIAVGDLMRSITLLQYKGDEGNFEEVARDYNPNWMTAVEILDDDTYLGAENSGNLFTVRKDSDAT-TDEE  950 (1096)
T ss_pred             EEEEEEecCcEEEEeeccceEEEEEEeccCCceEEeehhhCccceeeEEEecCceEEeecccccEEEEEecCCCC-chhh
Confidence            999999999999999999999999999999999999999999999999999999999999999999999986443 2334


Q ss_pred             CccceeeeeeecCccccEEEeeeeeccCCCCCccccccccCCCCCcEEEEEeCCCceEEEEecCHHHHHHHHHHHHHHhc
Q 011732          312 ECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQTTIIASTLLGSIVIFIPISSEEYELLEAVQARLAI  391 (478)
Q Consensus       312 ~~~L~~~~~fhlGd~vt~~~~gsl~~~~~~~~~~~~~~~~~~~~~~~il~~T~~GsIg~i~pi~e~~~~~L~~LQ~~L~~  391 (478)
                      +++|+..+.||+|+.|++|++|+++++.+++..+         ..++++|||.+|+||+++.++++.+.+|..||++|++
T Consensus       951 R~~l~~~~~~hlGelvn~f~hg~lv~~~~~s~~~---------~~~~vlfgTv~GsIG~i~sl~~d~~~fL~~Lq~~irk 1021 (1096)
T KOG1897|consen  951 RQILEEVGKFHLGELVNKFRHGSLVMQLGDSMIP---------LEPKVLFGTVNGSIGIIVSLPQDWYDFLEELQRRIRK 1021 (1096)
T ss_pred             hhcccceeeEEeccceeeeeecceEeeccccccC---------CCCcEEEEEccceEEEEEecCcchhHHHHHHHHHHHH
Confidence            5689999999999999999999999863333222         3577999999999999999999999999999999999


Q ss_pred             CCCCCCcCCCCccccccccCC---CCCCceeeHHHHHHHhcCCHHHHHHHHHhcCCCcceeccCCCCCCCCCCCHHHHHH
Q 011732          392 HPLTAPLLGNDHSEFRSRENP---VGVPKILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQ  468 (478)
Q Consensus       392 ~~~~~~~~gl~~~~~R~~~~p---~~~~~~IDGDlle~Fl~L~~~~q~~Ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  468 (478)
                        +++++||++|..||+|+..   ++++|||||||+|+|++|++++|.+|+++....         ..+   ++|++|++
T Consensus      1022 --~i~s~gglsH~~yrsf~~e~~~~P~~gfIDGDLiEsfl~l~~~~~~~i~~~~~~~---------~~~---~s~~el~k 1087 (1096)
T KOG1897|consen 1022 --VIKSVGGLSHMDYRSFEFEKRTSPVKGFIDGDLIESFLDLSRSKMREIVRGLEHT---------ESL---ASVQELLK 1087 (1096)
T ss_pred             --hhcccCCcchhhHhhhhcccccCCCcCcccchHHHhhhccCHHHHHHHHhhcccc---------ccc---CCHHHHHH
Confidence              8899999999999999652   249999999999999999999999999996432         111   89999999


Q ss_pred             HHHHH
Q 011732          469 LLERV  473 (478)
Q Consensus       469 ~~~r~  473 (478)
                      +||-+
T Consensus      1088 ~vEel 1092 (1096)
T KOG1897|consen 1088 IVEEL 1092 (1096)
T ss_pred             HHHHH
Confidence            98743

>KOG1896 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>COG5161 SFT1 Pre-mRNA cleavage and polyadenylation specificity factor [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 2e-51
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Length = 1158 Back     alignment and structure
 Score =  187 bits (475), Expect = 2e-51
 Identities = 80/478 (16%), Positives = 167/478 (34%), Gaps = 45/478 (9%)

Query: 1    MVHNKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNNDTCSSDICCVDPLSGSVLSSF 60
            +   ++L++R   L  +P+K+ Y   S+   V+ + +     S     + P + +   S 
Sbjct: 722  IDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSS 781

Query: 61   KLELGETGKSMELVRVGHEQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLC-IEHMQNSD 119
             +   +   S                  S G  +         +    VL   + +QN  
Sbjct: 782  SVSSSKLFSSSTAPH-----------ETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEY 830

Query: 120  CGSMTFCSKAGSSSQRTSPFREIVGYATEQLSSSSLCSSPDDASCDGIKLEETETWQLRL 179
              S+  C      +        IVG A        +     +     I + +    +L+ 
Sbjct: 831  ALSLVSCKLGKDPNTY-----FIVGTAM-------VYPEEAEPKQGRIVVFQYSDGKLQT 878

Query: 180  AYSTTWPGMVLAICPYLDRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAH 239
                   G V ++  +  +  LAS  +   +  +  +  + +R         M + L   
Sbjct: 879  VAEKEVKGAVYSMVEFNGK-LLASINSTVRLYEWTTE--KELRTECNHYNNIMALYLKTK 935

Query: 240  FTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVL 299
               I VGD    +L  +Y       E+I  D +   ++   ++D D  + ++   ++ V 
Sbjct: 936  GDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVC 995

Query: 300  SCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQTTI 359
               D          +L     +H+GE       GS + +   + +          +Q ++
Sbjct: 996  QK-DSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETST--------PTQGSV 1046

Query: 360  IASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENPVG---VP 416
            +  T+ G I +   +S   Y LL  +Q RL        +   +HS +RS           
Sbjct: 1047 LFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKV--IKSVGKIEHSFWRSFHTERKTEPAT 1104

Query: 417  KILDGDMLSQFLELTSTQQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQLLERVH 474
              +DGD++  FL+++  + + V    + +      S     ++   + +VV+ L R+H
Sbjct: 1105 GFIDGDLIESFLDISRPKMQEV----VANLQYDDGSGMKREATADDLIKVVEELTRIH 1158
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 98.18
3jrp_A379 Fusion protein of protein transport protein SEC13 98.18
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.07
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.04
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.02
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.92
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.92
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.92
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.9
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.89
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.89
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.88
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.86
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.85
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.84
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.84
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.84
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.82
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.8
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.8
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.79
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.78
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 97.77
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.76
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.76
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.74
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.71
3jrp_A379 Fusion protein of protein transport protein SEC13 97.71
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.7
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.7
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.68
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.67
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.65
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.64
3jro_A 753 Fusion protein of protein transport protein SEC13 97.63
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.62
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 97.62
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.61
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.61
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.61
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.58
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.54
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.52
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.5
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.49
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.49
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.48
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.47
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.46
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.46
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.44
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.44
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.44
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.43
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.42
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.4
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.38
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.37
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.36
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.36
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.34
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.27
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.26
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.24
2ymu_A577 WD-40 repeat protein; unknown function, two domain 97.24
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.23
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.23
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.23
2pm7_B297 Protein transport protein SEC13, protein transport 97.2
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 97.18
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.16
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.15
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.15
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.11
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 97.09
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 97.09
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.06
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.04
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.03
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.03
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.02
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.98
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.98
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.98
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.97
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.92
3jro_A 753 Fusion protein of protein transport protein SEC13 96.91
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.81
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.76
2ymu_A577 WD-40 repeat protein; unknown function, two domain 96.74
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.74
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.68
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.63
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.62
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.56
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.54
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.53
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 96.53
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.48
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.39
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.35
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.35
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.35
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.35
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.32
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.32
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.28
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.28
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.22
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.2
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.2
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.18
2pm7_B297 Protein transport protein SEC13, protein transport 96.17
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.12
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.04
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.03
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.93
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 95.86
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.8
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 95.71
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.64
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.59
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 95.55
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.39
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 95.39
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.35
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.27
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.19
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.89
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.72
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 94.58
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 94.39
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.33
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.17
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.06
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.04
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 93.47
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 93.34
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 93.15
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 93.08
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 92.91
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 92.88
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 92.32
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 92.06
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 91.96
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 91.94
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 91.83
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 91.81
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.08
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 90.89
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 90.61
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 90.23
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 90.08
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 89.93
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 89.81
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 89.71
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 89.43
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 88.95
2ece_A462 462AA long hypothetical selenium-binding protein; 88.67
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 87.74
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 87.73
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 87.15
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 87.03
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 86.83
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 86.76
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 86.75
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 86.71
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 86.66
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 86.51
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 86.04
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 85.8
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 85.67
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 85.28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 85.16
2ece_A462 462AA long hypothetical selenium-binding protein; 85.12
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 84.76
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 82.83
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 82.32
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 81.73
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 80.65
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
Probab=100.00  E-value=9.8e-69  Score=620.93  Aligned_cols=386  Identities=19%  Similarity=0.292  Sum_probs=328.3

Q ss_pred             CCCCCCeeeEEEeCCCCcCEEEEecCCCeEEEEEEeeCC-----------------------------------------
Q 011732            1 MVHNKRLNVRKFHLGGTPKKVLYHSESRLLIVMRTELNN-----------------------------------------   39 (478)
Q Consensus         1 ~~~~~~l~ir~i~L~~tp~ki~y~~~~~~~~v~~~~~~~-----------------------------------------   39 (478)
                      |+.+++|++|+|||++|||||+|||++++|+|++++.+.                                         
T Consensus       722 i~~~~~~~~~~ipL~~Tprri~y~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g  801 (1158)
T 3ei3_A          722 IDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFG  801 (1158)
T ss_dssp             ECCSSSEEEEEEECSSEEEEEEEEGGGTEEEEEEEEEEEECSSSSEEESSCCHHHHCSEEEECCCCCC----------CC
T ss_pred             ecccCCeeEEEEeCCCCceEEEEcCCCCEEEEEEEeccccccccccchhhhhhhhhhhhhcccccccccccccCchhhcC
Confidence            356789999999999999999999999999999975410                                         


Q ss_pred             -CcceeEEEEEeCCCCcEEEEEECCCCCceEEEEEEEECC--eeEEEEeeecCCCCCCCCCCCCcCcceEEEEEEEEecc
Q 011732           40 -DTCSSDICCVDPLSGSVLSSFKLELGETGKSMELVRVGH--EQVLVVGTSLSSGPAIMPSGEAESTKGRLIVLCIEHMQ  116 (478)
Q Consensus        40 -~~~~s~l~l~d~~t~~~i~~~~l~~~E~~~s~~~~~l~~--~~~l~VGT~~~~g~~~~~~~e~~~~~Gri~v~~i~~~~  116 (478)
                       ..++++|+++||.+|+++++|+|++||.++|++.+.|.+  ++||||||++..      ++|+++++|||++|++.+  
T Consensus       802 ~~~~~s~i~lidp~t~~~i~~~~l~~nE~~~sv~~v~~~~~~~~~lvVGTa~~~------~~e~~~~~Gri~vf~v~~--  873 (1158)
T 3ei3_A          802 EEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVY------PEEAEPKQGRIVVFQYSD--  873 (1158)
T ss_dssp             CEEEEEEEEEEETTTCCEEEEEECCTTEEEEEEEEECCTTCCCCEEEEEEEECC------TTCSSCCCEEEEEEEEET--
T ss_pred             CceeeEEEEEEeCCCCeEEEEEeCCCCcceEEEEEEEEccCCCEEEEEEeeecC------CCCCCCCceEEEEEEEEC--
Confidence             026899999999999999999999999999999999975  589999999976      578999999999999982  


Q ss_pred             cCCCCCccccccCCCCCccCCCceeeccccccccccCccCCCCCCCCcCCccccccccceEEEEEEEecCCceEEEeeeC
Q 011732          117 NSDCGSMTFCSKAGSSSQRTSPFREIVGYATEQLSSSSLCSSPDDASCDGIKLEETETWQLRLAYSTTWPGMVLAICPYL  196 (478)
Q Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~l~l~~~~~~~G~V~ai~~~~  196 (478)
                                                                                .||+++|+++++|+|+||++|+
T Consensus       874 ----------------------------------------------------------~kL~lv~~~~v~g~v~al~~~~  895 (1158)
T 3ei3_A          874 ----------------------------------------------------------GKLQTVAEKEVKGAVYSMVEFN  895 (1158)
T ss_dssp             ----------------------------------------------------------TEEEEEEEEEESSCEEEEEEET
T ss_pred             ----------------------------------------------------------CEEEEEEEEEcCCcCEEEeeeC
Confidence                                                                      4899999999999999999999


Q ss_pred             CceEEEEeCCeEEEEeeCCCCcccceeeeecccceeEEEEEEeCCEEEEeecCCcEEEEEEeccCceEEEEecCCCCcee
Q 011732          197 DRYFLASAGNAFYVCGFPNDNPQRVRRFAVGRTRFMIMLLTAHFTRIAVGDCRDGILFYSYHEDARKLEQIYCDPSQRLV  276 (478)
Q Consensus       197 g~~Ll~avg~~l~v~~l~~~~~~~L~~~a~~~~~~~i~sL~~~~n~IlvgD~~~Sv~ll~y~~~~~~L~~varD~~~~~v  276 (478)
                      |+ |++|+|++|++|+|+++  +.|+..+..-....+++|++.+|+|+|||+|+|++|++|++++++|+++|||+.++|+
T Consensus       896 g~-Lla~ig~~l~vy~l~~~--~~L~~~~~~~~~i~~~~l~~~~~~I~vgD~~~Sv~~~~y~~~~~~L~~~a~D~~~~~v  972 (1158)
T 3ei3_A          896 GK-LLASINSTVRLYEWTTE--KELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWM  972 (1158)
T ss_dssp             TE-EEEEETTEEEEEEECTT--SCEEEEEEECCCSCEEEEEEETTEEEEEESSBCEEEEEEETTTTEEEEEEECCSCBCE
T ss_pred             CE-EEEEcCCEEEEEECCCC--ceEEEEeeccccEEEEEEeccCCEEEEEEhhheEEEEEEEcCCCeEEEEEeecccccE
Confidence            98 99999999999999974  4576323212223477999999999999999999999999999999999999999999


Q ss_pred             EEEEeecCCeEEEeCCCCcEEEEecCCCcccCCCCCccceeeeeeecCccccEEEeeeeeccCCCCCccccccccCCCCC
Q 011732          277 ADCVLMDVDTAVVSDRKGSIAVLSCSDRLEDNASPECNLTPNCAYHMGEIAVSIRKGSFIYKLPADDALGDCLASFESSQ  356 (478)
Q Consensus       277 ta~~~ld~~~~l~aD~~gNl~vl~~~~~~~~s~~~~~~L~~~~~fhlGd~vt~~~~gsl~~~~~~~~~~~~~~~~~~~~~  356 (478)
                      +++++||+++++++|++|||+++++++...++.++ ++|+.+++||+|+.||+|+++++.+..+.+..        ....
T Consensus       973 ta~~~ld~~t~l~aD~~gNl~vl~~~~~~~~~~~~-~~L~~~~~fhlG~~vt~~~~~sl~~~~~~~~~--------~~~~ 1043 (1158)
T 3ei3_A          973 SAVEILDDDNFLGAENAFNLFVCQKDSAATTDEER-QHLQEVGLFHLGEFVNVFCHGSLVMQNLGETS--------TPTQ 1043 (1158)
T ss_dssp             EEEEEEETTEEEEEETTSEEEEEEECTTCCSTTGG-GBEEEEEEEECSSCEEEEEECCSCCC---------------CEE
T ss_pred             EEEEEEccCcEEEEcCCCcEEEEecCCCCCCcccc-ceeeeEEEEeCCCcEeeEEeeeeecCCCcccc--------cccc
Confidence            99999999999999999999999999854433333 59999999999999999999998753221111        1246


Q ss_pred             cEEEEEeCCCceEEEEecCHHHHHHHHHHHHHHhcCCCCCCcCCCCccccccccCC---CCCCceeeHHHHHHHhcCCHH
Q 011732          357 TTIIASTLLGSIVIFIPISSEEYELLEAVQARLAIHPLTAPLLGNDHSEFRSRENP---VGVPKILDGDMLSQFLELTST  433 (478)
Q Consensus       357 ~~il~~T~~GsIg~i~pi~e~~~~~L~~LQ~~L~~~~~~~~~~gl~~~~~R~~~~p---~~~~~~IDGDlle~Fl~L~~~  433 (478)
                      +.++|+|++|+||+|+|+++++|++|..||++|++  .++++||++|++||+|++.   .+++|||||||||+|++|+.+
T Consensus      1044 ~~il~~T~~GsIg~l~pl~~~~~~~L~~Lq~~l~~--~~~~~~gl~~~~~Rs~~~~~~~~~~~~~iDGdLle~fl~L~~~ 1121 (1158)
T 3ei3_A         1044 GSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNK--VIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRP 1121 (1158)
T ss_dssp             EEEEEEETTSCEEEEEEECHHHHHHHHHHHHHHHH--HSCCTTSCCHHHHHSEECSSCEECCBSEEEHHHHHGGGGSCHH
T ss_pred             ceEEEEecCCEEEEEEEcCHHHHHHHHHHHHHHHh--hCCCCcCCCHHHhhCeecccccCCCCccCcHHHHHHHHcCCHH
Confidence            88999999999999999999999999999999999  6799999999999999872   128999999999999999999


Q ss_pred             HHHHHHHhcCCCcceeccCCCCCCCCCCCHHHHHHHHHHH
Q 011732          434 QQEAVLSFTLGSFDTIKASSKLPPSSPIPVNQVVQLLERV  473 (478)
Q Consensus       434 ~q~~Ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~  473 (478)
                      +|++||++++.       +.+.+++++.||+||.+.||.+
T Consensus      1122 ~q~~ia~~l~~-------~~~~~~~~~~t~~ei~k~~e~l 1154 (1158)
T 3ei3_A         1122 KMQEVVANLQY-------DDGSGMKREATADDLIKVVEEL 1154 (1158)
T ss_dssp             HHHHHCCCC-------------------CCHHHHHHHHHH
T ss_pred             HHHHHHHhhCc-------cccccccCCCCHHHHHHHHHHH
Confidence            99999999752       1245678899999999999744
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.82
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.74
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.71
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.69
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.69
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 97.65
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.53
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.52
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.51
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.47
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.41
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.23
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.13
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.73
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.54
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.51
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.32
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.14
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.12
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.82
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.78
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 95.51
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.47
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 94.79
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 94.77
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 94.52
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 94.34
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 94.1
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 93.67
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 91.85
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 91.13
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.1
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 89.02
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 87.78
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 86.2
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 85.83
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 83.67
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 81.61
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 80.52
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

Probab=97.82  E-value=0.004  Score=56.56  Aligned_cols=122  Identities=9%  Similarity=0.123  Sum_probs=73.9

Q ss_pred             EEEEEecCCceEEEeeeC-CceEEEEe-CCeEEEEeeCCCCcccceeeeecc-cceeEEEEEE--eCCEEEEeecCCcEE
Q 011732          179 LAYSTTWPGMVLAICPYL-DRYFLASA-GNAFYVCGFPNDNPQRVRRFAVGR-TRFMIMLLTA--HFTRIAVGDCRDGIL  253 (478)
Q Consensus       179 l~~~~~~~G~V~ai~~~~-g~~Ll~av-g~~l~v~~l~~~~~~~L~~~a~~~-~~~~i~sL~~--~~n~IlvgD~~~Sv~  253 (478)
                      .+.....+++|++++-.. +.+|+++. ...+.+|++...  ..+.....+. ....|.++..  .+++|+.|..-..|.
T Consensus       172 ~~~~~~~~~~i~~~~~~~~~~~l~~~~~d~~i~~~~~~~~--~~~~~~~~~~~h~~~v~~l~~s~~~~~l~sgs~dg~i~  249 (299)
T d1nr0a2         172 EVKTIVHPAEITSVAFSNNGAFLVATDQSRKVIPYSVANN--FELAHTNSWTFHTAKVACVSWSPDNVRLATGSLDNSVI  249 (299)
T ss_dssp             EEEEEECSSCEEEEEECTTSSEEEEEETTSCEEEEEGGGT--TEESCCCCCCCCSSCEEEEEECTTSSEEEEEETTSCEE
T ss_pred             cccccccccccccccccccccccccccccccccccccccc--ccccccccccccccccccccccccccceEEEcCCCEEE
Confidence            333445678999988554 56565554 456999998752  2222222222 1235666654  467899998888888


Q ss_pred             EEEEeccCceEEEEecCCCCceeEEEEeecCCeEEEeCCCCcEEEEecC
Q 011732          254 FYSYHEDARKLEQIYCDPSQRLVADCVLMDVDTAVVSDRKGSIAVLSCS  302 (478)
Q Consensus       254 ll~y~~~~~~L~~varD~~~~~vta~~~ld~~~~l~aD~~gNl~vl~~~  302 (478)
                      ++..+.................+.++.+.++..++.+-.+|+|.+.+++
T Consensus       250 iwd~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~l~s~s~D~~i~iWdl~  298 (299)
T d1nr0a2         250 VWNMNKPSDHPIIIKGAHAMSSVNSVIWLNETTIVSAGQDSNIKFWNVP  298 (299)
T ss_dssp             EEETTCTTSCCEEETTSSTTSCEEEEEEEETTEEEEEETTSCEEEEECC
T ss_pred             EEECCCCCcceEEEecCCCCCcEEEEEECCCCEEEEEeCCCEEEEEecc
Confidence            8654433222222222233334556666677788888889999998764
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure