Citrus Sinensis ID: 012092
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 471 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FKW0 | 522 | Putative E3 ubiquitin-pro | yes | no | 0.838 | 0.756 | 0.503 | 3e-99 | |
| Q0WX00 | 460 | Putative E3 ubiquitin-pro | no | no | 0.802 | 0.821 | 0.486 | 7e-84 | |
| Q99496 | 336 | E3 ubiquitin-protein liga | yes | no | 0.178 | 0.25 | 0.511 | 5e-22 | |
| Q5R9J5 | 336 | E3 ubiquitin-protein liga | yes | no | 0.178 | 0.25 | 0.511 | 5e-22 | |
| Q9CQJ4 | 336 | E3 ubiquitin-protein liga | yes | no | 0.178 | 0.25 | 0.511 | 5e-22 | |
| Q4KLY4 | 308 | E3 ubiquitin-protein liga | yes | no | 0.178 | 0.272 | 0.511 | 8e-22 | |
| Q7ZWM8 | 343 | E3 ubiquitin-protein liga | N/A | no | 0.197 | 0.271 | 0.484 | 2e-21 | |
| Q803I4 | 336 | E3 ubiquitin-protein liga | yes | no | 0.178 | 0.25 | 0.511 | 2e-21 | |
| Q66J69 | 344 | E3 ubiquitin-protein liga | N/A | no | 0.197 | 0.270 | 0.484 | 2e-21 | |
| Q9VB08 | 435 | E3 ubiquitin-protein liga | yes | no | 0.216 | 0.234 | 0.452 | 3e-21 |
| >sp|Q9FKW0|RNG1A_ARATH Putative E3 ubiquitin-protein ligase RING1a OS=Arabidopsis thaliana GN=RING1A PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 362 bits (929), Expect = 3e-99, Method: Compositional matrix adjust.
Identities = 207/411 (50%), Positives = 282/411 (68%), Gaps = 16/411 (3%)
Query: 72 DRSRSSGDGEKDEFVIVKLSDIRKEVQCPICLGIIRKTRTVMECLHRFCRECIDKAMRLG 131
+RS SS G++ EF+ + L +IRK+VQCPICLGII+KTRTVMECLHRFCRECIDK+MRLG
Sbjct: 109 ERSPSSISGDQSEFMEIDLGEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLG 168
Query: 132 NNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEELAFQDEEAARNKQIQASIA 191
NNECPACR HCASRRSLRDD +DALIAAL+ +ID YEEEELAF ++E ARNKQIQASIA
Sbjct: 169 NNECPACRKHCASRRSLRDDPKFDALIAALFTNIDSYEEEELAFHEDEMARNKQIQASIA 228
Query: 192 QTFQRQTEALGRKRTPKSTSALRRSHGRYRDTPLRGRRNYRMTELQGSDENDDANGDA-- 249
Q QRQ+EAL ++R+ +A+ R R R + M + S+ ++D + D
Sbjct: 229 QISQRQSEALVKRRSLGKEAAVLMRSPRIASGSRRRRNSRNMEQQNASEAHEDDDNDDNN 288
Query: 250 --GKDS-SSADERSTEVRPKRRKRWYGARFSQ--SSSAAAGTDGGGDENDSEVHRESMGA 304
G+D SS+DER TEVR K+R++ +R +Q SSS A +G +ND+EV+R++ G
Sbjct: 289 NRGRDKDSSSDERGTEVRQKKRRKRSTSRSTQHPSSSGANKNNGNCADNDTEVYRDTKGI 348
Query: 305 SVGLIGPSERLAWGKGGIRSHTRHG-SVSGSNGKNARNNRLSKLVDYLQ-SLEEKDDQLD 362
S GL+ E LAWG+GG RS+TRHG + SG + K+ RN R++KLV+YL+ S++ +LD
Sbjct: 349 SPGLVWNPEILAWGRGGTRSNTRHGNNTSGGSSKSVRNARVNKLVEYLRSSVDGSSVELD 408
Query: 363 MHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYL----VKELH 418
+H+ LVSLD + IP L QPYLCCRPTL V+ L ++VA Q L+ E+E+ + V E
Sbjct: 409 IHVKLVSLDTKCIPDLPQPYLCCRPTLLVKQLREFVALQIHLKTEEVELLVTRRRVGEDA 468
Query: 419 SKINLPSSSNSLMIDPCKDKLQVLNEQETLTGLQTQNLG--HGFLLLAYQK 467
+ NLP+ + + KD++ L + ETL+ L+ + L++AY+K
Sbjct: 469 AIENLPAVTPASAA-ASKDEMLSLEDNETLSRLKIDFISSHEQHLIIAYRK 518
|
As part of the PRC1-like complex, repress class I KNOX gene expression. PcG PRC1 complex maintains the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. Arabidopsis thaliana (taxid: 3702) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|Q0WX00|RNG1B_ARATH Putative E3 ubiquitin-protein ligase RING1b OS=Arabidopsis thaliana GN=RING1B PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q99496|RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens GN=RNF2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R9J5|RING2_PONAB E3 ubiquitin-protein ligase RING2 OS=Pongo abelii GN=RNF2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9CQJ4|RING2_MOUSE E3 ubiquitin-protein ligase RING2 OS=Mus musculus GN=Rnf2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q4KLY4|RING2_RAT E3 ubiquitin-protein ligase RING2 OS=Rattus norvegicus GN=Rnf2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q7ZWM8|RNG2B_XENLA E3 ubiquitin-protein ligase RING2-B OS=Xenopus laevis GN=rnf2-b PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q803I4|RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio GN=rnf2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q66J69|RNG2A_XENLA E3 ubiquitin-protein ligase RING2-A OS=Xenopus laevis GN=rnf2-a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9VB08|RING1_DROME E3 ubiquitin-protein ligase RING1 OS=Drosophila melanogaster GN=Sce PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 471 | ||||||
| 224125396 | 445 | predicted protein [Populus trichocarpa] | 0.917 | 0.970 | 0.626 | 1e-161 | |
| 359483484 | 534 | PREDICTED: putative E3 ubiquitin-protein | 0.883 | 0.779 | 0.692 | 1e-155 | |
| 297740412 | 433 | unnamed protein product [Vitis vinifera] | 0.883 | 0.960 | 0.695 | 1e-155 | |
| 224079177 | 463 | predicted protein [Populus trichocarpa] | 0.953 | 0.969 | 0.628 | 1e-152 | |
| 255536761 | 418 | ring finger protein, putative [Ricinus c | 0.864 | 0.973 | 0.622 | 1e-147 | |
| 302143319 | 568 | unnamed protein product [Vitis vinifera] | 0.861 | 0.714 | 0.624 | 1e-127 | |
| 359485403 | 412 | PREDICTED: putative E3 ubiquitin-protein | 0.813 | 0.929 | 0.640 | 1e-124 | |
| 224133478 | 497 | predicted protein [Populus trichocarpa] | 0.800 | 0.758 | 0.613 | 1e-117 | |
| 147774461 | 636 | hypothetical protein VITISV_001902 [Viti | 0.811 | 0.600 | 0.544 | 1e-117 | |
| 449434332 | 427 | PREDICTED: putative E3 ubiquitin-protein | 0.791 | 0.873 | 0.592 | 1e-115 |
| >gi|224125396|ref|XP_002329795.1| predicted protein [Populus trichocarpa] gi|222870857|gb|EEF07988.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 575 bits (1483), Expect = e-161, Method: Compositional matrix adjust.
Identities = 299/477 (62%), Positives = 361/477 (75%), Gaps = 45/477 (9%)
Query: 1 MPAQKRSYENATTNNNNNNHIIITPSEVVEAVLDDDGDDTLQRDHSNNLEEQQPPQDSTP 60
MPAQKRSYE +DD Q+DH+NN EQ+ P
Sbjct: 1 MPAQKRSYETLQK--------------------EDDALLRQQQDHTNNNHEQK----QEP 36
Query: 61 AAAADVDGN-ESDRSRSSG---DGEKDEFVIVKLSDIRKEVQCPICLGIIRKTRTVMECL 116
+ D DG ESDRS+ S + K+E+V+VKLS+IRKEVQCPICLGIIRKTRTVMECL
Sbjct: 37 RSDIDDDGGVESDRSQPSSNINEDVKEEYVVVKLSEIRKEVQCPICLGIIRKTRTVMECL 96
Query: 117 HRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEELAFQ 176
HRFCRECIDK+MRLGNNECPACRTHCASRRSLRDD NYDALIAALYPDIDKYEEEELAFQ
Sbjct: 97 HRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALIAALYPDIDKYEEEELAFQ 156
Query: 177 DEEAARNKQIQASIAQTFQRQTEALGRKR-TPKSTSAL--RRSHGRYRDTPLRGRRNYRM 233
++E ARNK+IQA+IAQTF RQ EAL RKR T K+T+A+ RR+ R+RD RGRRNYR+
Sbjct: 157 EDEKARNKEIQATIAQTFDRQAEALSRKRSTAKATAAVFARRTPSRFRDAHSRGRRNYRI 216
Query: 234 TELQGSDENDDANGDAGKDSSSADERSTEVRPKRRKRWYGARFSQSSSAAAGTDGGGDEN 293
ELQGSD+N+DANG GKDSSS DE S EV+PKR +R SAA DG G EN
Sbjct: 217 AELQGSDDNEDANGGGGKDSSSTDEHSAEVKPKRYRRC---------SAAFNADGSGGEN 267
Query: 294 DSEVHRESMGASVGLIGPSERLAWGKGGIRSHTRHGSVSGSNGKNARNNRLSKLVDYLQS 353
DSEV++ES+GAS GLI SERLAWGK G+RSHTR+GS +GSN KNARN+R+SKL DYL++
Sbjct: 268 DSEVNKESVGASAGLISSSERLAWGKNGMRSHTRYGSANGSNVKNARNSRISKLADYLRN 327
Query: 354 LEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYL 413
L+E D++LD++L+LVS DEQR+P LQ+PYLCCRPTLS++ LCQYVA QT+LQA+E+EIYL
Sbjct: 328 LDENDNELDINLMLVSFDEQRVPSLQRPYLCCRPTLSIKSLCQYVAFQTSLQANEVEIYL 387
Query: 414 VKELHSKINLPSSSNSL-----MIDPCKDKLQVLNEQETLTGLQTQNLGHGFLLLAY 465
V++++SK++ S +S +IDPCKDKLQVL + ETL GL+T N HG L+ ++
Sbjct: 388 VQDMNSKLDFSLSMSSPVSRHGIIDPCKDKLQVLEQHETLGGLKTNNCIHGHLVSSF 444
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359483484|ref|XP_002273941.2| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297740412|emb|CBI30594.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224079177|ref|XP_002305782.1| predicted protein [Populus trichocarpa] gi|222848746|gb|EEE86293.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255536761|ref|XP_002509447.1| ring finger protein, putative [Ricinus communis] gi|223549346|gb|EEF50834.1| ring finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|302143319|emb|CBI21880.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359485403|ref|XP_002274885.2| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224133478|ref|XP_002328052.1| predicted protein [Populus trichocarpa] gi|222837461|gb|EEE75840.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147774461|emb|CAN59794.1| hypothetical protein VITISV_001902 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449434332|ref|XP_004134950.1| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Cucumis sativus] gi|449479584|ref|XP_004155643.1| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 471 | ||||||
| TAIR|locus:2158705 | 525 | RING1A "RING 1A" [Arabidopsis | 0.881 | 0.790 | 0.397 | 1.1e-72 | |
| UNIPROTKB|E1BQF7 | 336 | RNF2 "Uncharacterized protein" | 0.212 | 0.297 | 0.44 | 2.3e-26 | |
| UNIPROTKB|Q99496 | 336 | RNF2 "E3 ubiquitin-protein lig | 0.176 | 0.247 | 0.506 | 2.3e-26 | |
| UNIPROTKB|Q5R9J5 | 336 | RNF2 "E3 ubiquitin-protein lig | 0.176 | 0.247 | 0.506 | 2.3e-26 | |
| UNIPROTKB|A6QLQ0 | 336 | RNF2 "RNF2 protein" [Bos tauru | 0.176 | 0.247 | 0.506 | 3e-26 | |
| MGI|MGI:1101759 | 336 | Rnf2 "ring finger protein 2" [ | 0.176 | 0.247 | 0.506 | 3e-26 | |
| UNIPROTKB|E2RFW1 | 337 | RNF2 "Uncharacterized protein" | 0.176 | 0.246 | 0.506 | 3.8e-26 | |
| UNIPROTKB|F1S3N6 | 336 | RNF2 "Uncharacterized protein" | 0.176 | 0.247 | 0.506 | 3.8e-26 | |
| RGD|1305491 | 308 | Rnf2 "ring finger protein 2" [ | 0.176 | 0.269 | 0.506 | 3.8e-26 | |
| ZFIN|ZDB-GENE-030131-5243 | 336 | rnf2 "ring finger protein 2" [ | 0.212 | 0.297 | 0.44 | 2.1e-23 |
| TAIR|locus:2158705 RING1A "RING 1A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 715 (256.8 bits), Expect = 1.1e-72, Sum P(2) = 1.1e-72
Identities = 174/438 (39%), Positives = 257/438 (58%)
Query: 50 EEQQPPQDSTPAAAADVDGNESDRSRSSGDGEKDEFVIVKLSDIRKEVQCPICLGIIRKT 109
+E+ ++ + + + +RS SS G++ EF+ + L +IRK+VQCPICL ++
Sbjct: 87 DEEAEEEEEEEEEEEEEEEDSKERSPSSISGDQSEFMEIDLGEIRKDVQCPICLVGMKFL 146
Query: 110 RTVMECLHRFCRECIDKAMRL----GNNECPACRTHCASRRSLRDDLNYDALIAALYPDI 165
R + ++ ++C + + NNECPACR HCASRRSLRDD +DALIAAL+ +I
Sbjct: 147 RLFIS-YYKENKDCDGMSPQFCATFKNNECPACRKHCASRRSLRDDPKFDALIAALFTNI 205
Query: 166 DKYXXXXXXXXXXXXXRNKQIQASIAQTFQRQTEALGRKRT-PKSTSALRRS----HGRY 220
D Y RNKQIQASIAQ QRQ+EAL ++R+ K + L RS G
Sbjct: 206 DSYEEEELAFHEDEMARNKQIQASIAQISQRQSEALVKRRSLGKEAAVLMRSPRIASGSR 265
Query: 221 RDTPLRGRRNYRMTELQGSDENDDANGDAGKDS-SSADERSTEVRPKRRKRWYGARFXXX 279
R R +E D+NDD N + G+D SS+DER TEVR K+R++ +R
Sbjct: 266 RRRNSRNMEQQNASEAHEDDDNDD-NNNRGRDKDSSSDERGTEVRQKKRRKRSTSRSTQH 324
Query: 280 XXXXXXXXXXXD--ENDSEVHRESMGASVGLIGPSERLAWGKGGIRSHTRHGS-VSGSNG 336
+ +ND+EV+R++ G S GL+ E LAWG+GG RS+TRHG+ SG +
Sbjct: 325 PSSSGANKNNGNCADNDTEVYRDTKGISPGLVWNPEILAWGRGGTRSNTRHGNNTSGGSS 384
Query: 337 KNARNNRLSKLVDYLQS-LEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLC 395
K+ RN R++KLV+YL+S ++ +LD+H+ LVSLD + IP L QPYLCCRPTL V+ L
Sbjct: 385 KSVRNARVNKLVEYLRSSVDGSSVELDIHVKLVSLDTKCIPDLPQPYLCCRPTLLVKQLR 444
Query: 396 QYVAHQTALQASEIEIYLVKEL---HSKI-NLPSSSNSLMIDPCKDKLQVLNEQETLTGL 451
++VA Q L+ E+E+ + + + I NLP+ + + KD++ L + ETL+ L
Sbjct: 445 EFVALQIHLKTEEVELLVTRRRVGEDAAIENLPAVTPASAA-ASKDEMLSLEDNETLSRL 503
Query: 452 QTQNLG-HG-FLLLAYQK 467
+ + H L++AY+K
Sbjct: 504 KIDFISSHEQHLIIAYRK 521
|
|
| UNIPROTKB|E1BQF7 RNF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q99496 RNF2 "E3 ubiquitin-protein ligase RING2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R9J5 RNF2 "E3 ubiquitin-protein ligase RING2" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QLQ0 RNF2 "RNF2 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1101759 Rnf2 "ring finger protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RFW1 RNF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S3N6 RNF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1305491 Rnf2 "ring finger protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5243 rnf2 "ring finger protein 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9FKW0 | RNG1A_ARATH | 6, ., 3, ., 2, ., - | 0.5036 | 0.8386 | 0.7567 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 471 | |||
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 6e-15 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 9e-12 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 9e-11 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-10 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 1e-09 | |
| COG5222 | 427 | COG5222, COG5222, Uncharacterized conserved protei | 8e-06 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 2e-05 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 3e-04 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 0.003 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
Score = 68.2 bits (167), Expect = 6e-15
Identities = 22/45 (48%), Positives = 28/45 (62%)
Query: 98 QCPICLGIIRKTRTVMECLHRFCRECIDKAMRLGNNECPACRTHC 142
+CPICL R+ ++ C H FCR CIDK ++ G N CP CRT
Sbjct: 1 ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTPI 45
|
Length = 45 |
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 471 | |||
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 99.34 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.1 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.09 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.03 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.0 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.94 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.94 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.93 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.91 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.8 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.77 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.77 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.76 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.76 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.73 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.7 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.69 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.67 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.61 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.41 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.39 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.39 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.38 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.36 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.36 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.27 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.23 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.21 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.21 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 98.15 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.12 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.85 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.8 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.76 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.69 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.68 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.65 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.6 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 97.57 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.52 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.49 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.45 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 97.45 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.33 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.91 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.82 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.78 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 96.64 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.54 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.53 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.43 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 96.43 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 96.21 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.02 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 95.57 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.54 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.52 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 95.4 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.35 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.31 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 95.24 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 95.22 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 95.22 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.09 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.02 | |
| PF11816 | 331 | DUF3337: Domain of unknown function (DUF3337); Int | 94.87 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 94.78 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 94.78 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 94.67 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 94.43 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 93.41 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 93.12 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 92.99 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 92.91 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 92.85 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 92.78 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 92.5 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 92.47 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.15 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 91.97 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.16 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 90.75 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 90.6 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.3 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 89.64 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 89.56 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.55 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 89.14 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 89.14 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 89.01 | |
| PHA03096 | 284 | p28-like protein; Provisional | 88.55 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 86.53 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 85.91 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 83.67 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 83.07 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 82.4 | |
| PHA02862 | 156 | 5L protein; Provisional | 81.82 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 80.57 |
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-37 Score=309.84 Aligned_cols=351 Identities=35% Similarity=0.501 Sum_probs=271.7
Q ss_pred CccCCCCCCCCchhHHHhhhhccCccccccccccccccceeeccCCCcchHHHHHHHhhcCCCCCCccccccccCCcCCc
Q 012092 71 SDRSRSSGDGEKDEFVIVKLSDIRKEVQCPICLGIIRKTRTVMECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRD 150 (471)
Q Consensus 71 d~~s~s~~~~~~~e~~~~~~~~l~~~l~CpICl~~~~~Pv~v~~CgH~FC~~CI~~~l~~~~~~CP~Cr~~~~~~~~l~~ 150 (471)
-++++++.-+...+ +.+.+..+...+.|+||+++++..+++..|+|.||..||...++.+.+.||.||+.+.+++.|++
T Consensus 19 ~er~p~~~~~d~~E-i~~~l~~~~~~v~c~icl~llk~tmttkeClhrfc~~ci~~a~r~gn~ecptcRk~l~SkrsLr~ 97 (381)
T KOG0311|consen 19 KERSPSSYNGDPSE-IMVDLAMFDIQVICPICLSLLKKTMTTKECLHRFCFDCIWKALRSGNNECPTCRKKLVSKRSLRI 97 (381)
T ss_pred hhcChhhhcCCchh-heecHHHhhhhhccHHHHHHHHhhcccHHHHHHHHHHHHHHHHHhcCCCCchHHhhccccccCCC
Confidence 34455555454444 77788889999999999999999998889999999999999999889999999999999999999
Q ss_pred cHHHHHHHHHHccchhhhHHHHhhcchHHHHHHHH-HHHHHHHhHHHHHHhhhcccCCcchhhhhcccCCCCCCCCCCCC
Q 012092 151 DLNYDALIAALYPDIDKYEEEELAFQDEEAARNKQ-IQASIAQTFQRQTEALGRKRTPKSTSALRRSHGRYRDTPLRGRR 229 (471)
Q Consensus 151 n~~l~~li~~l~p~c~~~eeel~~~ceed~~~~k~-i~~hl~~~~~r~~~al~KkR~~~~aa~~~R~r~~~r~~~~r~r~ 229 (471)
++.+..||.++++.+..++.....|.+.+.....+ |+.++++..++|...+.+++....- |+.+.. .++++++
T Consensus 98 Dp~fdaLis~i~~sie~~e~~q~~~~ekd~~~~~q~i~~si~~~~~~qs~~~~kr~a~~~~----~s~r~g--~Gs~~~g 171 (381)
T KOG0311|consen 98 DPNFDALISKIYPSIEEYEAPQPRFMEKDDSAQIQYIKTSINAAVDHQSSYLTKRKALEEL----RSIRWG--GGSRRRG 171 (381)
T ss_pred CccHHHHHHHHhccHHHHhccchhHHhhHHHHhHHHHhhhHHHHHhhhhhhhhhhhccccc----cccccc--CCCCCCC
Confidence 99999999999999998888888888876655544 9999999999999999988876443 222222 2445555
Q ss_pred CCcccccCC-C-CCCCCCCC---CCCCCCCCCCcCCCccCCcccccccCCCCCCC-CCCCCCCCCCCCCCChhhhhcccC
Q 012092 230 NYRMTELQG-S-DENDDANG---DAGKDSSSADERSTEVRPKRRKRWYGARFSQS-SSAAAGTDGGGDENDSEVHRESMG 303 (471)
Q Consensus 230 ~~~~~~~~~-~-~~~~d~~~---d~~~~sss~~~~~~~~~~~r~~~~~~~~~~~~-ss~~~~~~~~~~~~d~~~~~~~~~ 303 (471)
+.+...... + -+++|+++ +.++++|+ |+. --.++..++......-+ ++.++..+..++.+|.+..+++.+
T Consensus 172 n~r~~~~s~~~a~~ea~~~~~~n~rg~~ss~-d~~---~~~~~~~~S~d~~~~~~~~s~as~~~~~~~~a~te~~~~~~~ 247 (381)
T KOG0311|consen 172 NVRNVEQSKKSAPKEADGNDDENDRGKDSSS-DEL---MDFPREIRSSDREQTHPSSSGASMNDSNCAGADTEDVRDSST 247 (381)
T ss_pred CcccchhccccCCccCCCccccccccccccc-ccc---ccccccccccccccCCCCccccccCCCcccCCCCcccccccc
Confidence 655532211 1 11222222 33455555 333 22333333333221122 344454677888888888899999
Q ss_pred CCCCCCCCccccccccCCccCCcccCCcC-CCCCCcccchhhHHHHHHHhhcccccCceeEEEEEeeccccCCCCCCCCc
Q 012092 304 ASVGLIGPSERLAWGKGGIRSHTRHGSVS-GSNGKNARNNRLSKLVDYLQSLEEKDDQLDMHLVLVSLDEQRIPGLQQPY 382 (471)
Q Consensus 304 ~~~~~~~~~~~~~wg~~g~rs~~r~g~~~-~~~~~~~~~~~~~~~~~~l~~~~e~~~e~~~~~~l~~~d~~~~p~l~~py 382 (471)
+++++||+.+..+||++|+|+.||+|++. |.-..++|.++..++++|++..+...++
T Consensus 248 i~r~~v~~~e~~~s~r~~~~~~t~n~~~~~~~k~~~vr~a~~~~~~e~~~~~~G~S~~---------------------- 305 (381)
T KOG0311|consen 248 ISRTLVWNRESSESGRGGTRSNTRNGNNKMGRKSLAVRNALEVRLSEYDGSVEGTSNI---------------------- 305 (381)
T ss_pred cccccccccccchhccCCccccccccccccccchhhhhHHHHHHhhhhcccccccccc----------------------
Confidence 99999999999999999999999999953 4445667999999999999966655555
Q ss_pred cccCCCcchHHHHHHHHhhhcccccceeeeeeecccccCCCCCCCCceeecCCCCcceeecccchhhhhccc-cCCCcce
Q 012092 383 LCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKELHSKINLPSSSNSLMIDPCKDKLQVLNEQETLTGLQTQ-NLGHGFL 461 (471)
Q Consensus 383 l~c~pt~sv~hl~~~va~~~~~~~~e~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~tl~~l~~~-~~~~~~l 461 (471)
|||.+..+..+++|+++... ++......+.++++|+|++|+|.+|++++||+.|+.+ |..++.|
T Consensus 306 --------------~~~~~~~~~~~~~~~~~~~~-~~~d~~~enn~~iy~a~~~~~~~~Lng~~Tls~v~~df~kvn~~m 370 (381)
T KOG0311|consen 306 --------------KVAKKKPLKREEVELLVELI-HPLDTASENNYTIYIATSKDQFTSLNGDETLSLVKEDFWKVNEPM 370 (381)
T ss_pred --------------cccccCCccccccccccccc-ccccccccccceeEeecCCCceEEecccchHHHHhhhhhhcccch
Confidence 99999999999999888776 3444455568999999999999999999999999999 9999999
Q ss_pred eehhhhhh
Q 012092 462 LLAYQKIL 469 (471)
Q Consensus 462 ~l~y~~k~ 469 (471)
+|.|..|.
T Consensus 371 ~l~~~~kk 378 (381)
T KOG0311|consen 371 ELSYHEKK 378 (381)
T ss_pred hhhhchhc
Confidence 99998774
|
|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11816 DUF3337: Domain of unknown function (DUF3337); InterPro: IPR021772 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 471 | ||||
| 2ckl_B | 165 | Ring1b-Bmi1 E3 Catalytic Domain Structure Length = | 2e-21 | ||
| 3rpg_C | 121 | Bmi1RING1B-Ubch5c Complex Structure Length = 121 | 5e-20 | ||
| 2h0d_B | 100 | Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti | 2e-18 | ||
| 2h0d_A | 97 | Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti | 3e-05 | ||
| 3rpg_B | 117 | Bmi1RING1B-Ubch5c Complex Structure Length = 117 | 4e-05 | ||
| 2ckl_A | 108 | Ring1b-Bmi1 E3 Catalytic Domain Structure Length = | 4e-05 | ||
| 2djb_A | 72 | Solution Structure Of The Ring Domain Of The Human | 6e-05 | ||
| 2ysl_A | 73 | Solution Structure Of The Ring Domain (1-66) From T | 6e-05 | ||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 1e-04 | ||
| 2ysj_A | 63 | Solution Structure Of The Ring Domain (1-56) From T | 3e-04 | ||
| 2ecw_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 3e-04 | ||
| 2jmd_A | 63 | Solution Structure Of The Ring Domain Of Human Traf | 8e-04 | ||
| 2eci_A | 86 | Solution Structure Of The Ring Domain Of The Human | 9e-04 |
| >pdb|2CKL|B Chain B, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 165 | Back alignment and structure |
|
| >pdb|3RPG|C Chain C, Bmi1RING1B-Ubch5c Complex Structure Length = 121 | Back alignment and structure |
| >pdb|2H0D|B Chain B, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 100 | Back alignment and structure |
| >pdb|2H0D|A Chain A, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 97 | Back alignment and structure |
| >pdb|3RPG|B Chain B, Bmi1RING1B-Ubch5c Complex Structure Length = 117 | Back alignment and structure |
| >pdb|2CKL|A Chain A, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 108 | Back alignment and structure |
| >pdb|2DJB|A Chain A, Solution Structure Of The Ring Domain Of The Human Polycomb Group Ring Finger Protein 6 Length = 72 | Back alignment and structure |
| >pdb|2YSL|A Chain A, Solution Structure Of The Ring Domain (1-66) From Tripartite Motif-containing Protein 31 Length = 73 | Back alignment and structure |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
| >pdb|2YSJ|A Chain A, Solution Structure Of The Ring Domain (1-56) From Tripartite Motif-containing Protein 31 Length = 63 | Back alignment and structure |
| >pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 | Back alignment and structure |
| >pdb|2JMD|A Chain A, Solution Structure Of The Ring Domain Of Human Traf6 Length = 63 | Back alignment and structure |
| >pdb|2ECI|A Chain A, Solution Structure Of The Ring Domain Of The Human Tnf Receptor-Associated Factor 6 Protein Length = 86 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
Score = 124 bits (312), Expect = 6e-34
Identities = 52/136 (38%), Positives = 72/136 (52%), Gaps = 3/136 (2%)
Query: 65 DVDGNESDRSRSSGDGEKDEFVIVKLSDIRKEVQCPICLGIIRKTRTVMECLHRFCRECI 124
++ E R+ + E V V + E+ CPICL +++ T T ECLHRFC +CI
Sbjct: 24 ELSLYELQRTPQEAITDGLEIV-VSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCI 82
Query: 125 DKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEELAFQDEEAARNK 184
A+R GN ECP CR S+RSLR D N+DALI+ +YP D+YE + N
Sbjct: 83 ITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNN 142
Query: 185 Q--IQASIAQTFQRQT 198
Q + SI + + Q
Sbjct: 143 QQALSHSIEEGLKIQA 158
|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 471 | |||
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.5 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.47 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.47 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.46 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.44 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.42 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.42 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.41 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.4 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.38 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.38 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.37 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.34 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.34 | |
| 3gs2_A | 111 | E3 ubiquitin-protein ligase RING2; RING1B, CBOX, C | 99.32 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.32 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.31 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.3 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.29 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.28 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.27 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.26 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.26 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.26 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.26 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.25 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.24 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.23 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.22 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.19 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.18 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.14 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.13 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.1 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.1 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.08 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.07 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.07 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.06 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.01 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.0 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.99 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.98 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.97 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.96 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.94 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.94 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.93 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.92 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.91 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.9 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.87 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.85 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.83 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.78 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.77 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.75 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.62 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.6 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.6 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.59 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.53 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.52 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.49 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.43 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.38 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.34 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.28 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.03 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.99 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.31 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.28 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.26 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 96.09 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 94.8 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 93.93 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 93.61 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 91.99 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 82.53 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 80.74 | |
| 2r2q_A | 110 | Gamma-aminobutyric acid receptor-associated protei | 80.42 | |
| 3h9d_A | 119 | ATG8, microtubule-associated protein 1A/1B, light | 80.41 |
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.50 E-value=1.2e-14 Score=126.86 Aligned_cols=75 Identities=25% Similarity=0.649 Sum_probs=66.7
Q ss_pred hhccCccccccccccccccceeeccCCCcchHHHHHHHhhcCCCCCCccccccccCCcCCccHHHHHHHHHHccch
Q 012092 90 LSDIRKEVQCPICLGIIRKTRTVMECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDI 165 (471)
Q Consensus 90 ~~~l~~~l~CpICl~~~~~Pv~v~~CgH~FC~~CI~~~l~~~~~~CP~Cr~~~~~~~~l~~n~~l~~li~~l~p~c 165 (471)
...+.+.+.|+||+++|.+|++ ++|||+||..||..|+......||+||..+.....+.+|..+.+++.+++|.-
T Consensus 46 ~~~~~~~~~C~IC~~~~~~p~~-~~CgH~fC~~Ci~~~~~~~~~~CP~Cr~~~~~~~~~~~n~~l~~~i~~~~p~~ 120 (124)
T 3fl2_A 46 LSKVEETFQCICCQELVFRPIT-TVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGY 120 (124)
T ss_dssp HHHHHHHTBCTTTSSBCSSEEE-CTTSCEEEHHHHHHHHHTTCCBCTTTCCBCCTTCCCCCCHHHHHHHHHHSTTT
T ss_pred HHhCccCCCCCcCChHHcCcEE-eeCCCcccHHHHHHHHhHCcCCCCCCCccCCCCCCCCCCHHHHHHHHHHcccc
Confidence 4456678999999999999996 89999999999999998556699999999986578999999999999998863
|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3gs2_A E3 ubiquitin-protein ligase RING2; RING1B, CBOX, CBX7, polycomb, E3-ligase, chromosomal protein transcription regulation, chromatin regulator; 1.70A {Homo sapiens} PDB: 3ixs_A* 3h8h_A* | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A | Back alignment and structure |
|---|
| >3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 471 | ||||
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 3e-14 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 8e-12 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-11 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 5e-11 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-09 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 4e-09 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 9e-09 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 2e-08 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 5e-08 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 3e-06 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 4e-06 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 7e-06 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 2e-05 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 2e-05 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 8e-05 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 2e-04 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 66.1 bits (161), Expect = 3e-14
Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 7/69 (10%)
Query: 91 SDIRKEVQCPICLGIIRKTRTVMECLHRFCRECIDKAMRLGNNECPACRTHCASR----- 145
+ K + C IC I+ C H FCR CI + +++ + CP+CR C
Sbjct: 18 AHFVKSISCQICEHIL-ADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESP 76
Query: 146 -RSLRDDLN 153
+S + LN
Sbjct: 77 VKSFLNILN 85
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 471 | |||
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.47 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.45 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.42 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.42 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.41 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.27 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.13 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.12 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.07 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.01 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.0 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.0 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.82 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.62 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.35 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.8 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 84.98 |
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.47 E-value=1.4e-14 Score=115.84 Aligned_cols=68 Identities=16% Similarity=0.197 Sum_probs=60.9
Q ss_pred cCccccccccccccccceeeccCCCcchHHHHHHHhhcCCCCCCccccccccCCcCCccHHHHHHHHHHc
Q 012092 93 IRKEVQCPICLGIIRKTRTVMECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALY 162 (471)
Q Consensus 93 l~~~l~CpICl~~~~~Pv~v~~CgH~FC~~CI~~~l~~~~~~CP~Cr~~~~~~~~l~~n~~l~~li~~l~ 162 (471)
+.++|.||||+++|.+||+ ++|||+||+.||..|+..+...||.|+.++. ...+.+|..|+++|+.+.
T Consensus 4 iP~~l~CpIc~~l~~dPv~-~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~-~~~l~pN~~L~~~I~~~l 71 (80)
T d2c2la2 4 IPDYLCGKISFELMREPCI-TPSGITYDRKDIEEHLQRVGHFNPVTRSPLT-QEQLIPNLAMKEVIDAFI 71 (80)
T ss_dssp CCSTTBCTTTCSBCSSEEE-CSSCCEEETTHHHHHHHHTCSSCTTTCCCCC-GGGCEECHHHHHHHHHHH
T ss_pred CCccccCcCcCchhhhhcc-cCCcCeecHHHHHHHHhcCCccCCCcccccc-ccccccHHHHHHHHHHHH
Confidence 4578999999999999995 9999999999999999866778999999987 467899999999998863
|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|