Citrus Sinensis ID: 012111


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-
MHLSNSIFTPPTTATHLPKFYKEPVFRIQAIKRSPGPIQELGIQKEAEKDLSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKENSGKKLIQC
cccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccc
ccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEEEHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEcc
mhlsnsiftppttathlpkfykepvfriqaikrspgpiqelgIQKEAEKDLSKILRTEFAIKNIEKKVSskkyknlwpkpVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYgqsglldeAFSTindmksvsdckpdvyTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVesggchpdifTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSygragmydKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMkhrgmkpnsityCSLVSAYSKAGLIMKVDSILRQvensdvildtpfFNCIISAygqagdveKMGELFLTMKerhcvpdniTFATMIQAYNALGMTEAAQNLENKMIAMKENSGKKLIQC
mhlsnsiftppttathlpkfYKEPVFRIQAIKrspgpiqelgiqKEAEKDLSKILRTEFAIkniekkvsskkyknlwpKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTINdmksvsdckPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIEtfgkaghiEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMkensgkkliqc
MHLSNSIFTPPTTATHLPKFYKEPVFRIQAIKRSPGPIQELGIQKEAEKDLSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKENSGKKLIQC
**************THLPKFYKEPVFRIQAIK******************LSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEE****FSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTE***********************
*****************************************GIQKEAEKDLSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKENSGKKLIQC
MHLSNSIFTPPTTATHLPKFYKEPVFRIQAIKRSPGPIQELGIQKEAEKDLSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKEN********
*****SIFTPPTTATHLPKFYKEPVFRIQAIKRSPGPIQELGIQKEAEKDLSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKENSGKKLIQC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLSNSIFTPPTTATHLPKFYKEPVFRIQAIKRSPGPIQELGIQKEAEKDLSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNxxxxxxxxxxxxxxxxxxxxxSGKKLIQC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query471 2.2.26 [Sep-21-2011]
Q9SCP4447 Pentatricopeptide repeat- yes no 0.891 0.939 0.661 1e-171
Q9FKC3508 Pentatricopeptide repeat- no no 0.857 0.795 0.457 1e-102
Q9SQU6486 Pentatricopeptide repeat- no no 0.923 0.895 0.396 5e-96
Q9SV96563 Pentatricopeptide repeat- no no 0.760 0.635 0.261 1e-39
Q9S7Q2 862 Pentatricopeptide repeat- no no 0.770 0.421 0.256 2e-38
Q9LYZ9 819 Pentatricopeptide repeat- no no 0.777 0.446 0.288 2e-37
Q5G1S8 1440 Pentatricopeptide repeat- no no 0.779 0.254 0.266 7e-36
Q9FLD8 678 Pentatricopeptide repeat- no no 0.755 0.525 0.248 9e-35
Q8GYP6 860 Pentatricopeptide repeat- no no 0.685 0.375 0.278 4e-34
O82178591 Pentatricopeptide repeat- no no 0.745 0.593 0.235 7e-34
>sp|Q9SCP4|PP279_ARATH Pentatricopeptide repeat-containing protein At3g53170 OS=Arabidopsis thaliana GN=At3g53170 PE=2 SV=1 Back     alignment and function desciption
 Score =  600 bits (1547), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 345/420 (82%)

Query: 44  QKEAEKDLSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGL 103
           Q + +K+LS+ILRT+ A+K IE+K +S+KY  LWPK VLEALDEAIK+ +WQ ALKIF L
Sbjct: 24  QVDPKKELSRILRTDAAVKGIERKANSEKYLTLWPKAVLEALDEAIKENRWQSALKIFNL 83

Query: 104 LRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSG 163
           LR+Q WY+ RC+T+TKL  +LG CKQP+QASLLFEVMLS+GLKP++DVYT+L+S YG+S 
Sbjct: 84  LRKQHWYEPRCKTYTKLFKVLGNCKQPDQASLLFEVMLSEGLKPTIDVYTSLISVYGKSE 143

Query: 164 LLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTY 223
           LLD+AFST+  MKSVSDCKPDV+T+++LI  C K  RFDL++ I+ EMSYLG+ CS VTY
Sbjct: 144 LLDKAFSTLEYMKSVSDCKPDVFTFTVLISCCCKLGRFDLVKSIVLEMSYLGVGCSTVTY 203

Query: 224 NTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFN 283
           NTIIDGYGKA  FEEMES  + M+E G   PD+ TLNS+I +YGN  N+ KME WY+ F 
Sbjct: 204 NTIIDGYGKAGMFEEMESVLADMIEDGDSLPDVCTLNSIIGSYGNGRNMRKMESWYSRFQ 263

Query: 284 LMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIE 343
           LMGV+ DI T NIL  S+G+AGMY KM SVMDFM+KRFF  T VTYNIVIETFGKAG IE
Sbjct: 264 LMGVQPDITTFNILILSFGKAGMYKKMCSVMDFMEKRFFSLTTVTYNIVIETFGKAGRIE 323

Query: 344 KMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCII 403
           KM++ F+KMK++G+KPNSITYCSLV+AYSKAGL++K+DS+LRQ+ NSDV+LDTPFFNCII
Sbjct: 324 KMDDVFRKMKYQGVKPNSITYCSLVNAYSKAGLVVKIDSVLRQIVNSDVVLDTPFFNCII 383

Query: 404 SAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKEN 463
           +AYGQAGD+  M EL++ M+ER C PD ITFATMI+ Y A G+ +A Q LE +MI+  EN
Sbjct: 384 NAYGQAGDLATMKELYIQMEERKCKPDKITFATMIKTYTAHGIFDAVQELEKQMISSGEN 443





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FKC3|PP424_ARATH Pentatricopeptide repeat-containing protein At5g48730, chloroplastic OS=Arabidopsis thaliana GN=At5g48730 PE=2 SV=2 Back     alignment and function description
>sp|Q9SQU6|PP216_ARATH Pentatricopeptide repeat-containing protein At3g06430, chloroplastic OS=Arabidopsis thaliana GN=EMB2750 PE=2 SV=1 Back     alignment and function description
>sp|Q9SV96|PP358_ARATH Pentatricopeptide repeat-containing protein At4g39620, chloroplastic OS=Arabidopsis thaliana GN=EMB2453 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 Back     alignment and function description
>sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 Back     alignment and function description
>sp|Q9FLD8|PP408_ARATH Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 Back     alignment and function description
>sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=1 SV=1 Back     alignment and function description
>sp|O82178|PP186_ARATH Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query471
297736301485 unnamed protein product [Vitis vinifera] 0.949 0.921 0.732 0.0
359487410538 PREDICTED: pentatricopeptide repeat-cont 0.940 0.823 0.731 0.0
255553476486 pentatricopeptide repeat-containing prot 0.980 0.950 0.680 0.0
224104097474 predicted protein [Populus trichocarpa] 0.978 0.972 0.677 0.0
356552149481 PREDICTED: pentatricopeptide repeat-cont 0.980 0.960 0.669 0.0
357458279511 Pentatricopeptide repeat-containing prot 0.966 0.890 0.672 0.0
449436321477 PREDICTED: pentatricopeptide repeat-cont 0.893 0.882 0.686 1e-177
75265624447 RecName: Full=Pentatricopeptide repeat-c 0.891 0.939 0.661 1e-169
334185941499 tetratricopeptide repeat domain-containi 0.895 0.845 0.658 1e-168
297820044439 pentatricopeptide repeat-containing prot 0.868 0.931 0.633 1e-156
>gi|297736301|emb|CBI24939.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/448 (73%), Positives = 380/448 (84%), Gaps = 1/448 (0%)

Query: 24  PVFRIQAIKRSPGPIQELGIQKEAEKDLSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLE 83
           P   ++A KRS G  Q  G+Q++ +KDLS+ILRTE AI  IE+K +S+KY  LWPK VLE
Sbjct: 39  PFLFVRAGKRSSGSSQN-GLQRQPKKDLSRILRTEAAISGIERKANSRKYSTLWPKAVLE 97

Query: 84  ALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSD 143
           ALDEAI++ +++ ALKIFGLLR+Q WY+ RCQT+TKL++MLGKCKQPEQASLLFEVMLS+
Sbjct: 98  ALDEAIRENRYESALKIFGLLRKQHWYEPRCQTYTKLLMMLGKCKQPEQASLLFEVMLSE 157

Query: 144 GLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDL 203
           GL+P++DVYTALVSAYG SG LD+AF T+ DMKSVSDCKPDVYTYSILIK CT   RFDL
Sbjct: 158 GLRPTLDVYTALVSAYGHSGQLDKAFCTVEDMKSVSDCKPDVYTYSILIKCCTTLGRFDL 217

Query: 204 IEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMI 263
           IE+I  EMSYLGIECS VTYNTIIDGYGKA  FE MESS + M+ESG C PDIFTLNS I
Sbjct: 218 IERIFTEMSYLGIECSTVTYNTIIDGYGKADMFELMESSLTEMIESGTCLPDIFTLNSFI 277

Query: 264 SAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFF 323
            AYGNSG IEKMEKWY+EF LMG++ DI+T NIL +SYG+A MY+KM SVM+FM+KRF+ 
Sbjct: 278 WAYGNSGQIEKMEKWYDEFQLMGIRPDIKTFNILIRSYGKACMYEKMVSVMEFMKKRFYS 337

Query: 324 PTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSI 383
           PT+VT+NIVIE FG+ G+IEKMEE+F KMKH+G+KPNSITYCSLVSAYSKAG + KVDSI
Sbjct: 338 PTIVTFNIVIEMFGRVGNIEKMEEFFLKMKHQGVKPNSITYCSLVSAYSKAGYLKKVDSI 397

Query: 384 LRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNA 443
           LRQ+ENSDV LDTPFFNC++SAYGQAGDVE+MGELFL MKER C PDNITFATMIQAYNA
Sbjct: 398 LRQIENSDVTLDTPFFNCVLSAYGQAGDVERMGELFLVMKERKCKPDNITFATMIQAYNA 457

Query: 444 LGMTEAAQNLENKMIAMKENSGKKLIQC 471
            GM EAAQNLE  MI  K  SG +LI C
Sbjct: 458 QGMIEAAQNLEVNMITTKNKSGTRLIGC 485




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359487410|ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255553476|ref|XP_002517779.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543051|gb|EEF44586.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224104097|ref|XP_002313317.1| predicted protein [Populus trichocarpa] gi|222849725|gb|EEE87272.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356552149|ref|XP_003544432.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Glycine max] Back     alignment and taxonomy information
>gi|357458279|ref|XP_003599420.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355488468|gb|AES69671.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449436321|ref|XP_004135941.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] gi|449514880|ref|XP_004164505.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|75265624|sp|Q9SCP4.1|PP279_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g53170 gi|6630737|emb|CAB64220.1| nodulin / glutamate-ammonia ligase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185941|ref|NP_190885.5| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] gi|332645523|gb|AEE79044.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297820044|ref|XP_002877905.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323743|gb|EFH54164.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query471
TAIR|locus:2081041486 PPR2 "pentatricopeptide repeat 0.910 0.882 0.401 2.8e-89
TAIR|locus:2122561563 EMB2453 "EMBRYO DEFECTIVE 2453 0.870 0.728 0.25 9.6e-41
TAIR|locus:2151281 819 AT5G02860 [Arabidopsis thalian 0.878 0.505 0.269 4.9e-39
TAIR|locus:2027166 862 PTAC2 "plastid transcriptional 0.781 0.426 0.256 3.5e-35
TAIR|locus:2150024 729 AT5G01110 [Arabidopsis thalian 0.717 0.463 0.256 1.4e-32
TAIR|locus:1005716169 831 AT5G21222 [Arabidopsis thalian 0.715 0.405 0.276 1.6e-32
TAIR|locus:2093472 642 AT3G16010 [Arabidopsis thalian 0.717 0.526 0.274 2.4e-32
TAIR|locus:2027212 855 AT1G74750 [Arabidopsis thalian 0.636 0.350 0.280 5.8e-32
TAIR|locus:1009023134644 AT1G12775 [Arabidopsis thalian 0.779 0.569 0.273 6.7e-32
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.740 0.554 0.283 7.8e-32
TAIR|locus:2081041 PPR2 "pentatricopeptide repeat 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 891 (318.7 bits), Expect = 2.8e-89, P = 2.8e-89
 Identities = 173/431 (40%), Positives = 273/431 (63%)

Query:    28 IQAIKRSPGPIQELGIQKEAE-KDLSK-ILRTEFAIKNIEKKVSSKKYKNLWPKPVLEAL 85
             + A K SPG + +  + K+ E   +++ + +    IKN++KK+  +   N W   V E L
Sbjct:    36 LAASKSSPGSVTKKRLWKDGEFPGITEPVNQRRTPIKNVKKKLDRRSKANGWVNTVTETL 95

Query:    86 DEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGL 145
              + I +K+W  AL++F +LR+Q +YQ +  T+ KL+V+LGK  QP +A  LF+ ML +GL
Sbjct:    96 SDLIAKKQWLQALEVFDMLREQTFYQPKEGTYMKLLVLLGKSGQPNRAQKLFDEMLEEGL 155

Query:   146 KPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIE 205
             +P+V++YTAL++AY +S L+D+AFS ++ MKS   C+PDV+TYS L+K+C    +FDL++
Sbjct:   156 EPTVELYTALLAAYTRSNLIDDAFSILDKMKSFPQCQPDVFTYSTLLKACVDASQFDLVD 215

Query:   206 KILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISA 265
              +  EM    I  + VT N ++ GYG+  +F++ME   S M+ S  C PD++T+N ++S 
Sbjct:   216 SLYKEMDERLITPNTVTQNIVLSGYGRVGRFDQMEKVLSDMLVSTACKPDVWTMNIILSV 275

Query:   266 YGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPT 325
             +GN G I+ ME WY +F   G++ + +T NIL  SYG+  MYDKM SVM++M+K  F  T
Sbjct:   276 FGNMGKIDMMESWYEKFRNFGIEPETRTFNILIGSYGKKRMYDKMSSVMEYMRKLEFPWT 335

Query:   326 VVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILR 385
               TYN +IE F   G  + ME  F +M+  GMK ++ T+C L++ Y+ AGL  KV S ++
Sbjct:   336 TSTYNNIIEAFADVGDAKNMELTFDQMRSEGMKADTKTFCCLINGYANAGLFHKVISSVQ 395

Query:   386 QVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALG 445
                  ++  +T F+N +ISA  +A D+ +M  +++ MKER CV D+ TF  M++AY   G
Sbjct:   396 LAAKFEIPENTAFYNAVISACAKADDLIEMERVYIRMKERQCVCDSRTFEIMVEAYEKEG 455

Query:   446 MTEAAQNLENK 456
             M +    LE +
Sbjct:   456 MNDKIYYLEQE 466


GO:0005739 "mitochondrion" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0048868 "pollen tube development" evidence=IMP
GO:0009507 "chloroplast" evidence=IDA
GO:0009553 "embryo sac development" evidence=IMP
GO:0009555 "pollen development" evidence=IMP
GO:0009790 "embryo development" evidence=IMP
GO:0019843 "rRNA binding" evidence=IDA
TAIR|locus:2122561 EMB2453 "EMBRYO DEFECTIVE 2453" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027166 PTAC2 "plastid transcriptionally active 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150024 AT5G01110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716169 AT5G21222 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093472 AT3G16010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027212 AT1G74750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023134 AT1G12775 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SCP4PP279_ARATHNo assigned EC number0.66190.89170.9395yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00028740001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (495 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-20
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-17
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-16
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-15
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-14
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-12
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-09
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-07
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-05
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-05
pfam0153531 pfam01535, PPR, PPR repeat 6e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
pfam1285434 pfam12854, PPR_1, PPR repeat 0.002
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 93.8 bits (233), Expect = 3e-20
 Identities = 73/340 (21%), Positives = 151/340 (44%), Gaps = 2/340 (0%)

Query: 115 QTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTIND 174
            TF  LM +    +  + A  +  ++   GLK    +YT L+S   +SG +D  F   ++
Sbjct: 438 STFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHE 497

Query: 175 MKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAK 234
           M   +  + +V+T+  LI  C +  +          M    ++   V +N +I   G++ 
Sbjct: 498 M-VNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSG 556

Query: 235 KFEEMESSFSAM-VESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQT 293
             +      + M  E+    PD  T+ +++ A  N+G +++ ++ Y   +   +K   + 
Sbjct: 557 AVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEV 616

Query: 294 LNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMK 353
             I   S  + G +D   S+ D M+K+   P  V ++ +++  G AG ++K  E  +  +
Sbjct: 617 YTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDAR 676

Query: 354 HRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVE 413
            +G+K  +++Y SL+ A S A    K   +   +++  +       N +I+A  +   + 
Sbjct: 677 KQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLP 736

Query: 414 KMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNL 453
           K  E+   MK     P+ IT++ ++ A       +   +L
Sbjct: 737 KALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDL 776


Length = 1060

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 471
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.92
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.92
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.9
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.89
PRK14574 822 hmsH outer membrane protein; Provisional 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
PRK14574 822 hmsH outer membrane protein; Provisional 99.83
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.79
KOG2076 895 consensus RNA polymerase III transcription factor 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.75
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.74
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.7
KOG2003 840 consensus TPR repeat-containing protein [General f 99.69
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.69
KOG2003 840 consensus TPR repeat-containing protein [General f 99.69
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.68
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.67
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.67
KOG0547606 consensus Translocase of outer mitochondrial membr 99.67
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.67
KOG1126638 consensus DNA-binding cell division cycle control 99.66
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.66
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.65
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.64
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.64
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.64
KOG2076 895 consensus RNA polymerase III transcription factor 99.63
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.63
KOG1126638 consensus DNA-binding cell division cycle control 99.62
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.62
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.57
KOG1915677 consensus Cell cycle control protein (crooked neck 99.52
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.51
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.49
PRK12370553 invasion protein regulator; Provisional 99.48
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.47
PRK12370553 invasion protein regulator; Provisional 99.47
KOG1129478 consensus TPR repeat-containing protein [General f 99.47
KOG0547606 consensus Translocase of outer mitochondrial membr 99.47
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.46
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.45
KOG1129478 consensus TPR repeat-containing protein [General f 99.45
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.44
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.42
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.4
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.4
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.39
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.38
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.36
PF1304150 PPR_2: PPR repeat family 99.35
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.35
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.32
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.32
PF1304150 PPR_2: PPR repeat family 99.31
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.29
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.28
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.27
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.26
PRK11189296 lipoprotein NlpI; Provisional 99.25
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.24
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.24
PRK11189296 lipoprotein NlpI; Provisional 99.22
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.21
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.21
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.2
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.19
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.19
PRK04841 903 transcriptional regulator MalT; Provisional 99.19
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.08
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.03
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.02
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.0
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.97
KOG1125579 consensus TPR repeat-containing protein [General f 98.96
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.95
PRK04841903 transcriptional regulator MalT; Provisional 98.94
KOG1125579 consensus TPR repeat-containing protein [General f 98.94
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.94
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.89
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.88
PLN02789320 farnesyltranstransferase 98.86
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.84
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.82
PLN02789320 farnesyltranstransferase 98.81
PRK10370198 formate-dependent nitrite reductase complex subuni 98.8
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.79
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.77
PF1285434 PPR_1: PPR repeat 98.77
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.76
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.74
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.73
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.73
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.71
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.71
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.71
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.7
PF1285434 PPR_1: PPR repeat 98.7
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.7
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.69
KOG1128777 consensus Uncharacterized conserved protein, conta 98.69
PRK10370198 formate-dependent nitrite reductase complex subuni 98.69
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.68
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.67
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.67
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.65
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.63
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.63
PRK15359144 type III secretion system chaperone protein SscB; 98.61
PRK15359144 type III secretion system chaperone protein SscB; 98.61
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.61
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.54
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.53
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.52
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.5
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.46
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.42
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.4
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.33
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.3
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.23
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.22
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.18
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.17
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.13
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.12
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.12
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.11
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.07
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.06
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.05
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.01
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.01
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.96
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.94
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.93
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.93
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.93
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.91
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.9
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.89
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.88
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.88
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.86
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.85
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.84
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.83
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.82
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.82
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.8
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.8
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.78
COG4700251 Uncharacterized protein conserved in bacteria cont 97.78
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.78
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.78
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.77
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.77
KOG0553304 consensus TPR repeat-containing protein [General f 97.74
KOG0553304 consensus TPR repeat-containing protein [General f 97.73
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.73
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.69
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.67
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.65
PRK10803263 tol-pal system protein YbgF; Provisional 97.62
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.6
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.6
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.58
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.57
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.56
PF12688120 TPR_5: Tetratrico peptide repeat 97.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.46
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.42
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.41
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.37
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.37
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.36
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.36
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.32
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.31
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.3
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.27
PF12688120 TPR_5: Tetratrico peptide repeat 97.27
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.22
KOG20411189 consensus WD40 repeat protein [General function pr 97.2
PF1337173 TPR_9: Tetratricopeptide repeat 97.18
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.16
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.13
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.1
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.09
PRK10803263 tol-pal system protein YbgF; Provisional 97.07
COG4700251 Uncharacterized protein conserved in bacteria cont 97.04
PF1337173 TPR_9: Tetratricopeptide repeat 96.99
PRK15331165 chaperone protein SicA; Provisional 96.88
COG3898531 Uncharacterized membrane-bound protein [Function u 96.85
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.85
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.82
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.81
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.79
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.77
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.73
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.72
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.67
PRK15331165 chaperone protein SicA; Provisional 96.64
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.59
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.54
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.5
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.5
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.42
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.4
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.36
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.3
KOG3941406 consensus Intermediate in Toll signal transduction 96.26
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.25
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.25
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.24
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.22
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.17
smart00299140 CLH Clathrin heavy chain repeat homology. 96.15
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.05
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.04
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.03
KOG1258 577 consensus mRNA processing protein [RNA processing 96.02
KOG4555175 consensus TPR repeat-containing protein [Function 96.0
PF13512142 TPR_18: Tetratricopeptide repeat 95.99
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.9
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.88
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.78
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.7
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.68
KOG4555175 consensus TPR repeat-containing protein [Function 95.68
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.55
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.53
COG3629280 DnrI DNA-binding transcriptional activator of the 95.52
PF1342844 TPR_14: Tetratricopeptide repeat 95.48
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.47
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.4
PRK11906458 transcriptional regulator; Provisional 95.39
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.36
KOG3941 406 consensus Intermediate in Toll signal transduction 95.36
smart00299140 CLH Clathrin heavy chain repeat homology. 95.35
PF13512142 TPR_18: Tetratricopeptide repeat 95.31
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.26
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.26
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.18
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.16
PF1342844 TPR_14: Tetratricopeptide repeat 95.03
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.0
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.89
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.84
KOG1941518 consensus Acetylcholine receptor-associated protei 94.76
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.58
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.55
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.53
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.45
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.36
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 94.22
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.2
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 93.96
PRK11906458 transcriptional regulator; Provisional 93.84
COG3629280 DnrI DNA-binding transcriptional activator of the 93.62
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.62
KOG1585308 consensus Protein required for fusion of vesicles 93.61
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 93.47
KOG1550552 consensus Extracellular protein SEL-1 and related 93.45
PF1343134 TPR_17: Tetratricopeptide repeat 93.33
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.25
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.1
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.09
PF13929292 mRNA_stabil: mRNA stabilisation 92.91
KOG1585308 consensus Protein required for fusion of vesicles 92.9
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.89
COG2976207 Uncharacterized protein conserved in bacteria [Fun 92.67
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 92.66
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.47
PF1343134 TPR_17: Tetratricopeptide repeat 92.27
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.23
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.17
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.05
KOG4570 418 consensus Uncharacterized conserved protein [Funct 91.82
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 91.76
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.6
COG4455273 ImpE Protein of avirulence locus involved in tempe 91.15
KOG1550552 consensus Extracellular protein SEL-1 and related 91.12
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.94
KOG4570418 consensus Uncharacterized conserved protein [Funct 90.87
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.81
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 90.72
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.66
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.5
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.46
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.14
COG4455 273 ImpE Protein of avirulence locus involved in tempe 90.1
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 89.83
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.53
COG3947361 Response regulator containing CheY-like receiver a 89.53
COG0457291 NrfG FOG: TPR repeat [General function prediction 88.91
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.61
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 88.5
KOG4648 536 consensus Uncharacterized conserved protein, conta 88.5
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 88.37
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.91
KOG4234271 consensus TPR repeat-containing protein [General f 87.6
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.53
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 87.37
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 87.12
PF13929292 mRNA_stabil: mRNA stabilisation 86.78
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 86.75
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 86.74
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 86.52
KOG4648 536 consensus Uncharacterized conserved protein, conta 85.46
PRK09687280 putative lyase; Provisional 84.63
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 84.56
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 84.55
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.26
KOG4234271 consensus TPR repeat-containing protein [General f 83.91
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 83.75
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.65
PF06552186 TOM20_plant: Plant specific mitochondrial import r 83.6
PF06552186 TOM20_plant: Plant specific mitochondrial import r 83.55
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 83.55
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 83.0
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 82.82
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 82.27
KOG1258577 consensus mRNA processing protein [RNA processing 82.01
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 81.93
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 81.51
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 81.49
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 81.32
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 81.07
PF13762145 MNE1: Mitochondrial splicing apparatus component 80.57
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 80.39
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 80.13
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.8e-61  Score=477.04  Aligned_cols=416  Identities=20%  Similarity=0.295  Sum_probs=384.6

Q ss_pred             hhhHHHHHHHhhHHHHHHHHHhhhhhhccCCCchHHHHHHHHHHHhhcHHHHHHHHHHhhhccCccCChhHHHHHHHHHh
Q 012111           46 EAEKDLSKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLG  125 (471)
Q Consensus        46 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~  125 (471)
                      .....+.+.++...+.+.++++.... ......-.....+..+.+.|.+++|+++|+.|..     |+..+|+.++.+|+
T Consensus       375 ~~y~~l~r~G~l~eAl~Lfd~M~~~g-vv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~-----pd~~Tyn~LL~a~~  448 (1060)
T PLN03218        375 DAYNRLLRDGRIKDCIDLLEDMEKRG-LLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRN-----PTLSTFNMLMSVCA  448 (1060)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHHhCC-CCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCC-----CCHHHHHHHHHHHH
Confidence            34444555567777777777664421 1111112223556777888899999999988863     89999999999999


Q ss_pred             cCCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhcCCCCCCCHHHHHHHHHHHHhcCCHHHHH
Q 012111          126 KCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIE  205 (471)
Q Consensus       126 ~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~  205 (471)
                      +.|+++.|.++|+.|.+.|+.||..+|+.||.+|++.|++++|.++|++|.+ .|+.||..+|+.+|.+|++.|++++|.
T Consensus       449 k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~-~Gv~PdvvTynaLI~gy~k~G~~eeAl  527 (1060)
T PLN03218        449 SSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVN-AGVEANVHTFGALIDGCARAGQVAKAF  527 (1060)
T ss_pred             hCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHH-cCCCCCHHHHHHHHHHHHHCcCHHHHH
Confidence            9999999999999999999999999999999999999999999999999998 799999999999999999999999999


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHHc-CCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHh
Q 012111          206 KILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVES-GGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNL  284 (471)
Q Consensus       206 ~~~~~~~~~g~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~-~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~  284 (471)
                      ++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+. .++.||..+|+.++.+|++.|++++|.++|++|.+
T Consensus       528 ~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e  607 (1060)
T PLN03218        528 GAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHE  607 (1060)
T ss_pred             HHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999763 46899999999999999999999999999999999


Q ss_pred             CCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHH
Q 012111          285 MGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITY  364 (471)
Q Consensus       285 ~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~  364 (471)
                      .|+.|+..+|+.+|.+|++.|++++|..+|+.|.+.|+.||..+|+.++.+|++.|++++|.+++++|.+.|+.||..+|
T Consensus       608 ~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~ty  687 (1060)
T PLN03218        608 YNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSY  687 (1060)
T ss_pred             cCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCHHHHHHHHHHHHhCCCCcCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhc
Q 012111          365 CSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNAL  444 (471)
Q Consensus       365 ~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~  444 (471)
                      +.+|.+|++.|++++|.++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|.+.|+.||..||+.++.+|.+.
T Consensus       688 nsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k~  767 (1060)
T PLN03218        688 SSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERK  767 (1060)
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHhhhcCCCCc
Q 012111          445 GMTEAAQNLENKMIAMKENSGKKL  468 (471)
Q Consensus       445 g~~~~A~~~~~~m~~~~~~~~~~~  468 (471)
                      |++++|.+++++|++.+..++..+
T Consensus       768 G~le~A~~l~~~M~k~Gi~pd~~t  791 (1060)
T PLN03218        768 DDADVGLDLLSQAKEDGIKPNLVM  791 (1060)
T ss_pred             CCHHHHHHHHHHHHHcCCCCCHHH
Confidence            999999999999999998887544



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 81.8 bits (200), Expect = 1e-16
 Identities = 25/223 (11%), Positives = 72/223 (32%), Gaps = 4/223 (1%)

Query: 239 MESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILT 298
           M              P    L  ++       +++  +    + +   +    Q L    
Sbjct: 75  MAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF 134

Query: 299 KSYGRAGMYDKMRSVMDFMQKRF---FFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHR 355
           K             ++     +       T+  YN V+  + + G  +++      +K  
Sbjct: 135 KCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDA 194

Query: 356 GMKPNSITYCSLVSAYSKAGLIMK-VDSILRQVENSDVILDTPFFNCIISAYGQAGDVEK 414
           G+ P+ ++Y + +    +       ++  L Q+    + L   F   ++S   +A  ++ 
Sbjct: 195 GLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKA 254

Query: 415 MGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKM 457
           + ++  T      +P  +  + +++   A     +   L   +
Sbjct: 255 VHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPL 297


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query471
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.98
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.88
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.85
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.84
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.82
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.82
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.82
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.81
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.8
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.77
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.77
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.76
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.73
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.73
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.71
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.7
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.69
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.69
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.68
3u4t_A272 TPR repeat-containing protein; structural genomics 99.68
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.67
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.67
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.66
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.66
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.65
3u4t_A272 TPR repeat-containing protein; structural genomics 99.65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.65
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.64
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.63
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.62
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.61
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.61
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.59
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.59
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.59
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.58
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.56
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.55
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.55
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.53
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.53
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.53
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.51
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.51
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.49
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.49
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.48
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.47
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.41
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.41
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.39
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.38
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.38
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.3
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.29
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.27
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.26
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.21
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.21
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.21
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.17
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.13
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.1
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.1
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.09
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.08
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.07
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.07
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.05
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.03
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.02
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.01
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.01
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.0
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.99
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.98
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.98
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.98
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.97
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.97
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.96
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.93
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.92
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.92
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.86
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.86
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.86
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.85
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.84
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.83
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.79
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.79
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.78
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.77
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.76
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.74
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.73
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.73
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.72
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.72
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.72
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.71
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.7
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.7
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.68
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.66
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.66
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.65
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.64
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.63
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.63
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.62
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.62
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.61
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.6
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.6
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.6
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.6
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.59
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.56
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.56
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.55
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.55
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.55
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.55
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.53
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.51
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.49
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.46
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.44
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.43
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.43
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.43
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.42
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.41
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.38
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.38
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.36
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.35
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.35
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.34
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.32
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.3
3k9i_A117 BH0479 protein; putative protein binding protein, 98.27
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.27
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.26
3k9i_A117 BH0479 protein; putative protein binding protein, 98.23
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.23
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.22
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.2
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.18
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.17
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.16
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.14
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.03
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.02
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.97
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.97
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.92
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.89
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.87
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.83
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.82
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.82
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.79
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.78
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.77
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.73
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.7
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.69
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.66
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.55
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.41
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.2
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.19
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.11
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.96
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.94
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.89
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.88
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.87
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.86
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.84
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.8
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.7
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.61
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.58
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.53
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.51
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.31
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.29
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.04
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.97
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.88
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.87
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.72
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.47
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.44
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.36
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.8
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 94.22
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 94.06
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.98
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 93.87
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.85
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.58
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.57
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.08
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.97
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.89
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 92.59
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 92.37
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.34
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.11
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 90.88
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.84
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 89.69
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 89.64
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 88.88
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 86.61
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 86.03
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 85.9
3lpz_A 336 GET4 (YOR164C homolog); protein targeting, tail-an 84.78
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 84.09
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=8.7e-35  Score=285.75  Aligned_cols=400  Identities=11%  Similarity=-0.029  Sum_probs=309.1

Q ss_pred             HHHHhhHHHHHHHHHhhhhhhccCCCchHHHHHHHHHHHhhcHHHHHHHHHHhhhccCccCChhHHHHHHHHHhcCCCHH
Q 012111           52 SKILRTEFAIKNIEKKVSSKKYKNLWPKPVLEALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPE  131 (471)
Q Consensus        52 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  131 (471)
                      .+.++...+...+..++...+    .+..+..+...+.+.|++++|+++|+.+...   +++..+++.++.+|.+.|+++
T Consensus        95 ~~~g~~~~A~~~~~~~~~~~p----~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~---~~~~~~~~~l~~~~~~~g~~~  167 (597)
T 2xpi_A           95 LMQQQYKCAAFVGEKVLDITG----NPNDAFWLAQVYCCTGDYARAKCLLTKEDLY---NRSSACRYLAAFCLVKLYDWQ  167 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHHC----CHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG---GTCHHHHHHHHHHHHHTTCHH
T ss_pred             HHccCchHHHHHHHHHHhhCC----CchHHHHHHHHHHHcCcHHHHHHHHHHHhcc---ccchhHHHHHHHHHHHHhhHH
Confidence            344456667777776664333    3356677888888999999999999988653   678888999999999999999


Q ss_pred             HHHHHHHHHHhC---------------CCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhcCCCC---------------
Q 012111          132 QASLLFEVMLSD---------------GLKPSVDVYTALVSAYGQSGLLDEAFSTINDMKSVSDC---------------  181 (471)
Q Consensus       132 ~a~~~~~~m~~~---------------~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~---------------  181 (471)
                      +|.++|+++...               |.+.+..+|+.++.+|.+.|++++|+++|+++.+....               
T Consensus       168 ~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~  247 (597)
T 2xpi_A          168 GALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLT  247 (597)
T ss_dssp             HHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTCSC
T ss_pred             HHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCchhhHHHHHHHHhhccc
Confidence            999999853221               22335788999999999999999999988888652210               


Q ss_pred             ------------------------------------------------------CCCHHHHHHHHHHHHhcCCHHHHHHH
Q 012111          182 ------------------------------------------------------KPDVYTYSILIKSCTKFHRFDLIEKI  207 (471)
Q Consensus       182 ------------------------------------------------------~~~~~~~~~ll~~~~~~~~~~~a~~~  207 (471)
                                                                            +++..+++.++..+.+.|++++|.++
T Consensus       248 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~  327 (597)
T 2xpi_A          248 ADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAI  327 (597)
T ss_dssp             HHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             chhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHH
Confidence                                                                  14556666666677777777777777


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHHcCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCC
Q 012111          208 LAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSFSAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGV  287 (471)
Q Consensus       208 ~~~~~~~g~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~  287 (471)
                      |+++.+.+ +.+..++..++.++.+.|++++|.++++.+.+..  +.+..++..++..|.+.|++++|.++|+++.+.. 
T Consensus       328 ~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-  403 (597)
T 2xpi_A          328 TTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH--PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-  403 (597)
T ss_dssp             HHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC--TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-
T ss_pred             HHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC--cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-
Confidence            77776554 3355666677777777777777777777776542  5567788888888889999999999998887653 


Q ss_pred             CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHH
Q 012111          288 KADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFFPTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSL  367 (471)
Q Consensus       288 ~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~l  367 (471)
                      +.+..+|+.++.+|.+.|++++|..+|+.+.+.+. .+..+|..++.+|.+.|++++|.++|+++.+.. +.+..+|..+
T Consensus       404 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l  481 (597)
T 2xpi_A          404 PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQ-GTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYDPLLLNEL  481 (597)
T ss_dssp             TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTT-TCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCc-cchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCChHHHHHH
Confidence            55677888889999999999999999988887643 367788888888999999999999999888764 4478888899


Q ss_pred             HHHHHhcCCHHHHHHHHHHHHhC----CCCcC--HHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHH
Q 012111          368 VSAYSKAGLIMKVDSILRQVENS----DVILD--TPFFNCIISAYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAY  441 (471)
Q Consensus       368 i~~~~~~g~~~~a~~~~~~~~~~----~~~~~--~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~  441 (471)
                      +..|.+.|++++|.++|+++.+.    +..|+  ..+|..++.+|.+.|++++|.++|+++.+.+ +.+..+|..+..+|
T Consensus       482 ~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~  560 (597)
T 2xpi_A          482 GVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVY  560 (597)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHH
T ss_pred             HHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHH
Confidence            99999999999999999888765    55666  6788899999999999999999999888753 34788888888999


Q ss_pred             HhcCCHHHHHHHHHHHHHhhhcCC
Q 012111          442 NALGMTEAAQNLENKMIAMKENSG  465 (471)
Q Consensus       442 ~~~g~~~~A~~~~~~m~~~~~~~~  465 (471)
                      .+.|++++|.+.++++++..|+..
T Consensus       561 ~~~g~~~~A~~~~~~~l~~~p~~~  584 (597)
T 2xpi_A          561 LHKKIPGLAITHLHESLAISPNEI  584 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHCTTCH
T ss_pred             HHhCCHHHHHHHHHHHHhcCCCCh
Confidence            999999999999999988887653



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query471
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.69
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.68
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.36
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.32
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.31
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.31
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.3
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.27
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.16
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.14
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.12
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.11
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.77
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.74
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.73
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.65
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.62
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.62
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.61
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.58
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.54
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.48
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.47
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.46
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.41
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.4
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.4
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.28
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.24
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.15
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.11
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.07
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.05
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.0
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.95
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.94
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.88
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.86
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.86
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.84
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.77
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.76
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.66
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.23
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.19
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.16
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.64
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.46
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.22
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.02
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.69
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.59
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 94.16
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.43
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 91.59
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 91.27
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=1.5e-22  Score=184.90  Aligned_cols=368  Identities=11%  Similarity=0.096  Sum_probs=286.4

Q ss_pred             HHHHHHHhhcHHHHHHHHHHhhhccCccCChhHHHHHHHHHhcCCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcC
Q 012111           84 ALDEAIKQKKWQLALKIFGLLRQQQWYQARCQTFTKLMVMLGKCKQPEQASLLFEVMLSDGLKPSVDVYTALVSAYGQSG  163 (471)
Q Consensus        84 ~l~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~  163 (471)
                      ......+.|++++|++.|+.+.+..  |.+..++..+..++.+.|++++|...|+...+.... +..+|..+..+|...|
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKERG   81 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhhhhc
Confidence            3455678999999999999998875  667888999999999999999999999999887533 6788999999999999


Q ss_pred             CHHHHHHHHHHhhcCCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHH
Q 012111          164 LLDEAFSTINDMKSVSDCKPDVYTYSILIKSCTKFHRFDLIEKILAEMSYLGIECSAVTYNTIIDGYGKAKKFEEMESSF  243 (471)
Q Consensus       164 ~~~~a~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~l~~~~~~~~~~~~a~~~~  243 (471)
                      ++++|+..+.......  +.+..............+....+........... .................+....+...+
T Consensus        82 ~~~~A~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLK--PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN-PDLYCVRSDLGNLLKALGRLEEAKACY  158 (388)
T ss_dssp             CHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-TTCTHHHHHHHHHHHTTSCHHHHHHHH
T ss_pred             cccccccccccccccc--cccccccccccccccccccccccccccccccccc-cccccccccccccccccchhhhhHHHH
Confidence            9999999999988732  3445555555555556666666666655555443 334445555666667778888888888


Q ss_pred             HHHHHcCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCC
Q 012111          244 SAMVESGGCHPDIFTLNSMISAYGNSGNIEKMEKWYNEFNLMGVKADIQTLNILTKSYGRAGMYDKMRSVMDFMQKRFFF  323 (471)
Q Consensus       244 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~  323 (471)
                      .......  +.+...+..+...+...|++++|...+++..... +-+...+..+...+...|++++|...+.........
T Consensus       159 ~~~~~~~--~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~  235 (388)
T d1w3ba_         159 LKAIETQ--PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN  235 (388)
T ss_dssp             HHHHHHC--TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT
T ss_pred             HHhhccC--cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhh
Confidence            7776653  4456777788888888899999998888887654 456677888888888889999998888888776433


Q ss_pred             CCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCcCHHHHHHHH
Q 012111          324 PTVVTYNIVIETFGKAGHIEKMEEYFKKMKHRGMKPNSITYCSLVSAYSKAGLIMKVDSILRQVENSDVILDTPFFNCII  403 (471)
Q Consensus       324 ~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~  403 (471)
                       +...+..+...+...|++++|...|++..+.. +-+..++..+...+...|++++|.+.++......+. +...+..+.
T Consensus       236 -~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~-~~~~~~~l~  312 (388)
T d1w3ba_         236 -HAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPT-HADSLNNLA  312 (388)
T ss_dssp             -CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTT-CHHHHHHHH
T ss_pred             -HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCc-cchhhhHHH
Confidence             56677778888888899999999998888753 335678888888888889999999988888776544 777888888


Q ss_pred             HHHHhcCCHHHHHHHHHHHHhCCCCC-CHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhhhcCC
Q 012111          404 SAYGQAGDVEKMGELFLTMKERHCVP-DNITFATMIQAYNALGMTEAAQNLENKMIAMKENSG  465 (471)
Q Consensus       404 ~~~~~~g~~~~a~~~~~~~~~~~~~p-~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~  465 (471)
                      ..+...|++++|++.|++..+.  .| +..++..+..+|...|++++|.+.++++++..|+..
T Consensus       313 ~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~  373 (388)
T d1w3ba_         313 NIKREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFA  373 (388)
T ss_dssp             HHHHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCH
T ss_pred             HHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCH
Confidence            8888889999999999888774  44 466777888888889999999999998888877643



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure