Citrus Sinensis ID: 012539


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGEISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRVCWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCKGYW
cccccccHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHcccccccccEEHHHHHHHHHHccccHHHHHHHHHHHHccccccEEHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccHHHHHHHHHccccccccEEEEccccccccHHHHHHHHHHHcccEEEEEccccccccccccccccccc
cccccccHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEcccccEEcccccEcccccc
myaelgclgycqkvfdgihepdVVCQTAMISACAKCGDVDLARKMfdemperdpiAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACThlgaldqgrwAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWgmkernvyTWTSVIGGlamngageKSLELFSLMKqagvrpneVTFVSVLRGCCVVGLVEEGREHFDSMRReygiepwleHYGCLVDLYGRAGRLDEALDVInkmpmkphagAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAkgvkklpgcsvieVDREVheffagdethpryNEIEVMLGEISRRLKLAgyvantnpvmydieeeekedtlckHSEKVAIAFGLislkegvpirIVKNLRVCWDCHDVTKMISKVFNReiivrdrnrfhhfkegkcsckgyw
MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNiyaesknwDRVINVRQIMkakgvkklpgcsVIEVDREVHEffagdethpryNEIEVMLGEISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFglislkegvpiRIVKNLRVCWDCHDVTKMiskvfnreiivrdrnrfhhfkegkcsckgyw
MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGEISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRVCWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCKGYW
**AELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGEISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRVCWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCK***
MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGEISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRVCWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCKGYW
MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGEISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRVCWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCKGYW
MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGEISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRVCWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCKGYW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGEISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRVCWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCKGYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query461 2.2.26 [Sep-21-2011]
Q9FND7612 Putative pentatricopeptid yes no 1.0 0.753 0.715 0.0
Q9FJY7620 Pentatricopeptide repeat- no no 0.997 0.741 0.462 1e-128
Q9SZT8632 Pentatricopeptide repeat- no no 1.0 0.729 0.473 1e-127
Q683I9573 Pentatricopeptide repeat- no no 1.0 0.804 0.472 1e-126
O82380738 Pentatricopeptide repeat- no no 1.0 0.624 0.453 1e-125
Q9FG16622 Pentatricopeptide repeat- no no 1.0 0.741 0.476 1e-124
Q9FI80646 Pentatricopeptide repeat- no no 0.837 0.597 0.477 1e-122
O23337722 Pentatricopeptide repeat- no no 0.997 0.637 0.463 1e-121
A8MQA3595 Pentatricopeptide repeat- no no 0.952 0.737 0.463 1e-119
Q9LW32659 Pentatricopeptide repeat- no no 0.952 0.666 0.475 1e-116
>sp|Q9FND7|PP410_ARATH Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana GN=PCMP-H14 PE=3 SV=1 Back     alignment and function desciption
 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/461 (71%), Positives = 396/461 (85%)

Query: 1   MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAM 60
           +YAELGCL  C KVF+ I  PD VC+TAM++ACA+CGDV  ARK+F+ MPERDPIAWNAM
Sbjct: 152 LYAELGCLDSCHKVFNSIPCPDFVCRTAMVTACARCGDVVFARKLFEGMPERDPIAWNAM 211

Query: 61  LAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRL 120
           ++GYAQ G+SREAL++FHLMQ+  VK+N V+M+SVLSACT LGALDQGRWAH YIERN++
Sbjct: 212 ISGYAQVGESREALNVFHLMQLEGVKVNGVAMISVLSACTQLGALDQGRWAHSYIERNKI 271

Query: 121 KMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSL 180
           K+TV L T LVD+Y+KCG+M KAM+ FWGM+E+NVYTW+S + GLAMNG GEK LELFSL
Sbjct: 272 KITVRLATTLVDLYAKCGDMEKAMEVFWGMEEKNVYTWSSALNGLAMNGFGEKCLELFSL 331

Query: 181 MKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAG 240
           MKQ GV PN VTFVSVLRGC VVG V+EG+ HFDSMR E+GIEP LEHYGCLVDLY RAG
Sbjct: 332 MKQDGVTPNAVTFVSVLRGCSVVGFVDEGQRHFDSMRNEFGIEPQLEHYGCLVDLYARAG 391

Query: 241 RLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSN 300
           RL++A+ +I +MPMKPHA  W +LL+A RMYKN E+G LAS+K++ELET NHGAYVLLSN
Sbjct: 392 RLEDAVSIIQQMPMKPHAAVWSSLLHASRMYKNLELGVLASKKMLELETANHGAYVLLSN 451

Query: 301 IYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGE 360
           IYA+S +WD V +VRQ MK+KGV+K PGCSV+EV+ EVHEFF GD++HP+Y +I+ +  +
Sbjct: 452 IYADSNDWDNVSHVRQSMKSKGVRKQPGCSVMEVNGEVHEFFVGDKSHPKYTQIDAVWKD 511

Query: 361 ISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRV 420
           ISRRL+LAGY A+T PVM+DI+EEEKED LC HSEK AIAFG++SLKE VPIRIVKNLRV
Sbjct: 512 ISRRLRLAGYKADTTPVMFDIDEEEKEDALCLHSEKAAIAFGIMSLKEDVPIRIVKNLRV 571

Query: 421 CWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCKGYW 461
           C DCH V+ MISK+FNREIIVRDRNRFHHFK+G CSC G+W
Sbjct: 572 CGDCHQVSMMISKIFNREIIVRDRNRFHHFKDGHCSCNGFW 612





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protein At4g37380, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H48 PE=3 SV=1 Back     alignment and function description
>sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protein At4g14820 OS=Arabidopsis thaliana GN=PCMP-H3 PE=2 SV=1 Back     alignment and function description
>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2 Back     alignment and function description
>sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protein At3g26782, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H34 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
359473281 615 PREDICTED: putative pentatricopeptide re 1.0 0.749 0.791 0.0
449435364 614 PREDICTED: putative pentatricopeptide re 1.0 0.750 0.731 0.0
356524120 616 PREDICTED: putative pentatricopeptide re 1.0 0.748 0.754 0.0
79329389 612 pentatricopeptide repeat-containing prot 1.0 0.753 0.715 0.0
297805648 1111 hypothetical protein ARALYDRAFT_493946 [ 0.982 0.407 0.713 0.0
326522230 628 predicted protein [Hordeum vulgare subsp 1.0 0.734 0.622 1e-174
297597505 699 Os01g0715700 [Oryza sativa Japonica Grou 1.0 0.659 0.618 1e-170
222619165 706 hypothetical protein OsJ_03249 [Oryza sa 1.0 0.652 0.618 1e-170
218188961 706 hypothetical protein OsI_03510 [Oryza sa 1.0 0.652 0.618 1e-170
212721478 617 uncharacterized protein LOC100192486 [Ze 0.997 0.745 0.600 1e-165
>gi|359473281|ref|XP_003631282.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/461 (79%), Positives = 411/461 (89%)

Query: 1   MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAM 60
           MYAELG L  C +VF  I EPD+VCQTAM+SACAK GDV  ARK+FD+M  +DPIAWNAM
Sbjct: 155 MYAELGGLDACHRVFSSICEPDLVCQTAMVSACAKMGDVGFARKLFDKMSHKDPIAWNAM 214

Query: 61  LAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRL 120
           ++GY QCG+SREAL LF+LMQ   VK+NEVSMVSVLSAC+HLGALDQGRWAH YIERN+L
Sbjct: 215 ISGYVQCGQSREALSLFNLMQREGVKVNEVSMVSVLSACSHLGALDQGRWAHAYIERNKL 274

Query: 121 KMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSL 180
           +MT+TLGTAL+DMY+KCGNMNKAM+ FWGMKE+NVYTW+S IGGLAMNGAGEK LELFSL
Sbjct: 275 RMTLTLGTALIDMYAKCGNMNKAMEVFWGMKEKNVYTWSSAIGGLAMNGAGEKCLELFSL 334

Query: 181 MKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAG 240
           MKQ  V+PNE+TFVSVLRGC VVGLVEEGR+HF+SM + YGIEP LEHYGC+VDLYGRAG
Sbjct: 335 MKQDSVQPNEITFVSVLRGCSVVGLVEEGRKHFESMSKVYGIEPRLEHYGCMVDLYGRAG 394

Query: 241 RLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSN 300
            LDEAL+ IN MP++PH GAWGALLNAC++Y+N EMGELASRK+VELE KNHGAYVLLSN
Sbjct: 395 HLDEALNFINSMPVRPHVGAWGALLNACKIYRNMEMGELASRKIVELEAKNHGAYVLLSN 454

Query: 301 IYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGE 360
           IYA+SK+WDRV NVRQ M  KGV+K PGCSVIEV  EVHEFF GD++HPRY EI+VMLGE
Sbjct: 455 IYADSKDWDRVSNVRQTMNVKGVRKQPGCSVIEVGGEVHEFFVGDKSHPRYAEIQVMLGE 514

Query: 361 ISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRV 420
           ISRRLKL+GYVANTNPV +DIEEEEKED LC HSEK+AIAFGLISL   VPIRIVKNLRV
Sbjct: 515 ISRRLKLSGYVANTNPVFFDIEEEEKEDALCMHSEKIAIAFGLISLSPDVPIRIVKNLRV 574

Query: 421 CWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCKGYW 461
           CWDCHD TKMISK FNREI+VRDRNRFHHF++G+CSCKGYW
Sbjct: 575 CWDCHDATKMISKAFNREIVVRDRNRFHHFRDGECSCKGYW 615




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449435364|ref|XP_004135465.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356524120|ref|XP_003530680.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Glycine max] Back     alignment and taxonomy information
>gi|79329389|ref|NP_001031987.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171830|sp|Q9FND7.1|PP410_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g40405 gi|10178152|dbj|BAB11597.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332007161|gb|AED94544.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297805648|ref|XP_002870708.1| hypothetical protein ARALYDRAFT_493946 [Arabidopsis lyrata subsp. lyrata] gi|297316544|gb|EFH46967.1| hypothetical protein ARALYDRAFT_493946 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|326522230|dbj|BAK04243.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|297597505|ref|NP_001044065.2| Os01g0715700 [Oryza sativa Japonica Group] gi|255673627|dbj|BAF05979.2| Os01g0715700 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|222619165|gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218188961|gb|EEC71388.1| hypothetical protein OsI_03510 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|212721478|ref|NP_001131178.1| uncharacterized protein LOC100192486 [Zea mays] gi|194690792|gb|ACF79480.1| unknown [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
TAIR|locus:1009023396612 AT5G40405 "AT5G40405" [Arabido 1.0 0.753 0.715 4.3e-189
TAIR|locus:2154855620 AT5G66520 "AT5G66520" [Arabido 0.997 0.741 0.462 3.7e-119
TAIR|locus:2144143622 AT5G06540 [Arabidopsis thalian 1.0 0.741 0.476 3e-117
TAIR|locus:2081635573 AT3G62890 [Arabidopsis thalian 1.0 0.804 0.472 4.9e-117
TAIR|locus:2060640738 OTP81 "ORGANELLE TRANSCRIPT PR 1.0 0.624 0.453 1.3e-116
TAIR|locus:2126352632 AT4G37380 [Arabidopsis thalian 1.0 0.729 0.473 5.6e-116
TAIR|locus:2154389646 LPA66 "LOW PSII ACCUMULATION 6 0.954 0.681 0.477 5.2e-113
TAIR|locus:2130354722 AT4G14820 "AT4G14820" [Arabido 0.997 0.637 0.467 1.4e-112
TAIR|locus:2205200741 OTP82 "AT1G08070" [Arabidopsis 0.939 0.584 0.469 2e-111
TAIR|locus:2056794630 REME1 "required for efficiency 0.973 0.712 0.451 2.1e-111
TAIR|locus:1009023396 AT5G40405 "AT5G40405" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1833 (650.3 bits), Expect = 4.3e-189, P = 4.3e-189
 Identities = 330/461 (71%), Positives = 396/461 (85%)

Query:     1 MYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAM 60
             +YAELGCL  C KVF+ I  PD VC+TAM++ACA+CGDV  ARK+F+ MPERDPIAWNAM
Sbjct:   152 LYAELGCLDSCHKVFNSIPCPDFVCRTAMVTACARCGDVVFARKLFEGMPERDPIAWNAM 211

Query:    61 LAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRL 120
             ++GYAQ G+SREAL++FHLMQ+  VK+N V+M+SVLSACT LGALDQGRWAH YIERN++
Sbjct:   212 ISGYAQVGESREALNVFHLMQLEGVKVNGVAMISVLSACTQLGALDQGRWAHSYIERNKI 271

Query:   121 KMTVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSL 180
             K+TV L T LVD+Y+KCG+M KAM+ FWGM+E+NVYTW+S + GLAMNG GEK LELFSL
Sbjct:   272 KITVRLATTLVDLYAKCGDMEKAMEVFWGMEEKNVYTWSSALNGLAMNGFGEKCLELFSL 331

Query:   181 MKQAGVRPNEVTFVSVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAG 240
             MKQ GV PN VTFVSVLRGC VVG V+EG+ HFDSMR E+GIEP LEHYGCLVDLY RAG
Sbjct:   332 MKQDGVTPNAVTFVSVLRGCSVVGFVDEGQRHFDSMRNEFGIEPQLEHYGCLVDLYARAG 391

Query:   241 RLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSN 300
             RL++A+ +I +MPMKPHA  W +LL+A RMYKN E+G LAS+K++ELET NHGAYVLLSN
Sbjct:   392 RLEDAVSIIQQMPMKPHAAVWSSLLHASRMYKNLELGVLASKKMLELETANHGAYVLLSN 451

Query:   301 IYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGE 360
             IYA+S +WD V +VRQ MK+KGV+K PGCSV+EV+ EVHEFF GD++HP+Y +I+ +  +
Sbjct:   452 IYADSNDWDNVSHVRQSMKSKGVRKQPGCSVMEVNGEVHEFFVGDKSHPKYTQIDAVWKD 511

Query:   361 ISRRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRV 420
             ISRRL+LAGY A+T PVM+DI+EEEKED LC HSEK AIAFG++SLKE VPIRIVKNLRV
Sbjct:   512 ISRRLRLAGYKADTTPVMFDIDEEEKEDALCLHSEKAAIAFGIMSLKEDVPIRIVKNLRV 571

Query:   421 CWDCHDVTKMISKVFNREIIVRDRNRFHHFKEGKCSCKGYW 461
             C DCH V+ MISK+FNREIIVRDRNRFHHFK+G CSC G+W
Sbjct:   572 CGDCHQVSMMISKIFNREIIVRDRNRFHHFKDGHCSCNGFW 612


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144143 AT5G06540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081635 AT3G62890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060640 OTP81 "ORGANELLE TRANSCRIPT PROCESSING 81" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126352 AT4G37380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130354 AT4G14820 "AT4G14820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056794 REME1 "required for efficiency of mitochondrial editing 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FND7PP410_ARATHNo assigned EC number0.71581.00.7532yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-139
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-135
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-43
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-40
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-36
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-33
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 3e-25
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-20
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-17
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-15
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.003
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  414 bits (1065), Expect = e-139
 Identities = 185/440 (42%), Positives = 266/440 (60%)

Query: 22  DVVCQTAMISACAKCGDVDLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQ 81
           D     A+I   +KCGD++ AR +FD MPE+  +AWN+MLAGYA  G S EAL L++ M+
Sbjct: 258 DTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMR 317

Query: 82  IHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMN 141
              V +++ +   ++   + L  L+  + AH  + R    + +   TALVD+YSK G M 
Sbjct: 318 DSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRME 377

Query: 142 KAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCC 201
            A + F  M  +N+ +W ++I G   +G G K++E+F  M   GV PN VTF++VL  C 
Sbjct: 378 DARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACR 437

Query: 202 VVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAW 261
             GL E+G E F SM   + I+P   HY C+++L GR G LDEA  +I + P KP    W
Sbjct: 438 YSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMW 497

Query: 262 GALLNACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAK 321
            ALL ACR++KN E+G LA+ KL  +  +    YV+L N+Y  S        V + +K K
Sbjct: 498 AALLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRK 557

Query: 322 GVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGEISRRLKLAGYVANTNPVMYDI 381
           G+   P C+ IEV ++ H FF+GD  HP+  EI   L E+ + +   GYVA  N ++ D+
Sbjct: 558 GLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAEENELLPDV 617

Query: 382 EEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRVCWDCHDVTKMISKVFNREIIV 441
           +E+E++ +   HSEK+AIAFGLI+  E  P++I ++ R+C DCH V K I+ V  REI+V
Sbjct: 618 DEDEEKVSGRYHSEKLAIAFGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVV 677

Query: 442 RDRNRFHHFKEGKCSCKGYW 461
           RD +RFHHFK GKCSC  YW
Sbjct: 678 RDASRFHHFKLGKCSCGDYW 697


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 461
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.91
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.84
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.82
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.82
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.81
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.78
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.76
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.76
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.74
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.74
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.68
KOG2076 895 consensus RNA polymerase III transcription factor 99.66
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.64
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.64
PRK14574 822 hmsH outer membrane protein; Provisional 99.64
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.59
PRK14574 822 hmsH outer membrane protein; Provisional 99.59
KOG1126638 consensus DNA-binding cell division cycle control 99.59
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.58
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.56
KOG2003840 consensus TPR repeat-containing protein [General f 99.56
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.51
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.51
KOG1126638 consensus DNA-binding cell division cycle control 99.5
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.47
KOG0547606 consensus Translocase of outer mitochondrial membr 99.46
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.44
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.44
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.43
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.41
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.4
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.38
KOG1915677 consensus Cell cycle control protein (crooked neck 99.38
PRK12370553 invasion protein regulator; Provisional 99.36
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.36
PF1304150 PPR_2: PPR repeat family 99.35
PF1304150 PPR_2: PPR repeat family 99.34
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.34
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.34
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.33
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.32
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.32
KOG2003840 consensus TPR repeat-containing protein [General f 99.31
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.31
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.28
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.28
PRK12370553 invasion protein regulator; Provisional 99.28
KOG1129478 consensus TPR repeat-containing protein [General f 99.22
KOG2076 895 consensus RNA polymerase III transcription factor 99.21
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.21
KOG1129478 consensus TPR repeat-containing protein [General f 99.2
PRK11189296 lipoprotein NlpI; Provisional 99.18
PRK11189296 lipoprotein NlpI; Provisional 99.17
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.16
KOG1915677 consensus Cell cycle control protein (crooked neck 99.14
KOG0547606 consensus Translocase of outer mitochondrial membr 99.12
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.06
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.03
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.02
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.0
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.99
KOG1125579 consensus TPR repeat-containing protein [General f 98.98
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.97
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.97
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.96
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.95
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.93
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.93
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.92
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.87
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.85
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.83
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.82
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.8
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.79
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.75
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.71
KOG1125579 consensus TPR repeat-containing protein [General f 98.69
PRK04841903 transcriptional regulator MalT; Provisional 98.69
PF1285434 PPR_1: PPR repeat 98.68
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.68
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.66
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.65
PF1285434 PPR_1: PPR repeat 98.62
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.61
PLN02789320 farnesyltranstransferase 98.6
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.58
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.57
PRK10370198 formate-dependent nitrite reductase complex subuni 98.56
PRK04841903 transcriptional regulator MalT; Provisional 98.55
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.52
KOG1128777 consensus Uncharacterized conserved protein, conta 98.51
KOG2376652 consensus Signal recognition particle, subunit Srp 98.5
KOG1128777 consensus Uncharacterized conserved protein, conta 98.49
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.49
PLN02789320 farnesyltranstransferase 98.47
PRK15359144 type III secretion system chaperone protein SscB; 98.47
PRK10370198 formate-dependent nitrite reductase complex subuni 98.46
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.45
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.44
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.41
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.41
PRK15359144 type III secretion system chaperone protein SscB; 98.39
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.36
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.35
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.31
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.31
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.3
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.3
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.3
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.3
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.28
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.26
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.25
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.24
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.24
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.24
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.22
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.2
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.19
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.18
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.13
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.13
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.11
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.09
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.09
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.99
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.99
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.98
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.94
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.91
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.88
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.85
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.84
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.83
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.82
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.78
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.77
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.76
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.74
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.72
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.68
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.68
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.67
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.67
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.67
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.65
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.64
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.64
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.64
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.63
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.62
PF12688120 TPR_5: Tetratrico peptide repeat 97.59
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.59
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.59
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.56
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.56
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.55
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.53
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.52
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.52
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.5
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.5
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.49
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.49
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.48
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.47
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.46
COG4700251 Uncharacterized protein conserved in bacteria cont 97.42
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.4
KOG0553304 consensus TPR repeat-containing protein [General f 97.4
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.39
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.34
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.34
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.31
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.27
KOG0553304 consensus TPR repeat-containing protein [General f 97.27
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.26
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.25
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.23
PF1337173 TPR_9: Tetratricopeptide repeat 97.22
PRK15331165 chaperone protein SicA; Provisional 97.12
COG3898531 Uncharacterized membrane-bound protein [Function u 97.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.05
PF12688120 TPR_5: Tetratrico peptide repeat 97.05
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.03
COG4700251 Uncharacterized protein conserved in bacteria cont 97.01
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.99
KOG20411189 consensus WD40 repeat protein [General function pr 96.93
COG3898531 Uncharacterized membrane-bound protein [Function u 96.91
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.91
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.88
PF1343134 TPR_17: Tetratricopeptide repeat 96.83
PRK10803263 tol-pal system protein YbgF; Provisional 96.83
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.82
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.67
KOG20411189 consensus WD40 repeat protein [General function pr 96.59
PRK10803263 tol-pal system protein YbgF; Provisional 96.52
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.49
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.47
PF1337173 TPR_9: Tetratricopeptide repeat 96.43
PF1342844 TPR_14: Tetratricopeptide repeat 96.43
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.4
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.37
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.32
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.29
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.23
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.21
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.2
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.13
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.06
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.79
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.7
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.65
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.63
PRK15331165 chaperone protein SicA; Provisional 95.62
KOG3941406 consensus Intermediate in Toll signal transduction 95.57
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.53
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.45
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.44
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.39
KOG3941406 consensus Intermediate in Toll signal transduction 95.31
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.28
PF13512142 TPR_18: Tetratricopeptide repeat 95.1
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.06
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.02
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.95
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.81
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.77
PRK09687280 putative lyase; Provisional 94.67
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.61
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.59
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.55
PF13512142 TPR_18: Tetratricopeptide repeat 94.45
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.45
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.42
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.4
smart00299140 CLH Clathrin heavy chain repeat homology. 94.4
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.36
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.18
PRK11906458 transcriptional regulator; Provisional 94.11
KOG1585308 consensus Protein required for fusion of vesicles 94.06
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.99
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 93.97
PRK11906458 transcriptional regulator; Provisional 93.83
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.79
KOG1258577 consensus mRNA processing protein [RNA processing 93.64
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.59
smart00299140 CLH Clathrin heavy chain repeat homology. 93.59
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.58
KOG4555175 consensus TPR repeat-containing protein [Function 93.55
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.22
COG3629280 DnrI DNA-binding transcriptional activator of the 93.12
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.04
COG3629280 DnrI DNA-binding transcriptional activator of the 93.03
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.93
PF1342844 TPR_14: Tetratricopeptide repeat 92.75
KOG4555175 consensus TPR repeat-containing protein [Function 92.75
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.73
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.69
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.65
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.61
KOG2610491 consensus Uncharacterized conserved protein [Funct 92.56
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 92.37
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.25
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.17
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 92.05
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.04
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.01
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.85
KOG1941518 consensus Acetylcholine receptor-associated protei 91.56
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 91.53
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.49
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.3
KOG4570418 consensus Uncharacterized conserved protein [Funct 90.78
PF1343134 TPR_17: Tetratricopeptide repeat 90.72
PRK11619 644 lytic murein transglycosylase; Provisional 90.7
KOG1586288 consensus Protein required for fusion of vesicles 90.63
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.53
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.28
KOG4234271 consensus TPR repeat-containing protein [General f 90.21
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.13
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 89.43
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.31
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.98
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.88
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 87.98
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 87.16
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.97
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.84
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 86.82
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.56
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 86.3
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.12
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 86.01
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.72
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 84.95
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.69
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.51
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 84.47
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.44
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 84.14
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 84.11
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 84.1
PRK09687280 putative lyase; Provisional 83.89
KOG4648 536 consensus Uncharacterized conserved protein, conta 83.75
COG1747 711 Uncharacterized N-terminal domain of the transcrip 83.69
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 83.2
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.08
COG2976207 Uncharacterized protein conserved in bacteria [Fun 83.06
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 83.01
KOG4234271 consensus TPR repeat-containing protein [General f 82.79
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 82.43
KOG1258577 consensus mRNA processing protein [RNA processing 81.94
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 81.53
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 81.52
KOG1586288 consensus Protein required for fusion of vesicles 81.5
KOG4648 536 consensus Uncharacterized conserved protein, conta 81.44
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 81.38
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 81.1
KOG4570418 consensus Uncharacterized conserved protein [Funct 80.69
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 80.25
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=3e-101  Score=791.16  Aligned_cols=460  Identities=41%  Similarity=0.716  Sum_probs=449.1

Q ss_pred             ccccCCchHHHHHHhcCC---------------------------------------CCCHHHHHHHHHHHHHcCCHHHH
Q 012539            2 YAELGCLGYCQKVFDGIH---------------------------------------EPDVVCQTAMISACAKCGDVDLA   42 (461)
Q Consensus         2 y~~~g~~~~A~~~~~~~~---------------------------------------~~~~~~~~~li~~~~~~g~~~~A   42 (461)
                      |++.|++++|.++|++|.                                       .||..+||+||++|+++|++++|
T Consensus       199 ~~~~g~~~~A~~lf~~M~~~g~~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A  278 (697)
T PLN03081        199 LVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIEDA  278 (697)
T ss_pred             HHHCcCHHHHHHHHHHHHHhCCCCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHhCCCccceeHHHHHHHHHHCCCHHHH
Confidence            677888888888887652                                       35666778999999999999999


Q ss_pred             HHHHhhCCCCChhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCcCHHHHHHHHHHHhccCCHHHHHHHHHHHHHcCCCC
Q 012539           43 RKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRLKM  122 (461)
Q Consensus        43 ~~~~~~m~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~  122 (461)
                      .++|++|+++|+++||+||.+|++.|++++|+++|++|.+.|+.||..||++++.+|++.|++++|.+++..|.+.|++|
T Consensus       279 ~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~  358 (697)
T PLN03081        279 RCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPL  358 (697)
T ss_pred             HHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHHHHHHhcCCHHHHHHHHHhcCCCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhh
Q 012539          123 TVTLGTALVDMYSKCGNMNKAMDFFWGMKERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCV  202 (461)
Q Consensus       123 ~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~  202 (461)
                      +..++++|+++|+++|++++|.++|++|.++|+.+||+||.+|+++|+.++|+++|++|.+.|+.||..||+.++.+|++
T Consensus       359 d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~  438 (697)
T PLN03081        359 DIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRY  438 (697)
T ss_pred             CeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcHHHHHHHHHHhhhhcCCccChhHHHHHHHHHHhcCCHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCChHHHHHHHH
Q 012539          203 VGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYKNTEMGELASR  282 (461)
Q Consensus       203 ~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~  282 (461)
                      .|.+++|.++|+.|.+++|+.|+..+|++|+++|++.|++++|.+++++|+..|+..+|++|+.+|..+|+++.|..+++
T Consensus       439 ~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~~~a~~~~~  518 (697)
T PLN03081        439 SGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNLELGRLAAE  518 (697)
T ss_pred             CCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCcHHHHHHHH
Confidence            99999999999999887899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhccCCCcchHHHHHHHHhhcCChhHHHHHHHHHHhCCCccCCcccEEEeCCEEEEEEeCCCCCCChHHHHHHHHHHH
Q 012539          283 KLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKGVKKLPGCSVIEVDREVHEFFAGDETHPRYNEIEVMLGEIS  362 (461)
Q Consensus       283 ~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~s~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  362 (461)
                      ++.++.|++..+|..|+++|++.|+|++|.+++++|++.|+++.|++||+++++.+|.|++||..||+..+++..+.++.
T Consensus       519 ~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~~~~~f~~~d~~h~~~~~i~~~l~~l~  598 (697)
T PLN03081        519 KLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLDELM  598 (697)
T ss_pred             HHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCccCCCeeEEEECCeEEEEccCCCCCccHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCcccCCCccccccchhhhhhhhhhhhHHHHHHHhhcCCCCCCcEEEecccccCcchhhHhHHhhhhcCceEEEe
Q 012539          363 RRLKLAGYVANTNPVMYDIEEEEKEDTLCKHSEKVAIAFGLISLKEGVPIRIVKNLRVCWDCHDVTKMISKVFNREIIVR  442 (461)
Q Consensus       363 ~~m~~~g~~pd~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~  442 (461)
                      .+|++.||.||+.++++++++++++..++.|||+||++|||+++++++||||+||||+|+|||+|+|+||++.+|+||||
T Consensus       599 ~~~~~~gy~~~~~~~~~~~~~~~~~~~~~~hsekla~a~~l~~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~~r  678 (697)
T PLN03081        599 KEISEYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIAFGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVVR  678 (697)
T ss_pred             HHHHHcCCCCCcchhhccccHHHHHHHHHhccHHHHHHhhCccCCCCCeEEEecCCEECCCchhhHHHHhhhcceEEEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCcccccccCccCCCCCC
Q 012539          443 DRNRFHHFKEGKCSCKGYW  461 (461)
Q Consensus       443 ~~~~~h~~~~g~~s~~~~w  461 (461)
                      |.+|||||+||+|||+|||
T Consensus       679 d~~rfh~f~~g~csc~d~w  697 (697)
T PLN03081        679 DASRFHHFKLGKCSCGDYW  697 (697)
T ss_pred             cCCccccCCCCcccccccC
Confidence            9999999999999999999



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 65.2 bits (157), Expect = 2e-11
 Identities = 36/293 (12%), Positives = 84/293 (28%), Gaps = 15/293 (5%)

Query: 40  DLARKMFDEMPERDPIAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVSMVSVLSAC 99
            L  K+       +  A    L    +    + A  L    +       E  +  +L   
Sbjct: 43  RLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEA 102

Query: 100 THLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMKER------ 153
               +LD  +       + +L        A          +  A         +      
Sbjct: 103 PGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKL 162

Query: 154 -NVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGREH 212
             +  + +V+ G A  GA ++ + +  ++K AG+ P+ +++ + L+            E 
Sbjct: 163 LTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIER 222

Query: 213 FDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKMPMKPHAGAWGALLNACRMYK 272
                 + G++        L+    RA  L     V     + P             +  
Sbjct: 223 CLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQL--------PPPVNT 274

Query: 273 NTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKGVKK 325
           +  + ++ ++       K H     L  ++ +  + +    V  +   K    
Sbjct: 275 SKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSVEKPTLP 327


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.98
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.85
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.83
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.82
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.81
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.77
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.75
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.73
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.72
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.71
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.69
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.68
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.66
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.64
3u4t_A272 TPR repeat-containing protein; structural genomics 99.63
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.63
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.62
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.61
3u4t_A272 TPR repeat-containing protein; structural genomics 99.61
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.61
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.6
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.59
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.59
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.59
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.59
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.59
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.58
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.58
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.57
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.57
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.56
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.56
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.55
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.54
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.54
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.53
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.51
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.5
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.48
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.47
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.46
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.46
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.46
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.46
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.45
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.44
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.44
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.4
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.38
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.37
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.33
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.31
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.29
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.24
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.24
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.23
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.19
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.19
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.13
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.1
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.1
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.06
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.06
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.02
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.01
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.98
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.96
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.96
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.94
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.94
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.93
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.9
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.9
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.9
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.9
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.88
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.88
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.84
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.84
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.83
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.83
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.82
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.8
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.8
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.78
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.76
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.76
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.75
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.75
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.73
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.71
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.69
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.68
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.63
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.63
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.62
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.61
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.6
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.59
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.59
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.57
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.54
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.54
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.53
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.52
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.51
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.51
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.5
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.49
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.48
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.47
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.47
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.46
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.46
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.46
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.46
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.45
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.42
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.42
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.42
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.4
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.38
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.37
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.32
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.32
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.31
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.31
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.29
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.29
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.29
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.28
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.28
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.27
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.26
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.24
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.23
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.23
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.19
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.19
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.17
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.17
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.17
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.15
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.11
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.11
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.1
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.07
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.03
3k9i_A117 BH0479 protein; putative protein binding protein, 98.03
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.0
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.94
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.94
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.94
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.92
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.92
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.85
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.84
3k9i_A117 BH0479 protein; putative protein binding protein, 97.83
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.78
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.73
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.71
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.68
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.67
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.63
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.5
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.45
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.44
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.39
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.39
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.36
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.33
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.29
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.29
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.26
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.99
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.99
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.96
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.92
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.88
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.83
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.81
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.8
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.63
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.62
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.55
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.54
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.45
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.86
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.85
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.54
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.28
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.96
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 94.43
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.41
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.06
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.68
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.52
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.96
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.86
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.83
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.72
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.63
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 91.41
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 90.54
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.28
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 89.93
2p58_C116 Putative type III secretion protein YSCG; type III 89.65
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 89.4
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 89.36
2uwj_G115 Type III export protein PSCG; virulence, chaperone 89.28
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.08
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.03
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 88.91
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 88.69
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 88.5
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.15
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 88.08
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 88.05
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 87.91
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.83
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 86.57
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 86.24
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 86.19
2p58_C116 Putative type III secretion protein YSCG; type III 86.13
2uwj_G115 Type III export protein PSCG; virulence, chaperone 85.59
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 85.09
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 84.27
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 83.83
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 81.99
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 81.13
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 81.13
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.5
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=4.4e-30  Score=260.56  Aligned_cols=318  Identities=12%  Similarity=0.025  Sum_probs=258.9

Q ss_pred             ccccCCchHHHHHHhcC--CCCCHHHHHHHHHHHHHcCCHHHHHHHHhhCC-CC------------------ChhHHHHH
Q 012539            2 YAELGCLGYCQKVFDGI--HEPDVVCQTAMISACAKCGDVDLARKMFDEMP-ER------------------DPIAWNAM   60 (461)
Q Consensus         2 y~~~g~~~~A~~~~~~~--~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~-~~------------------~~~~~~~l   60 (461)
                      |.+.|++++|..+|+.+  ..+++.+++.++.+|.+.|++++|.++|+++. ..                  ++.+|+.+
T Consensus       127 ~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  206 (597)
T 2xpi_A          127 YCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLR  206 (597)
T ss_dssp             HHHTTCHHHHHHHHHHTCGGGTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHH
T ss_pred             HHHcCcHHHHHHHHHHHhccccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHH
Confidence            55677788888888777  35677788888888888888888888887433 22                  36778888


Q ss_pred             HHHHHHcCChHHHHHHHHHHHHCCC-------------------------------------------------------
Q 012539           61 LAGYAQCGKSREALHLFHLMQIHDV-------------------------------------------------------   85 (461)
Q Consensus        61 i~~~~~~g~~~~A~~~~~~m~~~~~-------------------------------------------------------   85 (461)
                      +.+|.+.|++++|+++|++|.+.+.                                                       
T Consensus       207 ~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g  286 (597)
T 2xpi_A          207 GQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHED  286 (597)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcc
Confidence            8888888888888888877754321                                                       


Q ss_pred             ---------------CcCHHHHHHHHHHHhccCCHHHHHHHHHHHHHcCC------------------------------
Q 012539           86 ---------------KLNEVSMVSVLSACTHLGALDQGRWAHVYIERNRL------------------------------  120 (461)
Q Consensus        86 ---------------~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~------------------------------  120 (461)
                                     +++..++..++.++.+.|++++|..+++++.+.+.                              
T Consensus       287 ~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~  366 (597)
T 2xpi_A          287 ELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLV  366 (597)
T ss_dssp             HHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCCTTHHHHHHHHHHHTCHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcccHHHHHHHHHHHHHhCCHHHHHHHHHHHH
Confidence                           15666777777777777888888777777765432                              


Q ss_pred             ---CCchHHHHHHHHHHHhcCCHHHHHHHHHhcC---CCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHH
Q 012539          121 ---KMTVTLGTALVDMYSKCGNMNKAMDFFWGMK---ERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFV  194 (461)
Q Consensus       121 ---~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~  194 (461)
                         +.+..+++.++.+|.+.|++++|.++|+++.   ..+..+|+.++.+|.+.|++++|+++|+++.+.+ +.+..++.
T Consensus       367 ~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~  445 (597)
T 2xpi_A          367 DRHPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYL  445 (597)
T ss_dssp             HHCTTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHH
T ss_pred             hhCcccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHH
Confidence               3456788888899999999999999999875   3467899999999999999999999999998753 44788899


Q ss_pred             HHHHHHhhcCcHHHHHHHHHHhhhhcCCccChhHHHHHHHHHHhcCCHHHHHHHHHhC-------CCCCC--HHHHHHHH
Q 012539          195 SVLRGCCVVGLVEEGREHFDSMRREYGIEPWLEHYGCLVDLYGRAGRLDEALDVINKM-------PMKPH--AGAWGALL  265 (461)
Q Consensus       195 ~ll~~~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~-------~~~p~--~~~~~~ll  265 (461)
                      .++.+|.+.|++++|.++|+.+.+.  .+.++.+|..++..|.+.|++++|.++|+++       +..|+  ..+|..+.
T Consensus       446 ~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~  523 (597)
T 2xpi_A          446 FLGMQHMQLGNILLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLG  523 (597)
T ss_dssp             HHHHHHHHHTCHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHH
Confidence            9999999999999999999998753  2346788999999999999999999999887       44677  67999999


Q ss_pred             HHHHhcCChHHHHHHHHHHhhccCCCcchHHHHHHHHhhcCChhHHHHHHHHHHhCC
Q 012539          266 NACRMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKAKG  322 (461)
Q Consensus       266 ~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~g  322 (461)
                      .+|...|++++|...++++.+.+|+++.+|..++.+|.+.|++++|.+.++++.+..
T Consensus       524 ~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~  580 (597)
T 2xpi_A          524 HAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAIS  580 (597)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC
T ss_pred             HHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999999999999987743



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 461
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.5 bits (101), Expect = 4e-05
 Identities = 41/290 (14%), Positives = 80/290 (27%), Gaps = 9/290 (3%)

Query: 35  KCGDVDLARKMFDEMPERDP---IAWNAMLAGYAQCGKSREALHLFHLMQIHDVKLNEVS 91
           + GD + A +   ++  ++P        + + + QC +   + H                
Sbjct: 11  QAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFST--LAIKQNPLLAE 68

Query: 92  MVSVLSACTHLGALDQGRWAHVYIERNRLKMTVTLGTALVDMYSKCGNMNKAMDFFWGMK 151
             S L          Q    H           +     L       G+M  A+  +    
Sbjct: 69  AYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSAL 128

Query: 152 ERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLRGCCVVGLVEEGRE 211
           + N   +        +  A  +  E  +   +A              GC       E   
Sbjct: 129 QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQ-GEIWL 187

Query: 212 HFDSMRREYGIEP-WLEHYGCLVDLYGRAGRLDEALDVINKMP--MKPHAGAWGALLNAC 268
                 +   ++P +L+ Y  L ++   A   D A+    +       HA   G L    
Sbjct: 188 AIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVY 247

Query: 269 RMYKNTEMGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIM 318
                 ++     R+ +EL+     AY  L+N   E  +     +     
Sbjct: 248 YEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTA 297


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.85
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.63
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.27
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.2
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.2
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.19
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.16
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.16
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.13
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.07
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.04
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.99
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.75
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.46
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.43
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.35
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.31
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.3
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.29
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.24
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.21
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.2
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.14
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.11
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.11
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.04
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.0
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.95
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.9
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.87
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.84
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.82
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.82
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.79
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.67
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.53
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.52
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.41
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.26
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.24
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.23
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.13
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.84
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.93
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.15
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.06
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.59
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.18
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.46
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.32
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.81
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 84.83
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=3.6e-20  Score=173.96  Aligned_cols=313  Identities=13%  Similarity=0.097  Sum_probs=255.8

Q ss_pred             ccccCCchHHHHHHhcCC--CC-CHHHHHHHHHHHHHcCCHHHHHHHHhhCCC---CChhHHHHHHHHHHHcCChHHHHH
Q 012539            2 YAELGCLGYCQKVFDGIH--EP-DVVCQTAMISACAKCGDVDLARKMFDEMPE---RDPIAWNAMLAGYAQCGKSREALH   75 (461)
Q Consensus         2 y~~~g~~~~A~~~~~~~~--~~-~~~~~~~li~~~~~~g~~~~A~~~~~~m~~---~~~~~~~~li~~~~~~g~~~~A~~   75 (461)
                      +.+.|++++|++.|+++.  .| ++.++..+..+|.+.|++++|...|++..+   .++.+|..+...|.+.|++++|+.
T Consensus         9 ~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~   88 (388)
T d1w3ba_           9 EYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIE   88 (388)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHH
T ss_pred             HHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccccc
Confidence            456899999999999875  34 678899999999999999999999998753   357799999999999999999999


Q ss_pred             HHHHHHHCCCCcCHHHHHHH----------------------------------HHHHhccCCHHHHHHHHHHHHHcCCC
Q 012539           76 LFHLMQIHDVKLNEVSMVSV----------------------------------LSACTHLGALDQGRWAHVYIERNRLK  121 (461)
Q Consensus        76 ~~~~m~~~~~~p~~~t~~~l----------------------------------l~~~~~~~~~~~a~~~~~~~~~~~~~  121 (461)
                      .+......... +.......                                  .......+....+...+....... +
T Consensus        89 ~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~  166 (388)
T d1w3ba_          89 HYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-P  166 (388)
T ss_dssp             HHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-T
T ss_pred             ccccccccccc-cccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccC-c
Confidence            99998775422 22222121                                  222233334444455555555443 4


Q ss_pred             CchHHHHHHHHHHHhcCCHHHHHHHHHhcC---CCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHHHHHH
Q 012539          122 MTVTLGTALVDMYSKCGNMNKAMDFFWGMK---ERNVYTWTSVIGGLAMNGAGEKSLELFSLMKQAGVRPNEVTFVSVLR  198 (461)
Q Consensus       122 ~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~  198 (461)
                      .+...+..+...+...|++++|...++...   ..+..+|..+...+...|++++|+..+++..... +.+...+..+..
T Consensus       167 ~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~  245 (388)
T d1w3ba_         167 NFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLAC  245 (388)
T ss_dssp             TCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHH
T ss_pred             chhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHH
Confidence            456677788999999999999999998765   3467889999999999999999999999998763 445677888888


Q ss_pred             HHhhcCcHHHHHHHHHHhhhhcCCcc-ChhHHHHHHHHHHhcCCHHHHHHHHHhC--CCCCCHHHHHHHHHHHHhcCChH
Q 012539          199 GCCVVGLVEEGREHFDSMRREYGIEP-WLEHYGCLVDLYGRAGRLDEALDVINKM--PMKPHAGAWGALLNACRMYKNTE  275 (461)
Q Consensus       199 ~~~~~g~~~~a~~~~~~~~~~~~~~p-~~~~~~~li~~~~~~g~~~~A~~~~~~~--~~~p~~~~~~~ll~~~~~~~~~~  275 (461)
                      .+...|++++|...|+++.+   +.| ++..+..+...|...|++++|.+.++..  ....+...+..+...+...|+++
T Consensus       246 ~~~~~~~~~~A~~~~~~al~---~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  322 (388)
T d1w3ba_         246 VYYEQGLIDLAIDTYRRAIE---LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIE  322 (388)
T ss_dssp             HHHHTTCHHHHHHHHHHHHH---TCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHH
T ss_pred             HHHHCCCHHHHHHHHHHHHH---hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHH
Confidence            99999999999999999875   344 4778999999999999999999999887  22346678888888999999999


Q ss_pred             HHHHHHHHHhhccCCCcchHHHHHHHHhhcCChhHHHHHHHHHHh
Q 012539          276 MGELASRKLVELETKNHGAYVLLSNIYAESKNWDRVINVRQIMKA  320 (461)
Q Consensus       276 ~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~  320 (461)
                      +|...++++.+..|+++.++..++.+|.+.|++++|.+.+++..+
T Consensus       323 ~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         323 EAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             HHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999998765



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure