Citrus Sinensis ID: 012622
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 460 | 2.2.26 [Sep-21-2011] | |||||||
| Q8GY79 | 393 | Double-stranded RNA-bindi | yes | no | 0.7 | 0.819 | 0.504 | 2e-91 | |
| Q9LJF5 | 359 | Double-stranded RNA-bindi | no | no | 0.404 | 0.518 | 0.791 | 3e-87 | |
| Q0DKP4 | 593 | Double-stranded RNA-bindi | yes | no | 0.445 | 0.345 | 0.687 | 1e-81 | |
| Q9SKN2 | 434 | Double-stranded RNA-bindi | no | no | 0.413 | 0.437 | 0.726 | 8e-79 | |
| B7E321 | 404 | Double-stranded RNA-bindi | no | no | 0.336 | 0.383 | 0.832 | 8e-74 | |
| Q9AV50 | 514 | Double-stranded RNA-bindi | no | no | 0.410 | 0.367 | 0.698 | 1e-68 | |
| Q8H1D4 | 355 | Double-stranded RNA-bindi | no | no | 0.317 | 0.411 | 0.474 | 2e-30 | |
| Q5N8Z0 | 441 | Double-stranded RNA-bindi | no | no | 0.317 | 0.331 | 0.496 | 2e-29 | |
| Q0IV63 | 473 | Double-stranded RNA-bindi | no | no | 0.330 | 0.321 | 0.389 | 1e-21 | |
| Q0IQN6 | 424 | Double-stranded RNA-bindi | no | no | 0.330 | 0.358 | 0.389 | 1e-21 |
| >sp|Q8GY79|DRB5_ARATH Double-stranded RNA-binding protein 5 OS=Arabidopsis thaliana GN=DRB5 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 337 bits (863), Expect = 2e-91, Method: Compositional matrix adjust.
Identities = 208/412 (50%), Positives = 250/412 (60%), Gaps = 90/412 (21%)
Query: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPSYCTTLRQAEHAA 60
MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESP+YC+TLRQAEHAA
Sbjct: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAA 60
Query: 61 AEVALNVLSTRGPSRSLTARVLDETGIYKNLLQETAHRAGLNLPVYTTVRSGPGHVPIFT 120
AEV+LNVLS+R PS+SLTA++LDETGIYKNLLQETAHRAGL+LP+YT+VRSG H P F+
Sbjct: 61 AEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFS 120
Query: 121 CTVELAGMNFTGEPAKTKKQAEKNAAIAAWSALKRMPNLDSLTNKETDKPEEQDQAIVAR 180
CTVELAGM FTGE AKTKKQAEKNAAIAAWS+LK+M +LDS + EE++Q VAR
Sbjct: 121 CTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDS-------QDEEKEQEAVAR 173
Query: 181 VLSNFRAKDDNRNNNARRRDQS-QARRRVVCRSHRDNCSAASSTSGNSSQYQQHWRLLDM 239
VLS F+ K+ RRR+ + Q RRR S N + R +++
Sbjct: 174 VLSRFKPKE------VRRRETTNQWRRRT------------SQQDSNKDLLIERLRWINL 215
Query: 240 LMDSA-----LAVPTQ-KQSSYVSLVPPPPPRSTSKILPPITSLCPANIPIPALAKLDEH 293
L + A + P Q K SS++SL+PPPPP +SKILP I +
Sbjct: 216 LTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFI-----------------QQ 258
Query: 294 HHQGDHEEDWLFGKQDAIIKKPFEKEDSSSIIVHGTKSSIQKPFPQLDTSMLKTSLFDST 353
+ +E + I K E S T+ S Q PF
Sbjct: 259 YKDRSSQEAKTETATEMINSKAKVNETS-------TRLSKQMPF---------------- 295
Query: 354 SQVGSSRFLGSLNPNPITPTSIRAKSMYTGGFNPQRIAPAVQIRSVIPVCAA 405
S + F+G + NP + +APAVQ+RSVIPV AA
Sbjct: 296 SDMNRYNFVGGCSVNPYS------------------LAPAVQMRSVIPVFAA 329
|
Binds double-stranded RNA. May be involved in RNA-mediated silencing. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9LJF5|DRB3_ARATH Double-stranded RNA-binding protein 3 OS=Arabidopsis thaliana GN=DRB3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0DKP4|DRB2_ORYSJ Double-stranded RNA-binding protein 2 OS=Oryza sativa subsp. japonica GN=DRB2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SKN2|DRB2_ARATH Double-stranded RNA-binding protein 2 OS=Arabidopsis thaliana GN=DRB2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|B7E321|DRB5_ORYSJ Double-stranded RNA-binding protein 5 OS=Oryza sativa subsp. japonica GN=DRB5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9AV50|DRB6_ORYSJ Double-stranded RNA-binding protein 6 OS=Oryza sativa subsp. japonica GN=DRB6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8H1D4|DRB4_ARATH Double-stranded RNA-binding protein 4 OS=Arabidopsis thaliana GN=DBR4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5N8Z0|DRB1_ORYSJ Double-stranded RNA-binding protein 1 OS=Oryza sativa subsp. japonica GN=DRB1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0IV63|DRB7_ORYSJ Double-stranded RNA-binding protein 7 OS=Oryza sativa subsp. japonica GN=DRB7 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0IQN6|DRB8_ORYSJ Double-stranded RNA-binding protein 8 OS=Oryza sativa subsp. japonica GN=DRB8 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 460 | ||||||
| 296082307 | 481 | unnamed protein product [Vitis vinifera] | 0.960 | 0.918 | 0.593 | 1e-135 | |
| 359488565 | 484 | PREDICTED: double-stranded RNA-binding p | 0.960 | 0.913 | 0.593 | 1e-135 | |
| 147820257 | 552 | hypothetical protein VITISV_038619 [Viti | 0.960 | 0.800 | 0.593 | 1e-135 | |
| 255543655 | 477 | double-stranded RNA binding protein, put | 0.956 | 0.922 | 0.603 | 1e-123 | |
| 224055781 | 357 | predicted protein [Populus trichocarpa] | 0.736 | 0.949 | 0.583 | 1e-112 | |
| 30693732 | 393 | dsRNA-binding protein 5 [Arabidopsis tha | 0.7 | 0.819 | 0.504 | 1e-89 | |
| 297805542 | 394 | dsRNA-binding protein 5 [Arabidopsis lyr | 0.7 | 0.817 | 0.504 | 2e-89 | |
| 297818244 | 356 | dsRNA-binding protein 3 [Arabidopsis lyr | 0.428 | 0.553 | 0.751 | 4e-88 | |
| 79420704 | 359 | dsRNA-binding protein 3 [Arabidopsis tha | 0.404 | 0.518 | 0.791 | 2e-85 | |
| 9759153 | 384 | unnamed protein product [Arabidopsis tha | 0.680 | 0.815 | 0.490 | 5e-85 |
| >gi|296082307|emb|CBI21312.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 488 bits (1257), Expect = e-135, Method: Compositional matrix adjust.
Identities = 296/499 (59%), Positives = 354/499 (70%), Gaps = 57/499 (11%)
Query: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPSYCTTLRQAEHAA 60
M+KNQLQELAQRSCFNLPSY CIREGPDHAPRFKASVNFNGEIFESPSYCTTLRQAEHAA
Sbjct: 1 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEIFESPSYCTTLRQAEHAA 60
Query: 61 AEVALNVLSTRGPSRSLTARVLDETGIYKNLLQETAHRAGLNLPVYTTVRSGPGHVPIFT 120
AEVALNVLSTRGPSRSLTARVLDETG+YKNLLQETAHRAGLNLPVYTTVRSGPGHVP+FT
Sbjct: 61 AEVALNVLSTRGPSRSLTARVLDETGVYKNLLQETAHRAGLNLPVYTTVRSGPGHVPVFT 120
Query: 121 CTVELAGMNFTGEPAKTKKQAEKNAAIAAWSALKRMPNLDSLTNKETDKPEEQDQAIVAR 180
CTVELAGMNFTGE AKTKKQAEKNAAIAAWSALKR+PNL SL++ + ++Q +VAR
Sbjct: 121 CTVELAGMNFTGESAKTKKQAEKNAAIAAWSALKRVPNLGSLSHLSKEAESREEQVVVAR 180
Query: 181 VLSNFRAKDDNRNNNARRRDQSQARRRVVCRSHRDNCSAASSTSGNSSQYQQHWRLLDML 240
VLSNFR+KD++R RR DQ+QARRR+V R + + SS++ N+SQ Q WR +D+L
Sbjct: 181 VLSNFRSKDESR--PIRRWDQNQARRRMV----RGHGGSGSSSTSNNSQQFQKWRPMDLL 234
Query: 241 MDSALAVPT-QKQSSYVSLVPPPPPRSTSKILPPIT-----SLCPANIPIPALA------ 288
MDS T Q Q+ +V+L+PPPPPR+ SKILPPI+ SL P+ PIP A
Sbjct: 235 MDSVPEGGTAQNQNCFVALLPPPPPRTASKILPPISPRDTLSLYPSTRPIPVQAIGRSQV 294
Query: 289 KLDE-----HHHQGDHEEDWLFGKQDAIIKKPFEKE---DSSSIIVHGTKSSIQKPFPQL 340
K+ E HQ D EE+WL GK + +I+KP EKE ++++ V+G +SI +PFP
Sbjct: 295 KMPEVPTLLEEHQRD-EEEWLDGKSN-LIRKPTEKECPSNANASSVYGA-NSIYRPFPLP 351
Query: 341 DTSMLKTSLFDSTSQVGSSRFLGSLNP--NPITPTSIRA-------KSMYTGGFNPQRIA 391
+ L TSL DS Q + + NP NP TP++++ ++M TGGF P RIA
Sbjct: 352 NAGKLNTSLPDSPHQPHEQTHIKN-NPFGNP-TPSAMKGSAGIHIPRTMGTGGFQPHRIA 409
Query: 392 PAVQIRSVIPVCAAPPSPPITTPSSSSSSSNPPSTKEAAEVSAA--------SGSKL-LN 442
PAVQIRSVIPVCAA P SN P+ EA+ + + +G+ L N
Sbjct: 410 PAVQIRSVIPVCAA------PPPPMRLPPSNHPTRNEASPSALSASSSIPAHTGAGLKFN 463
Query: 443 NPS-STQQLNPEFNKKLQL 460
P + QL+ EFN KLQL
Sbjct: 464 KPELYSTQLSSEFN-KLQL 481
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359488565|ref|XP_002275052.2| PREDICTED: double-stranded RNA-binding protein 5 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147820257|emb|CAN71476.1| hypothetical protein VITISV_038619 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255543655|ref|XP_002512890.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223547901|gb|EEF49393.1| double-stranded RNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224055781|ref|XP_002298650.1| predicted protein [Populus trichocarpa] gi|222845908|gb|EEE83455.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|30693732|ref|NP_198923.2| dsRNA-binding protein 5 [Arabidopsis thaliana] gi|75244423|sp|Q8GY79.1|DRB5_ARATH RecName: Full=Double-stranded RNA-binding protein 5; AltName: Full=dsRNA-binding protein 5; Short=AtDRB5 gi|26450682|dbj|BAC42450.1| unknown protein [Arabidopsis thaliana] gi|32189297|gb|AAP75803.1| At5g41070 [Arabidopsis thaliana] gi|332007250|gb|AED94633.1| dsRNA-binding protein 5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297805542|ref|XP_002870655.1| dsRNA-binding protein 5 [Arabidopsis lyrata subsp. lyrata] gi|297316491|gb|EFH46914.1| dsRNA-binding protein 5 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297818244|ref|XP_002877005.1| dsRNA-binding protein 3 [Arabidopsis lyrata subsp. lyrata] gi|297322843|gb|EFH53264.1| dsRNA-binding protein 3 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|79420704|ref|NP_189329.3| dsRNA-binding protein 3 [Arabidopsis thaliana] gi|145322916|ref|NP_001030779.2| dsRNA-binding protein 3 [Arabidopsis thaliana] gi|75273549|sp|Q9LJF5.1|DRB3_ARATH RecName: Full=Double-stranded RNA-binding protein 3; AltName: Full=dsRNA-binding protein 3; Short=AtDRB3 gi|11994159|dbj|BAB01188.1| unnamed protein product [Arabidopsis thaliana] gi|45773934|gb|AAS76771.1| At3g26932 [Arabidopsis thaliana] gi|62321583|dbj|BAD95129.1| putative protein [Arabidopsis thaliana] gi|332643724|gb|AEE77245.1| dsRNA-binding protein 3 [Arabidopsis thaliana] gi|332643725|gb|AEE77246.1| dsRNA-binding protein 3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9759153|dbj|BAB09709.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 460 | ||||||
| TAIR|locus:2829928 | 359 | DRB3 "dsRNA-binding protein 3" | 0.389 | 0.498 | 0.805 | 4e-83 | |
| TAIR|locus:2163016 | 393 | DRB5 "dsRNA-binding protein 5" | 0.386 | 0.452 | 0.805 | 1.9e-81 | |
| TAIR|locus:2057491 | 434 | DRB2 "dsRNA-binding protein 2" | 0.402 | 0.426 | 0.735 | 2.3e-74 | |
| TAIR|locus:2081620 | 355 | DRB4 "double-stranded-RNA-bind | 0.376 | 0.487 | 0.429 | 4.9e-30 | |
| UNIPROTKB|Q0IQN6 | 424 | DRB8 "Double-stranded RNA-bind | 0.328 | 0.356 | 0.393 | 5e-22 | |
| TAIR|locus:2024407 | 419 | HYL1 "HYPONASTIC LEAVES 1" [Ar | 0.358 | 0.393 | 0.355 | 8.3e-19 | |
| ZFIN|ZDB-GENE-050309-206 | 289 | prkra "protein kinase, interfe | 0.306 | 0.487 | 0.316 | 1.4e-05 | |
| UNIPROTKB|F1MH34 | 699 | F1MH34 "Uncharacterized protei | 0.302 | 0.198 | 0.318 | 1.5e-05 | |
| UNIPROTKB|Q2HJ92 | 313 | PRKRA "Interferon-inducible do | 0.315 | 0.463 | 0.333 | 1.7e-05 | |
| UNIPROTKB|J9P4M2 | 313 | PRKRA "Uncharacterized protein | 0.315 | 0.463 | 0.333 | 1.7e-05 |
| TAIR|locus:2829928 DRB3 "dsRNA-binding protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 774 (277.5 bits), Expect = 4.0e-83, Sum P(2) = 4.0e-83
Identities = 149/185 (80%), Positives = 168/185 (90%)
Query: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPSYCTTLRQAEHAA 60
MYKNQLQELAQRSCF+LPSYTC REGPDHAPRFKASVNFNGEIFESP+YC+TLRQAEH+A
Sbjct: 1 MYKNQLQELAQRSCFSLPSYTCTREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHSA 60
Query: 61 AEVALNVLSTRGPSRSLTARVLDETGIYKNLLQETAHRAGLNLPVYTTVRSGPGHVPIFT 120
AEVAL+ LS++GPS+SLTARVLDETGIYKNLLQETAHRAGL+LPVYT+VRSGPGH+P F+
Sbjct: 61 AEVALSALSSKGPSKSLTARVLDETGIYKNLLQETAHRAGLDLPVYTSVRSGPGHIPTFS 120
Query: 121 CTVELAGMNFTGEPAKTKKQAEKNAAIAAWSALKRMPNLDSLTNKETDKPEEQDQAIVAR 180
CTVELAGM+F GE AKTKKQAEKNAAIAAW +L++MP LD L + EE++Q IVAR
Sbjct: 121 CTVELAGMSFNGESAKTKKQAEKNAAIAAWFSLRKMPRLDPL------RGEEKEQEIVAR 174
Query: 181 VLSNF 185
VLS F
Sbjct: 175 VLSRF 179
|
|
| TAIR|locus:2163016 DRB5 "dsRNA-binding protein 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057491 DRB2 "dsRNA-binding protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081620 DRB4 "double-stranded-RNA-binding protein 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0IQN6 DRB8 "Double-stranded RNA-binding protein 8" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024407 HYL1 "HYPONASTIC LEAVES 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050309-206 prkra "protein kinase, interferon-inducible double stranded RNA dependent activator" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MH34 F1MH34 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2HJ92 PRKRA "Interferon-inducible double stranded RNA-dependent protein kinase activator A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P4M2 PRKRA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8GY79 | DRB5_ARATH | No assigned EC number | 0.5048 | 0.7 | 0.8193 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.26 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | gw1.I.3229.1 | hypothetical protein (357 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 460 | |||
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 3e-18 | |
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 8e-18 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 2e-16 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 7e-16 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 3e-14 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 2e-13 | |
| PRK00102 | 229 | PRK00102, rnc, ribonuclease III; Reviewed | 2e-13 | |
| TIGR02191 | 220 | TIGR02191, RNaseIII, ribonuclease III, bacterial | 1e-12 | |
| TIGR02191 | 220 | TIGR02191, RNaseIII, ribonuclease III, bacterial | 8e-12 | |
| PRK00102 | 229 | PRK00102, rnc, ribonuclease III; Reviewed | 9e-11 | |
| COG0571 | 235 | COG0571, Rnc, dsRNA-specific ribonuclease [Transcr | 2e-09 | |
| COG0571 | 235 | COG0571, Rnc, dsRNA-specific ribonuclease [Transcr | 2e-08 | |
| PRK12371 | 235 | PRK12371, PRK12371, ribonuclease III; Reviewed | 3e-07 | |
| PHA03103 | 183 | PHA03103, PHA03103, double-strand RNA-binding prot | 3e-05 | |
| TIGR04238 | 201 | TIGR04238, seadorna_dsRNA, seadornavirus double-st | 3e-05 | |
| PRK12371 | 235 | PRK12371, PRK12371, ribonuclease III; Reviewed | 1e-04 |
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
Score = 78.1 bits (193), Expect = 3e-18
Identities = 28/67 (41%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
Query: 88 YKNLLQETAHRAGLNLPVYTTV-RSGPGHVPIFTCTVELAGMNFTGEPAKTKKQAEKNAA 146
K+LLQE A + G LP Y V GP H P FT V + G +KK+A++NAA
Sbjct: 2 PKSLLQELAQKRGKPLPEYELVEEEGPDHAPRFTVEVTVGGKITGEGEGSSKKEAKQNAA 61
Query: 147 IAAWSAL 153
AA L
Sbjct: 62 EAALRKL 68
|
Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III, RNases H1, and dsRNA dependent adenosine deaminases. Length = 68 |
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|171444 PRK12371, PRK12371, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222987 PHA03103, PHA03103, double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234517 TIGR04238, seadorna_dsRNA, seadornavirus double-stranded RNA-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|171444 PRK12371, PRK12371, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 460 | |||
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 99.89 | |
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 99.79 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 99.77 | |
| PRK14718 | 467 | ribonuclease III; Provisional | 99.74 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 99.72 | |
| PRK00102 | 229 | rnc ribonuclease III; Reviewed | 99.64 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 99.62 | |
| TIGR02191 | 220 | RNaseIII ribonuclease III, bacterial. This family | 99.61 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 99.59 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 99.59 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 99.56 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 99.55 | |
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 99.33 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 99.3 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 99.25 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 99.24 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 99.22 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 99.18 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 99.16 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 99.16 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 99.1 | |
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 98.98 | |
| PRK14718 | 467 | ribonuclease III; Provisional | 98.95 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 98.9 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 98.87 | |
| PRK00102 | 229 | rnc ribonuclease III; Reviewed | 98.82 | |
| KOG1817 | 533 | consensus Ribonuclease [RNA processing and modific | 98.75 | |
| TIGR02191 | 220 | RNaseIII ribonuclease III, bacterial. This family | 98.73 | |
| KOG4334 | 650 | consensus Uncharacterized conserved protein, conta | 98.47 | |
| KOG3769 | 333 | consensus Ribonuclease III domain proteins [Transl | 97.82 | |
| KOG4334 | 650 | consensus Uncharacterized conserved protein, conta | 97.54 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 97.19 | |
| KOG1817 | 533 | consensus Ribonuclease [RNA processing and modific | 96.87 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 96.86 | |
| PF03368 | 90 | Dicer_dimer: Dicer dimerisation domain; InterPro: | 96.53 | |
| KOG3792 | 816 | consensus Transcription factor NFAT, subunit NF90 | 96.11 | |
| PF14954 | 252 | LIX1: Limb expression 1 | 95.15 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 94.23 | |
| KOG3769 | 333 | consensus Ribonuclease III domain proteins [Transl | 93.94 | |
| KOG2334 | 477 | consensus tRNA-dihydrouridine synthase [Translatio | 91.33 |
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
Probab=99.89 E-value=1.7e-22 Score=203.41 Aligned_cols=153 Identities=27% Similarity=0.283 Sum_probs=129.1
Q ss_pred cHHHHHHHHHHcCCCCCceEEE-eeCCCCCCceEEEEEECceeeecccchhhhHHHHHHHHHHHHHHHhccCCCC-----
Q 012622 2 YKNQLQELAQRSCFNLPSYTCI-REGPDHAPRFKASVNFNGEIFESPSYCTTLRQAEHAAAEVALNVLSTRGPSR----- 75 (460)
Q Consensus 2 yKS~LQElcQK~gl~LPeY~ll-eeGP~H~p~Ftv~V~IdG~vfEsG~gG~SKKqAEq~AAr~aL~~L~~~~p~~----- 75 (460)
..+.|||+|.++++ .|.|+++ ++|+.|.+.|+++|.|+. |++.+.|.+||.|++.||..+|..|....+..
T Consensus 40 ~IS~l~E~~~r~~~-~v~fevl~eeGp~H~~~fv~rvtvg~--~~a~GeG~sKK~AKh~AA~~~L~~lk~l~~l~~v~k~ 116 (339)
T KOG3732|consen 40 PISLLQEYGLRRGL-TPVYEVLREEGPPHMPNFVFRVTVGE--ITATGEGKSKKLAKHRAAEALLKELKKLPPLANVRKD 116 (339)
T ss_pred hHHHHHHHHHHhCC-CcceeeeeccCCccCCCeEEEEEEee--eEEecCCCchhHHHHHHHHHHHHHHhcCCCccccccC
Confidence 57899999999885 4799999 689999999999999985 44445799999999999999999998753321
Q ss_pred ----cccc-------ccc----cccCChhHHHHHHHHHcCCCCCeEEee-ccCCCCCCeEEEEEEECCEeecccccCCHH
Q 012622 76 ----SLTA-------RVL----DETGIYKNLLQETAHRAGLNLPVYTTV-RSGPGHVPIFTCTVELAGMNFTGEPAKTKK 139 (460)
Q Consensus 76 ----~l~d-------~~k----D~~~NyKS~LQE~cQK~~l~lP~Yevv-esGP~H~p~Ft~tV~V~G~~fg~G~G~SKK 139 (460)
.... ... +...||+++||||||+++|++|.|+++ +.|++|.+.|++.|.+++.. ..|.|.|||
T Consensus 117 ~~~~~~~~~~~~~~~q~~d~~~~~~~NPI~~L~e~~q~k~~k~P~yelv~E~G~~~~rEFv~q~sv~~~~-~~GkG~sKK 195 (339)
T KOG3732|consen 117 SLKFAKMKSSGVKKDQPGDPEYGQVLNPIGRLQELAQAKKWKLPEYELVQESGVPHRREFVIQCSVENFT-EEGKGPSKK 195 (339)
T ss_pred cccccccccCCccccCCCCcccccccChHHHHHHHHHHhCCCCCceEEEeccCCCccceEEEEEEeccee-eecCCchHH
Confidence 0000 011 136799999999999999999999999 88999999999999999875 458999999
Q ss_pred HHHHHHHHHHHHHHhcCCC
Q 012622 140 QAEKNAAIAAWSALKRMPN 158 (460)
Q Consensus 140 eAEQ~AAk~AL~~L~~~~~ 158 (460)
.||++||.+||+.|.-...
T Consensus 196 iAKRnAAeamLe~l~~~~~ 214 (339)
T KOG3732|consen 196 IAKRNAAEAMLESLGFVKP 214 (339)
T ss_pred HHHHHHHHHHHHHhccCCC
Confidence 9999999999999986553
|
|
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PRK14718 ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PRK00102 rnc ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >TIGR02191 RNaseIII ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >PRK14718 ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >PRK00102 rnc ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >KOG1817 consensus Ribonuclease [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02191 RNaseIII ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >KOG1817 consensus Ribonuclease [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases | Back alignment and domain information |
|---|
| >KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] | Back alignment and domain information |
|---|
| >PF14954 LIX1: Limb expression 1 | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 460 | ||||
| 2l2m_A | 77 | Solution Structure Of The Second Dsrbd Of Hyl1 Leng | 1e-08 | ||
| 3adj_A | 76 | Structure Of Arabidopsis Hyl1 And Its Molecular Imp | 3e-07 | ||
| 2l2n_A | 103 | Backbone 1h, 13c, And 15n Chemical Shift Assignment | 7e-06 | ||
| 2l2n_A | 103 | Backbone 1h, 13c, And 15n Chemical Shift Assignment | 2e-05 | ||
| 3adg_A | 73 | Structure Of Arabidopsis Hyl1 And Its Molecular Imp | 1e-05 | ||
| 3adg_A | 73 | Structure Of Arabidopsis Hyl1 And Its Molecular Imp | 4e-05 |
| >pdb|2L2M|A Chain A, Solution Structure Of The Second Dsrbd Of Hyl1 Length = 77 | Back alignment and structure |
|
| >pdb|3ADJ|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 76 | Back alignment and structure |
| >pdb|2L2N|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For The First Dsrbd Of Protein Hyl1 Length = 103 | Back alignment and structure |
| >pdb|2L2N|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For The First Dsrbd Of Protein Hyl1 Length = 103 | Back alignment and structure |
| >pdb|3ADG|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 73 | Back alignment and structure |
| >pdb|3ADG|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
Score = 153 bits (387), Expect = 1e-44
Identities = 32/163 (19%), Positives = 61/163 (37%), Gaps = 8/163 (4%)
Query: 2 YKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPSYCTTLRQAEHAAA 61
+ +L Q+ L GP H RF V +G F + ++A++AAA
Sbjct: 15 FMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGR-SKKEAKNAAA 73
Query: 62 EVALNVLSTRGPSRSLTARVLDETG------IYKNLLQETAHRAGLNLPVYTTVRSGPGH 115
++A+ +L+ + S + Y L+ A + L + Y SG
Sbjct: 74 KLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVN-YEQCASGVHG 132
Query: 116 VPIFTCTVELAGMNFTGEPAKTKKQAEKNAAIAAWSALKRMPN 158
F ++ ++ TK++A++ AA A+ +
Sbjct: 133 PEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEET 175
|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Length = 114 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Length = 114 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Length = 756 | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Length = 756 | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 88 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 460 | |||
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.97 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 99.93 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.91 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 99.8 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 99.79 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 99.77 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 99.77 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 99.77 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 99.75 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 99.75 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 99.75 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 99.75 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 99.75 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.75 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 99.74 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 99.74 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 99.73 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 99.73 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 99.71 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 99.71 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 99.69 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 99.69 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 99.68 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 99.68 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 99.68 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 99.66 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 99.66 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 99.65 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 99.63 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 99.63 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 99.62 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 99.61 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 99.59 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 99.58 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 99.57 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 99.53 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 99.52 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 99.5 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 99.5 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 99.49 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 99.48 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 99.48 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 99.47 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 99.46 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 99.45 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 99.44 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 99.44 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 99.41 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 99.41 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 99.39 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 99.38 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 99.37 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 99.37 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 99.37 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 99.36 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 99.32 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 99.32 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.25 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 99.23 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 99.16 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 99.16 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 99.1 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 99.09 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 99.04 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 98.93 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 98.92 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 98.28 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 97.75 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 96.13 | |
| 2kou_A | 102 | Dicer-like protein 4; ATP-binding, endonuclease, h | 95.43 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 93.87 | |
| 2db2_A | 119 | KIAA0890 protein; DSRM domain, structural genomics | 85.95 |
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
Probab=99.97 E-value=5.2e-30 Score=235.88 Aligned_cols=156 Identities=22% Similarity=0.292 Sum_probs=134.2
Q ss_pred CcHHHHHHHHHHcCCCCCceEEE-eeCCCCCCceEEEEEECceeeecccchhhhHHHHHHHHHHHHHHHhccCCCCcc--
Q 012622 1 MYKNQLQELAQRSCFNLPSYTCI-REGPDHAPRFKASVNFNGEIFESPSYCTTLRQAEHAAAEVALNVLSTRGPSRSL-- 77 (460)
Q Consensus 1 myKS~LQElcQK~gl~LPeY~ll-eeGP~H~p~Ftv~V~IdG~vfEsG~gG~SKKqAEq~AAr~aL~~L~~~~p~~~l-- 77 (460)
.||+.||||||++++. |.|.++ +.||+|++.|++.|.|+|..++.| .|.+||.|++.||+.+|..|.........
T Consensus 14 n~ks~LqE~~q~~~~~-p~Y~~~~~~Gp~h~~~F~~~v~v~g~~~~~G-~G~sKK~Aeq~AA~~al~~L~~~~~~~~p~~ 91 (179)
T 1qu6_A 14 FFMEELNTYRQKQGVV-LKYQELPNSGPPHDRRFTFQVIIDGREFPEG-EGRSKKEAKNAAAKLAVEILNKEKKAVSPLL 91 (179)
T ss_dssp SHHHHHHHHHHHHTCC-CEEEEEESCBTTTBCCEEEEEESSSSCCCEE-ECCSSHHHHHHHHHHHHHHHHSCCSCCSCSS
T ss_pred CHHHHHHHHHHhCCCC-CeEEEeeccCCCCCCeEEEEEEECCEEEEec-CCCCHHHHHHHHHHHHHHHHhcccccCCCcc
Confidence 3799999999999986 899988 689999999999999999888777 68999999999999999999865321110
Q ss_pred ---cccccc-ccCChhHHHHHHHHHcCCCCCeEEeeccCCCCCCeEEEEEEECCEeecccccCCHHHHHHHHHHHHHHHH
Q 012622 78 ---TARVLD-ETGIYKNLLQETAHRAGLNLPVYTTVRSGPGHVPIFTCTVELAGMNFTGEPAKTKKQAEKNAAIAAWSAL 153 (460)
Q Consensus 78 ---~d~~kD-~~~NyKS~LQE~cQK~~l~lP~YevvesGP~H~p~Ft~tV~V~G~~fg~G~G~SKKeAEQ~AAk~AL~~L 153 (460)
.+...+ ...||++.||||||++++.+ .|++.++|++|.+.|+|+|.|+|..|+.|.|.|||+||++||+.||..|
T Consensus 92 ~~~~~~~e~~~~~n~~~~L~E~~qk~~~~~-~Y~~~~~G~~h~~~F~~~v~v~~~~~~~g~g~sKK~Ak~~AA~~al~~L 170 (179)
T 1qu6_A 92 LTTTNSSEGLSMGNYIGLINRIAQKKRLTV-NYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQI 170 (179)
T ss_dssp CCCSCSSCCCCCCCCHHHHHHHHHHSCCEE-EEEEEEECSSSSSEEEEEEEEETTBCCEEEESSHHHHHHHHHHHHHHHH
T ss_pred CCCCCcccccCCCCHHHHHHHHHHhcCCcc-eEEecCcCCCCCCeEEEEEEECCEEEeeEEECCHHHHHHHHHHHHHHHH
Confidence 000111 35699999999999999987 9998889999999999999999999889999999999999999999999
Q ss_pred hcCCCC
Q 012622 154 KRMPNL 159 (460)
Q Consensus 154 ~~~~~~ 159 (460)
......
T Consensus 171 ~~~~~~ 176 (179)
T 1qu6_A 171 LSEETG 176 (179)
T ss_dssp HHCCCC
T ss_pred hcccCc
Confidence 775443
|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A | Back alignment and structure |
|---|
| >2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2db2_A KIAA0890 protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 460 | ||||
| d2nuga2 | 68 | d.50.1.1 (A:151-218) RNase III, C-terminal domain | 1e-15 | |
| d2nuga2 | 68 | d.50.1.1 (A:151-218) RNase III, C-terminal domain | 1e-12 | |
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 2e-15 | |
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 3e-14 | |
| d1x48a1 | 76 | d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p | 1e-14 | |
| d1x48a1 | 76 | d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p | 1e-13 | |
| d1x49a1 | 85 | d.50.1.1 (A:8-92) dsRNA-dependent protein kinase p | 2e-14 | |
| d1x49a1 | 85 | d.50.1.1 (A:8-92) dsRNA-dependent protein kinase p | 4e-12 | |
| d1qu6a1 | 90 | d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p | 7e-13 | |
| d1qu6a1 | 90 | d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p | 8e-12 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 1e-11 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 3e-10 | |
| d2b7va1 | 71 | d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R | 5e-11 | |
| d2b7va1 | 71 | d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R | 7e-10 | |
| d1t4oa_ | 81 | d.50.1.1 (A:) RNase III, C-terminal domain {Baker' | 7e-11 | |
| d1t4oa_ | 81 | d.50.1.1 (A:) RNase III, C-terminal domain {Baker' | 4e-07 | |
| d2b7ta1 | 73 | d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (R | 1e-10 | |
| d2b7ta1 | 73 | d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (R | 4e-10 | |
| d1di2a_ | 69 | d.50.1.1 (A:) Double-stranded RNA-binding protein | 1e-10 | |
| d1di2a_ | 69 | d.50.1.1 (A:) Double-stranded RNA-binding protein | 7e-09 | |
| d2dmya1 | 84 | d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin | 2e-10 | |
| d2dmya1 | 84 | d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin | 5e-10 | |
| d1ekza_ | 76 | d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros | 3e-09 | |
| d1ekza_ | 76 | d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros | 3e-09 | |
| d1whna_ | 128 | d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, | 7e-09 | |
| d1whna_ | 128 | d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, | 1e-08 | |
| d1uila_ | 113 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 1e-08 | |
| d1uila_ | 113 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 7e-08 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 1e-08 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 3e-07 | |
| d1whqa_ | 99 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 2e-08 | |
| d1whqa_ | 99 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 2e-08 | |
| d2cpna1 | 76 | d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu | 1e-07 | |
| d2cpna1 | 76 | d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu | 2e-07 | |
| d2dixa1 | 73 | d.50.1.1 (A:7-79) Interferon-inducible double stra | 2e-07 | |
| d2dixa1 | 73 | d.50.1.1 (A:7-79) Interferon-inducible double stra | 1e-06 | |
| d1uhza_ | 89 | d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul | 2e-05 | |
| d1uhza_ | 89 | d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul | 6e-05 |
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: dsRBD-like superfamily: dsRNA-binding domain-like family: Double-stranded RNA-binding domain (dsRBD) domain: RNase III, C-terminal domain species: Aquifex aeolicus [TaxId: 63363]
Score = 68.9 bits (168), Expect = 1e-15
Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
Query: 88 YKNLLQETAHRAGLNLPVYTTVRS-GPGHVPIFTCTVELAGMNFTGEPAKTKKQAEKNAA 146
YK +LQE + P Y + GP H F ++ GE K+KK+AE+ AA
Sbjct: 2 YKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGE-GKSKKEAEQRAA 60
Query: 147 IAAWSALK 154
L+
Sbjct: 61 EELIKLLE 68
|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 460 | |||
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 99.79 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.78 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 99.76 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.75 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 99.75 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.75 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 99.75 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 99.73 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 99.72 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.71 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.71 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 99.68 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.67 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 99.59 | |
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 99.56 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 99.56 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.54 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 99.53 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.5 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.48 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 99.47 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.45 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 99.45 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.45 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.45 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 99.44 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 99.43 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 99.41 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 99.36 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.36 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.32 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 99.29 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.08 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 99.08 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.02 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 98.83 |
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: dsRBD-like superfamily: dsRNA-binding domain-like family: Double-stranded RNA-binding domain (dsRBD) domain: RNase III, C-terminal domain species: Thermotoga maritima [TaxId: 2336]
Probab=99.79 E-value=7.3e-20 Score=142.45 Aligned_cols=67 Identities=33% Similarity=0.369 Sum_probs=64.7
Q ss_pred ChhHHHHHHHHHcCCCCCeEEee-ccCCCCCCeEEEEEEECCEeecccccCCHHHHHHHHHHHHHHHH
Q 012622 87 IYKNLLQETAHRAGLNLPVYTTV-RSGPGHVPIFTCTVELAGMNFTGEPAKTKKQAEKNAAIAAWSAL 153 (460)
Q Consensus 87 NyKS~LQE~cQK~~l~lP~Yevv-esGP~H~p~Ft~tV~V~G~~fg~G~G~SKKeAEQ~AAk~AL~~L 153 (460)
|||+.||||||++++.+|.|+++ .+|++|.+.|+|.|.|+|..++.|.|+|||+|||+||+.||+.|
T Consensus 1 d~Ks~LqE~~Qk~~~~~P~Y~~~~~~g~~h~~~F~~~v~v~~~~~~~g~g~sKK~Aeq~AA~~aL~~L 68 (69)
T d1o0wa2 1 DYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKL 68 (69)
T ss_dssp CHHHHHHHHHHHHHSSCCEEEEEEEECCTTSCEEEEEEEETTEEEEEEEESSHHHHHHHHHHHHHHHH
T ss_pred ChHHHHHHHHHHcCCCCCEEEEEEeeCCCCCceEEEEEEECCEEEEEEEeCCHHHHHHHHHHHHHHHh
Confidence 79999999999999999999998 77999999999999999999999999999999999999999987
|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|