Citrus Sinensis ID: 012630

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46

MCLNAVFGSFVWVNSSVLLVYTIPLSRGDSPKKSLVPFGPKIQSNEQQNVIQNRYTEGLLKDEFDEYLFEHYTTTQLVLATLDGTVKEFGPPAIYTAVEPSPDQKYILITSIDRPYSFTVSYTKFPQKVQVWTADGKFVRQLCELPLVENIPIAYNSVREGMRLISWRADRPSTLYWVETQDGGAAKVEVSPRDIIYTQPAEPVEGEEPEILHKLDLRFRGVSWCDDSLALVQETWFKTTQTRTWLISPGSKDTAPLILFDRSSEDVYSDPGLPMMRKSSTGTRVIAKIKKENDQGTYILLNGRGATPEGDVPFLDLFNINTGSKERIWESDKEKYYETAVALNLDQSVGDVNLNQLKILTSKESKTEITQYWIQSWPHKKCRQITDFPHPYPLLSTLQKELIKYQRKDGVQLTAKLYLPTGYDPSKDGHLLCLFWAYPGEFRSKDAAGQVRGSPNEFS

cccccccccEEEEccccEEEEEEEccccccccccccccccEEEEEccccccccccHHHHcccHHHHHHHHHHHHccEEEEEcccEEEEEccccEEEEccccccccEEEEEEccccccccccccccccEEEEEcccccEEEEEEcccccccccccccccccccccccccccccccEEEEEEEcccccccccccccEEEEcccccccccccEEEEcccccccccEEcccccEEEEEEEcccccEEEEEEcccccccccEEEEcccccccccccccccEEEcccccEEEEEEEEccccccEEEEEEcccccccccccEEEcccccccEEEEEEEccccEEEEEEEcccccccccccccccEEEEEEEcccccccEEEEEcccccccccccccccccccccccEEEEEEEcccccEEEEEEEEccccccccccccEEEEEEcccccccccccccccccccccc

cccccccccEEEcccccEEEEEEcccccccccccccccccEEEEcccccccccccHHHHcccHHHHHHHHHHHHccEEEEEccccEEEcccccEEEcccccccccEEEEEEEccccEEEEEccccccEEEEEEccccEEEEEcccccHcccccccccccccccccccccccccEEEEEEEccccccccccccHHHEHEcccccccccccHEEEEcccHcccEEEccccEEEEEEEccccccEEEEEEcccccccccEEEEEcccccccccccccEEEEcccccEEEEEEEEccccccEEEEEccccccccccccEEEEEccccccEEEEEcccccccccEEEEccccccccccccccEEEEEEccccccccEEEEEccccccEEEcccccccHHHcccccEEEEEEcccccEEEEEEEccccccccccccccEEEEEccHHcccHHHHccccccccccc

MCLNAVFGSFVWVNSSVLLVYTiplsrgdspkkslvpfgpkiqsneQQNVIQNRytegllkdEFDEYLFEHYTTTQLVLATLDgtvkefgppaiytavepspdqkYILITsidrpysftvsytkfpqkvQVWTADGKFVRQLCelplvenipiaYNSVREGMRLISwradrpstlywvetqdggaakvevsprdiiytqpaepvegeepeilhkldlrfrgvswcddSLALVQETWFKTtqtrtwlispgskdtaplilfdrssedvysdpglpmmrksstgTRVIAKIKKENDQGTYILLngrgatpegdvpfldlfnintgskeriwesdkeKYYETAVALNLdqsvgdvnlNQLKILTSKESKTEITQYWIqswphkkcrqitdfphpypllSTLQKELIKYQRKDGVQLTAKLylptgydpskdghLLCLFWaypgefrskdaagqvrgspnefs

MCLNAVFGSFVWVNSSVLLVYTIplsrgdspkKSLVPFgpkiqsneqqnvIQNRYTEGLLKDEFDEYLFEHYTTTQLVLATLDGTVKEFGPPAiytavepspdQKYILITSIDRPYSFTVSYTKFPQKVQVWTADGKFVRQLCELplvenipiaynsVREGMRLISWRADRPSTLYWVETQdggaakvevsprdiiytqpaepvegeepeILHKLDLRFRGVSWCDDSLALVQETWFKttqtrtwlispgskdtaplILFDrssedvysdpglpmmrksstgtrVIAKikkendqgtYILLNGRGATPEGDVPFLDLFNINTGSKERIWESDKEKYYETAVAlnldqsvgdvNLNQLKILTSKESKTEITQYWIQSWPHKKCRQITDFPHPYPLLSTLQKELIKYQRKDGVQLTAKLYLPTGYDPSKDGHLLCLFWAYPGEFrskdaagqvrgspnefs

*CLNAVFGSFVWVNSSVLLVYTIPL************************VIQNRYTEGLLKDEFDEYLFEHYTTTQLVLATLDGTVKEFGPPAIYTAVEPSPDQKYILITSIDRPYSFTVSYTKFPQKVQVWTADGKFVRQLCELPLVENIPIAYNSVREGMRLISWRADRPSTLYWVETQDGGAAKVEVSPRDIIYTQ*********PEILHKLDLRFRGVSWCDDSLALVQETWFKTTQTRTWLISPGSKDTAPLILFD***********************VIAKIKKENDQGTYILLNGRGATPEGDVPFLDLFNINTGSKERIWESDKEKYYETAVALNLDQSVGDVNLNQLKILTSKESKTEITQYWIQSWPHKKCRQITDFPHPYPLLSTLQKELIKYQRKDGVQLTAKLYLPTGYDPSKDGHLLCLFWAYPGEF*****************

MCLNAVFGSFVWVNSSVLLVYTI******************************RYTEGLLKDEFDEYLFEHYTTTQLVLATLDGTVKEFGPPAIYTAVEPSPDQKYILITSIDRPYSFTVSYTKFPQKVQVWTADGKFVRQLCELPLVENIPIAYNSVREGMRLISWRADRPSTLYWVETQDGGAAKVEVSPRDIIYTQPAEPVEGEEPEILHKLDLRFRGVSWCDDSLALVQETWFKTTQTRTWLISPGSKDTAPLILFDRSSEDVYSDPGLPMMRKSSTGTRVIAKIKKENDQGTYILLNGRGATPEGDVPFLDLFNINTGSKERIWESDKEKYYETAVALNLDQSVGDVNLNQLKILTSKESKTEITQYWIQSWPHKKCRQITDFPHPYPLLSTLQKELIKYQRKDGVQLTAKLYLPTGYDPSKDGHLLCLFWAYPGE******************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		459	2.2.26 [Sep-21-2011]
Q8VZF3		960	Probable glutamyl endopep	yes	no	0.993	0.475	0.708	0.0
Q10MJ1		938	Probable glutamyl endopep	yes	no	0.991	0.485	0.701	0.0

>sp\|Q8VZF3\|CGEP_ARATH Probable glutamyl endopeptidase, chloroplastic OS=Arabidopsis thaliana GN=GEP PE=2 SV=2	Back alignment and function desciption

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/457 (70%), Positives = 391/457 (85%), Gaps = 1/457 (0%)

Query: 3   LNAVFGSFVWVNSSVLLVYTIPLSRGDSPKKSLVPFGPKIQSNEQQNVIQNRYTEGLLKD 62
           LNA+F SFVW+++S LLV TIP SRG+ PKK LVP GPK  SNE + V+Q R  + LLKD
Sbjct: 256 LNAIFESFVWIDNSTLLVSTIPSSRGEPPKKPLVPSGPKTLSNETKTVVQVRTFQDLLKD 315

Query: 63  EFDEYLFEHYTTTQLVLATLDGTVKEFGPPAIYTAVEPSPDQKYILITSIDRPYSFTVSY 122
           E+D  LF++Y ++QLVLA+LDGTVKE G PA+YT+++PS D KY+L++S+ RPYSF V  
Sbjct: 316 EYDADLFDYYASSQLVLASLDGTVKEVGVPAVYTSLDPSTDHKYLLVSSLHRPYSFIVPC 375

Query: 123 TKFPQKVQVWTADGKFVRQLCELPLVENIPIAYNSVREGMRLISWRADRPSTLYWVETQD 182
            +FP+KV+VWT DG+FVRQLC+LPL E+IPIA NSVR+GMR I+WRAD+PSTL W ETQD
Sbjct: 376 GRFPKKVEVWTTDGRFVRQLCDLPLAEDIPIASNSVRKGMRSINWRADKPSTL-WAETQD 434

Query: 183 GGAAKVEVSPRDIIYTQPAEPVEGEEPEILHKLDLRFRGVSWCDDSLALVQETWFKTTQT 242
           GG AK+EVSPRDI+Y Q AEP+ GEEPE+LHKLDLR+ G+SWCDD+LALV E+W+KT +T
Sbjct: 435 GGDAKMEVSPRDIVYMQSAEPLAGEEPEVLHKLDLRYGGISWCDDTLALVYESWYKTRRT 494

Query: 243 RTWLISPGSKDTAPLILFDRSSEDVYSDPGLPMMRKSSTGTRVIAKIKKENDQGTYILLN 302
           RTW+ISPGS D +P ILFDRSSEDVYSDPG  M+R++  GT VIAKIKKEND+GTY+LLN
Sbjct: 495 RTWVISPGSNDVSPRILFDRSSEDVYSDPGSTMLRRTDAGTYVIAKIKKENDEGTYVLLN 554

Query: 303 GRGATPEGDVPFLDLFNINTGSKERIWESDKEKYYETAVALNLDQSVGDVNLNQLKILTS 362
           G GATP+G+VPFLDLF+INTG+KERIWESDKEKY+ET VAL  DQ  GD+ + +LKILTS
Sbjct: 555 GSGATPQGNVPFLDLFDINTGNKERIWESDKEKYFETVVALMSDQKEGDLKMEELKILTS 614

Query: 363 KESKTEITQYWIQSWPHKKCRQITDFPHPYPLLSTLQKELIKYQRKDGVQLTAKLYLPTG 422
           KESKTE TQY +Q WP +K +QIT+FPHPYP L++LQKE+I+YQRKDGVQLTA LYLP G
Sbjct: 615 KESKTENTQYSLQLWPDRKVQQITNFPHPYPQLASLQKEMIRYQRKDGVQLTATLYLPPG 674

Query: 423 YDPSKDGHLLCLFWAYPGEFRSKDAAGQVRGSPNEFS 459
           YDPSKDG L CLFW+YPGEF+SKDAAGQVRGSPNEF+
Sbjct: 675 YDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFA 711

Serine-type protease active in vitro against the LHCII N-terminal. Cleaves its substrate on the carboxy-side of Glu residues.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -

>sp\|Q10MJ1\|CGEP_ORYSJ Probable glutamyl endopeptidase, chloroplastic OS=Oryza sativa subsp. japonica GN=GEP PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		459
359479944		961	PREDICTED: probable glutamyl endopeptida	0.995	0.475	0.752	0.0
297743980		913	unnamed protein product [Vitis vinifera]	0.995	0.500	0.752	0.0
224064539		905	predicted protein [Populus trichocarpa]	0.995	0.504	0.737	0.0
224130988		967	predicted protein [Populus trichocarpa]	0.995	0.472	0.743	0.0
2275219		955	unknown protein [Arabidopsis thaliana]	0.995	0.478	0.711	0.0
30690669		961	prolyl oligopeptidase-like protein [Arab	0.995	0.475	0.711	0.0
297828471		962	serine-type peptidase [Arabidopsis lyrat	0.995	0.475	0.711	0.0
356572793		948	PREDICTED: probable glutamyl endopeptida	0.995	0.482	0.720	0.0
357511363		962	Acylamino-acid-releasing enzyme [Medicag	0.995	0.475	0.708	0.0
332278170		960	RecName: Full=Probable glutamyl endopept	0.993	0.475	0.708	0.0

>gi\|359479944\|ref\|XP_002270510.2\| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/457 (75%), Positives = 404/457 (88%)

Query: 3   LNAVFGSFVWVNSSVLLVYTIPLSRGDSPKKSLVPFGPKIQSNEQQNVIQNRYTEGLLKD 62
           LNAVF +FVWV+ S LLV TIPLSRGD PKK LVP GPK+QSNEQ+NV+Q R  + LLKD
Sbjct: 249 LNAVFDNFVWVDDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKNVVQVRTFQDLLKD 308

Query: 63  EFDEYLFEHYTTTQLVLATLDGTVKEFGPPAIYTAVEPSPDQKYILITSIDRPYSFTVSY 122
           E+D  LF++Y TTQLVLA+LDGT+KE GPPA+YT+++PSPDQKY+LI+SI RPYSF V  
Sbjct: 309 EYDADLFDYYATTQLVLASLDGTMKEIGPPAVYTSMDPSPDQKYLLISSIHRPYSFIVPC 368

Query: 123 TKFPQKVQVWTADGKFVRQLCELPLVENIPIAYNSVREGMRLISWRADRPSTLYWVETQD 182
            +FP+KV +WT++GKFVR+LC+LPL E+IPIA+NSVR+GMR I+WRAD+PSTLYWVETQD
Sbjct: 369 GRFPKKVDLWTSEGKFVRELCDLPLAEDIPIAFNSVRKGMRSINWRADKPSTLYWVETQD 428

Query: 183 GGAAKVEVSPRDIIYTQPAEPVEGEEPEILHKLDLRFRGVSWCDDSLALVQETWFKTTQT 242
            G AKVEVSPRDI+Y QPAEP++GE+  ILHKLDLR+ G+SWCDDSLALV E+W+KT +T
Sbjct: 429 EGDAKVEVSPRDIVYMQPAEPLDGEQQAILHKLDLRYGGISWCDDSLALVYESWYKTRRT 488

Query: 243 RTWLISPGSKDTAPLILFDRSSEDVYSDPGLPMMRKSSTGTRVIAKIKKENDQGTYILLN 302
           RTW+ISPGS+D +P ILFDRSSEDVYSDPG PM+R+++ GT VIAKIKKEND+GTYILLN
Sbjct: 489 RTWVISPGSEDVSPRILFDRSSEDVYSDPGSPMLRRTTAGTYVIAKIKKENDEGTYILLN 548

Query: 303 GRGATPEGDVPFLDLFNINTGSKERIWESDKEKYYETAVALNLDQSVGDVNLNQLKILTS 362
           G GATPEG++PFLDLF+INTGSKERIWESDKEKYYET VAL  DQS GD+ LNQLKILTS
Sbjct: 549 GSGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETVVALMSDQSEGDLYLNQLKILTS 608

Query: 363 KESKTEITQYWIQSWPHKKCRQITDFPHPYPLLSTLQKELIKYQRKDGVQLTAKLYLPTG 422
           KESKTE TQY+IQSW  KK  QIT+FPHPYP L++LQKE+I+Y+RKDGVQLTA LYLP G
Sbjct: 609 KESKTENTQYFIQSWLDKKACQITNFPHPYPQLASLQKEMIRYERKDGVQLTATLYLPPG 668

Query: 423 YDPSKDGHLLCLFWAYPGEFRSKDAAGQVRGSPNEFS 459
           YDPSKDG L CL W+YPGEF+SKDAAGQVRGSPNEF+
Sbjct: 669 YDPSKDGPLPCLVWSYPGEFKSKDAAGQVRGSPNEFA 705

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297743980\|emb\|CBI36950.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224064539\|ref\|XP_002301512.1\| predicted protein [Populus trichocarpa] gi\|222843238\|gb\|EEE80785.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224130988\|ref\|XP_002320974.1\| predicted protein [Populus trichocarpa] gi\|222861747\|gb\|EEE99289.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|2275219\|gb\|AAB63841.1\| unknown protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|30690669\|ref\|NP_850473.1\| prolyl oligopeptidase-like protein [Arabidopsis thaliana] gi\|330255741\|gb\|AEC10835.1\| prolyl oligopeptidase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297828471\|ref\|XP_002882118.1\| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] gi\|297327957\|gb\|EFH58377.1\| serine-type peptidase [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356572793\|ref\|XP_003554550.1\| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|357511363\|ref\|XP_003625970.1\| Acylamino-acid-releasing enzyme [Medicago truncatula] gi\|355500985\|gb\|AES82188.1\| Acylamino-acid-releasing enzyme [Medicago truncatula]	Back alignment and taxonomy information

>gi\|332278170\|sp\|Q8VZF3.2\|CGEP_ARATH RecName: Full=Probable glutamyl endopeptidase, chloroplastic; Flags: Precursor	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		459
UNIPROTKB\|Q8EHB8		801	SO_1310 "Serine peptidase S9 f	0.954	0.546	0.277	1.2e-43
TIGR_CMR\|SO_1310		801	SO_1310 "conserved hypothetica	0.954	0.546	0.277	1.2e-43

UNIPROTKB\|Q8EHB8 SO_1310 "Serine peptidase S9 family" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

 Score = 467 (169.5 bits), Expect = 1.2e-43, P = 1.2e-43
 Identities = 127/457 (27%), Positives = 214/457 (46%)

Query:     3 LNAVFG-SFVWVNSSVLLVYTIPLSRGDSPKKSLVPFGPKIQSNEQQNVIQNRYTEGLLK 61
             LN      + W N+  LL   + +++  S  +  V   PK +    +N  Q  Y + LLK
Sbjct:   160 LNGTISLDYQWANNKTLLARFV-IAQDISASQPHVSISPKTKETSGKNSPQRTYQD-LLK 217

Query:    62 DEFDEYLFEHYTTTQLVLATLDGTVKEFGPPAIYTAVEPSPDQKYILITSIDRPYSFTVS 121
                D+ LF   TT+QL L  L+G + + G P I      SPD +YIL   I  P+S  V 
Sbjct:   218 TSADKQLFSRLTTSQLALVDLEGKLTKIGAPGIIEDFSVSPDGQYILSRQITTPFSTQVK 277

Query:   122 YTKFPQKVQVWTADGKFVRQLCELPLVENIPIAYNSVREGMRLISWRADRPSTLYWVETQ 181
             Y  FP   +++  +G+ +  L +    E+ P   +SV  G R+  W   + +TL + +  
Sbjct:   278 YDDFPTLTEIYNLNGQLITLLHQSQGGESRPQGKDSVLPGPRMFHWVQGQAATLAFTKAL 337

Query:   182 DGGAAKVEVSPRDIIYTQPAEPVEGEEPEILHKLDLRFRGVSWCDDSLALVQETWFKTTQ 241
             D G ++ +   RD ++    +P   ++   + +   R   + W ++ LAL+ E   K  Q
Sbjct:   338 DQGDSQRDAPQRDSLWL--LDPPFTQQATRVAQTQWRITDIDWAENHLALITERNSKAQQ 395

Query:   242 TRTWLISPGSKDTAPLILFDRSSEDVYSDPGLPMMRKSSTGTRVIAKIKKENDQGTYILL 301
              R   ++    +++   L +R+  D Y D GL   +    G   +  ++ +  + T ++ 
Sbjct:   396 IRLSSLNTRLGESSLHTLNERNLRDKYQDLGL-FAKHYYPGKGQVVSLQ-QGAKTTGLIH 453

Query:   302 NGRGATPEGDVPFLDLFNINTGSKERIWESDKEKYYETAVALNLDQSVGDVNLNQLKILT 361
              G+GATP+GD PFL   ++ T     +W+S   +       LNLD          L+++ 
Sbjct:   454 YGQGATPQGDKPFLKRTSLITSESSLLWQSASNRLESVRYVLNLDP---------LQLII 504

Query:   362 SKESKTEITQYWIQSWPHKKCRQITDFPHPYPLLSTLQKELIKYQRKDGVQLTAKLYLPT 421
             ++ES TE     + +   +    + + P        +QK+LI ++R DGV L+  LYLP 
Sbjct:   505 NRESPTESPSLVLLNAAKESV--LYEQPDGLSAYLGMQKQLITFKRADGVPLSGTLYLPA 562

Query:   422 GYDPSKDGHLLCLFWAYPGEFRSKDAAGQVRGSPNEF 458
              Y   + G L  L WAYP EF   + AGQ+  S N++
Sbjct:   563 NYT-KEQGTLPVLMWAYPREFNDPEVAGQISFSANQY 598

GO:0003674 "molecular_function" evidence=ND

GO:0005575 "cellular_component" evidence=ND

GO:0008150 "biological_process" evidence=ND

TIGR_CMR\|SO_1310 SO_1310 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q10MJ1	CGEP_ORYSJ	3, ., 4, ., 2, 1, ., -	0.7017	0.9912	0.4850	yes	no
Q8VZF3	CGEP_ARATH	3, ., 4, ., 2, 1, ., -	0.7089	0.9934	0.475	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00028112001	SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (884 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00015534001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (725 aa)	•	0.422

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		459
COG1506		620	COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin	0.004

>gnl\|CDD\|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]	Back alignment and domain information

 Score = 39.4 bits (92), Expect = 0.004
 Identities = 21/96 (21%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 346 DQSVGDVNLNQLKILTSKESKTEITQYWIQSWPHKKCRQITDFPHPYPLLSTL-QKELIK 404
           D  V   +++  K+  +  S TE  + ++  +   +  ++T   +       L + E + 
Sbjct: 312 DGGVPGFDVDGRKLALAYSSPTEPPEIYL--YDRGEEAKLTSSNNSGLKKVKLAEPEPVT 369

Query: 405 YQRKDGVQLTAKLYLPTGYDPSKDGHLLCLFWAYPG 440
           Y+  DG  +   LY P G+DP K   L  + + + G
Sbjct: 370 YKSNDGETIHGWLYKPPGFDPRKKYPL--IVYIHGG 403

Length = 620

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		459
PRK01029		428	tolB translocation protein TolB; Provisional	99.76
PRK03629		429	tolB translocation protein TolB; Provisional	99.71
PRK05137		435	tolB translocation protein TolB; Provisional	99.7
PRK04043		419	tolB translocation protein TolB; Provisional	99.69
COG1506		620	DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept	99.66
PRK04792		448	tolB translocation protein TolB; Provisional	99.64
PRK02889		427	tolB translocation protein TolB; Provisional	99.63
PRK04922		433	tolB translocation protein TolB; Provisional	99.62
PRK05137		435	tolB translocation protein TolB; Provisional	99.62
PRK00178		430	tolB translocation protein TolB; Provisional	99.62
PRK04043		419	tolB translocation protein TolB; Provisional	99.6
PRK03629		429	tolB translocation protein TolB; Provisional	99.59
PRK10115		686	protease 2; Provisional	99.57
PRK04792		448	tolB translocation protein TolB; Provisional	99.55
PRK00178		430	tolB translocation protein TolB; Provisional	99.55
PRK01029		428	tolB translocation protein TolB; Provisional	99.53
PRK02889		427	tolB translocation protein TolB; Provisional	99.53
PRK04922		433	tolB translocation protein TolB; Provisional	99.51
PRK01742		429	tolB translocation protein TolB; Provisional	99.5
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.46
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	99.43
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	99.31
PRK01742		429	tolB translocation protein TolB; Provisional	99.19
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.12
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	99.1
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	99.04
PRK13616		591	lipoprotein LpqB; Provisional	98.82
COG1770		682	PtrB Protease II [Amino acid transport and metabol	98.71
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	98.7
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	98.67
COG4946		668	Uncharacterized protein related to the periplasmic	98.62
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	98.59
COG4946		668	Uncharacterized protein related to the periplasmic	98.42
KOG2281		867	consensus Dipeptidyl aminopeptidases/acylaminoacyl	98.41
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	98.28
KOG2100		755	consensus Dipeptidyl aminopeptidase [Posttranslati	98.15
PRK13616		591	lipoprotein LpqB; Provisional	98.01
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	97.84
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	97.79
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	97.6
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	97.6
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	97.57
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	97.41
KOG2315		566	consensus Predicted translation initiation factor	97.41
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	97.39
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.31
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.26
KOG2237		712	consensus Predicted serine protease [Posttranslati	97.21
KOG0318		603	consensus WD40 repeat stress protein/actin interac	97.2
KOG2055		514	consensus WD40 repeat protein [General function pr	96.96
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	96.92
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	96.91
COG1505		648	Serine proteases of the peptidase family S9A [Amin	96.86
PF07676		39	PD40: WD40-like Beta Propeller Repeat; InterPro: I	96.76
KOG0293		519	consensus WD40 repeat-containing protein [Function	96.68
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	96.58
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	96.5
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	96.45
TIGR02171		912	Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou	96.11
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	95.93
KOG0645		312	consensus WD40 repeat protein [General function pr	95.9
KOG0973		942	consensus Histone transcription regulator HIRA, WD	95.88
KOG1274		933	consensus WD40 repeat protein [General function pr	95.78
PF10647		253	Gmad1: Lipoprotein LpqB beta-propeller domain; Int	95.77
PRK11028		330	6-phosphogluconolactonase; Provisional	95.61
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	95.6
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	95.51
PRK11028		330	6-phosphogluconolactonase; Provisional	95.47
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	95.45
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	95.35
KOG0293		519	consensus WD40 repeat-containing protein [Function	95.23
PRK10115		686	protease 2; Provisional	95.11
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	95.02
KOG2139		445	consensus WD40 repeat protein [General function pr	94.97
KOG1407		313	consensus WD40 repeat protein [Function unknown]	94.9
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	94.9
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	94.58
PTZ00421		493	coronin; Provisional	94.42
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	94.35
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	94.33
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	94.12
PTZ00420		568	coronin; Provisional	94.09
PTZ00421		493	coronin; Provisional	94.02
PTZ00420		568	coronin; Provisional	94.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	93.97
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	93.87
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	93.79
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	93.72
KOG0318		603	consensus WD40 repeat stress protein/actin interac	93.7
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	93.62
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	93.58
KOG2139		445	consensus WD40 repeat protein [General function pr	93.55
KOG0279		315	consensus G protein beta subunit-like protein [Sig	93.52
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	93.45
KOG1407		313	consensus WD40 repeat protein [Function unknown]	93.44
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	93.26
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	93.25
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	93.24
KOG0266		456	consensus WD40 repeat-containing protein [General	93.14
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	92.6
KOG0315		311	consensus G-protein beta subunit-like protein (con	92.59
PF05448		320	AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0	92.43
TIGR02171		912	Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou	92.4
KOG1274		933	consensus WD40 repeat protein [General function pr	92.21
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	92.2
KOG0973		942	consensus Histone transcription regulator HIRA, WD	92.07
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	92.01
KOG0284		464	consensus Polyadenylation factor I complex, subuni	91.99
KOG1539		910	consensus WD repeat protein [General function pred	91.34
KOG0266		456	consensus WD40 repeat-containing protein [General	91.33
KOG0296		399	consensus Angio-associated migratory cell protein	91.16
KOG0288		459	consensus WD40 repeat protein TipD [General functi	91.08
PF10647		253	Gmad1: Lipoprotein LpqB beta-propeller domain; Int	91.07
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	90.97
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	90.71
KOG2314		698	consensus Translation initiation factor 3, subunit	90.65
COG3458		321	Acetyl esterase (deacetylase) [Secondary metabolit	90.62
KOG1273		405	consensus WD40 repeat protein [General function pr	90.51
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	90.23
PF07676		39	PD40: WD40-like Beta Propeller Repeat; InterPro: I	90.19
KOG0772		641	consensus Uncharacterized conserved protein, conta	89.82
KOG2096		420	consensus WD40 repeat protein [General function pr	89.4
KOG2096		420	consensus WD40 repeat protein [General function pr	89.3
PF03088		89	Str_synth: Strictosidine synthase; InterPro: IPR01	89.23
KOG2055		514	consensus WD40 repeat protein [General function pr	89.16
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	89.04
KOG0275		508	consensus Conserved WD40 repeat-containing protein	88.92
KOG0278		334	consensus Serine/threonine kinase receptor-associa	88.84
KOG2315		566	consensus Predicted translation initiation factor	88.63
KOG0279		315	consensus G protein beta subunit-like protein [Sig	88.24
KOG0286		343	consensus G-protein beta subunit [General function	88.18
KOG0263		707	consensus Transcription initiation factor TFIID, s	87.79
KOG0288		459	consensus WD40 repeat protein TipD [General functi	87.34
KOG0263		707	consensus Transcription initiation factor TFIID, s	87.14
KOG2106		626	consensus Uncharacterized conserved protein, conta	84.64
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	83.98
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	83.97
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	83.93
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	83.81
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	83.73
PLN00181		793	protein SPA1-RELATED; Provisional	82.8
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	82.08
KOG1273		405	consensus WD40 repeat protein [General function pr	81.79
KOG0302		440	consensus Ribosome Assembly protein [General funct	81.63
KOG0645		312	consensus WD40 repeat protein [General function pr	81.23
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	80.87
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	80.17
COG4099		387	Predicted peptidase [General function prediction o	80.11

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

Probab=99.76  E-value=2.3e-16  Score=163.02  Aligned_cols=266  Identities=14%  Similarity=0.126  Sum_probs=167.5

Q ss_pred             CCCeEeecCCCcccccccccccCCChhhHHHHHHHhhcceEEEcC-CCceeecCCC-ceeeecccCCCCCeE--EEEEec
Q 012630           38 FGPKIQSNEQQNVIQNRYTEGLLKDEFDEYLFEHYTTTQLVLATL-DGTVKEFGPP-AIYTAVEPSPDQKYI--LITSID  113 (459)
Q Consensus        38 ~~p~i~~~~~~~~~~~rt~~d~l~~~~D~~~f~~~~~sqL~~v~~-~G~~~~l~~~-~~~~~~~~SPDG~~l--~~~~~~  113 (459)
                      ..|.+.  . .+++++.+..+.-+++         ..++||++|. ++++++||.. ....+++|||||+.+  +|++.+
T Consensus       140 g~~g~~--~-~~iayv~~~~~~~~~~---------~~~~l~~~d~dG~~~~~lt~~~~~~~sP~wSPDG~~~~~~y~S~~  207 (428)
T PRK01029        140 GVPGIS--S-GKIIFSLSTTNSDTEL---------KQGELWSVDYDGQNLRPLTQEHSLSITPTWMHIGSGFPYLYVSYK  207 (428)
T ss_pred             CCCccc--c-CEEEEEEeeCCccccc---------ccceEEEEcCCCCCceEcccCCCCcccceEccCCCceEEEEEEcc
Confidence            335555  2 4555665544443332         4789999999 6789999974 445799999999984  457643


Q ss_pred             cCcccccccCCCCcceEEEecCCceeeeeecccccccccccccccccceeeeEEecCCCceEEEEEeccCCccccccCCC
Q 012630          114 RPYSFTVSYTKFPQKVQVWTADGKFVRQLCELPLVENIPIAYNSVREGMRLISWRADRPSTLYWVETQDGGAAKVEVSPR  193 (459)
Q Consensus       114 ~p~s~~v~~~~~~~~~~v~d~~g~~~~~lt~~p~~~~~P~~~~~~~~~~r~~~WspDg~~~l~~~~~~d~g~~~~~~~~~  193 (459)
                                ....+||+.+++|++.++|+..+....             .+.|||||+ .|+|+...++ .        
T Consensus       208 ----------~g~~~I~~~~l~~g~~~~lt~~~g~~~-------------~p~wSPDG~-~Laf~s~~~g-~--------  254 (428)
T PRK01029        208 ----------LGVPKIFLGSLENPAGKKILALQGNQL-------------MPTFSPRKK-LLAFISDRYG-N--------  254 (428)
T ss_pred             ----------CCCceEEEEECCCCCceEeecCCCCcc-------------ceEECCCCC-EEEEEECCCC-C--------
Confidence                      123689999999999999988654333             459999999 8888763322 1        


Q ss_pred             CeEEec--cCCCCCCCCceEeccccc-eeccceeCCCCcEEEEEeecCCccEEEEEEcCCCCCCCceEEeecCCCCccCC
Q 012630          194 DIIYTQ--PAEPVEGEEPEILHKLDL-RFRGVSWCDDSLALVQETWFKTTQTRTWLISPGSKDTAPLILFDRSSEDVYSD  270 (459)
Q Consensus       194 ~~l~~~--~~~pf~g~~~~~L~~~~~-~~~~~~Ws~D~~al~~~~~~~~~~~~ly~v~~~~~~~~~~~l~d~~~~d~y~~  270 (459)
                      ..+|++  +..--.+++++.|+.... ....+.|+|||..|++...+ ....++|+++....++.++.|+......    
T Consensus       255 ~di~~~~~~~~~g~~g~~~~lt~~~~~~~~~p~wSPDG~~Laf~s~~-~g~~~ly~~~~~~~g~~~~~lt~~~~~~----  329 (428)
T PRK01029        255 PDLFIQSFSLETGAIGKPRRLLNEAFGTQGNPSFSPDGTRLVFVSNK-DGRPRIYIMQIDPEGQSPRLLTKKYRNS----  329 (428)
T ss_pred             cceeEEEeecccCCCCcceEeecCCCCCcCCeEECCCCCEEEEEECC-CCCceEEEEECcccccceEEeccCCCCc----
Confidence            134443  320001247788886432 34668999998666655432 3556899998753233356664322100    


Q ss_pred             CCCCCeeeCCCCCEEEEEeeeccCCCcEEEEEcCCCCCCCCcceEEEEECCCCceEEEeecCcccceEEEEEeecCCCcc
Q 012630          271 PGLPMMRKSSTGTRVIAKIKKENDQGTYILLNGRGATPEGDVPFLDLFNINTGSKERIWESDKEKYYETAVALNLDQSVG  350 (459)
Q Consensus       271 pg~~~~~~~~dg~~v~~~~~~~~~~~~~ly~~~~g~s~~gd~~~l~~~~l~tg~~~~l~~~~~~~~~e~~~~~~~~~~~~  350 (459)
                         ....++|||+.+++...                 ..+ ...|+.+|+++|+.+.+.....  ..+.+ .        
T Consensus       330 ---~~p~wSPDG~~Laf~~~-----------------~~g-~~~I~v~dl~~g~~~~Lt~~~~--~~~~p-~--------  377 (428)
T PRK01029        330 ---SCPAWSPDGKKIAFCSV-----------------IKG-VRQICVYDLATGRDYQLTTSPE--NKESP-S--------  377 (428)
T ss_pred             ---cceeECCCCCEEEEEEc-----------------CCC-CcEEEEEECCCCCeEEccCCCC--Cccce-E--------
Confidence               12357999987765431                 011 2358889999998887765431  11111 1        


Q ss_pred             ccccCCCEEEEEeecCCCCcceEEEECCCcceeeccc
Q 012630          351 DVNLNQLKILTSKESKTEITQYWIQSWPHKKCRQITD  387 (459)
Q Consensus       351 ~~~~d~~~i~~~~~s~~~P~ely~~~~~~g~~~~LT~  387 (459)
                       .+.|+..+++.... ....++|++++.+++.++||.
T Consensus       378 -wSpDG~~L~f~~~~-~g~~~L~~vdl~~g~~~~Lt~  412 (428)
T PRK01029        378 -WAIDSLHLVYSAGN-SNESELYLISLITKKTRKIVI  412 (428)
T ss_pred             -ECCCCCEEEEEECC-CCCceEEEEECCCCCEEEeec
Confidence             34455677776654 345789999998888888885

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK10115 protease 2; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>COG1770 PtrB Protease II [Amino acid transport and metabolism]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism]	Back alignment and domain information

>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PRK10115 protease 2; Provisional	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins	Back alignment and domain information

>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>COG4099 Predicted peptidase [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		459
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 50.2 bits (119), Expect = 1e-06
 Identities = 66/452 (14%), Positives = 130/452 (28%), Gaps = 112/452 (24%)

Query: 33  KSLVP-FGPKIQSNEQQNVIQNRYTEGLLKDEFDEYLFEHYTTTQLVLATLDGTVKEFGP 91
           K ++  F      N     +Q+     L K+E D  +      +  +   L  T+     
Sbjct: 19  KDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLR--LFWTLLSKQE 76

Query: 92  PAIYTAVEPSPDQKY-ILITSI----DRPYSFTVSYTKFPQKVQVWTADGKFV-RQLCEL 145
             +   VE      Y  L++ I     +P   T  Y +  Q+ +++  +  F    +  L
Sbjct: 77  EMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIE--QRDRLYNDNQVFAKYNVSRL 134

Query: 146 PLVENIPIAYNSVREGMRLI---------SW------RADR-----PSTLYWVETQDGGA 185
                +  A   +R    ++         +W       + +        ++W+       
Sbjct: 135 QPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWL-----NL 189

Query: 186 AKVEVSPRDIIYTQPAEPVEGEEPEILHKLDLRFR--GVSWCDDSLALVQETWFKTTQTR 243
                SP  ++             E+L KL  +      S  D S  +         + R
Sbjct: 190 KNCN-SPETVL-------------EMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELR 235

Query: 244 TWLISPGSKDTAPLILFDRSSEDVYSDPGLPMMRKSSTGTRVIAKIKKENDQGTYILLNG 303
             L S   ++   L++      +V +                 AK     +    ILL  
Sbjct: 236 RLLKSKPYENC--LLVLL----NVQN-----------------AKAWNAFNLSCKILLTT 272

Query: 304 RGATPEGDVPFLDLFNINTGSKERIWESDK---EKYYETAVALNLDQSVGD-----VNLN 355
           R           D  +  T +   +            ++ +   LD    D     +  N
Sbjct: 273 R------FKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTN 326

Query: 356 QLKILTSKESKTEITQYWIQSWPHKKCRQITDFPHPYPLLSTLQKELIKYQRKDGVQLTA 415
             ++    ES  +    W  +W H  C +          L+T+ +  +        +   
Sbjct: 327 PRRLSIIAESIRDGLATW-DNWKHVNCDK----------LTTIIESSLNVLEPAEYR--- 372

Query: 416 KLY-----LPTGYD-PSKDGHLLCLFWAYPGE 441
           K++      P     P+    LL L W    +
Sbjct: 373 KMFDRLSVFPPSAHIPTI---LLSLIWFDVIK 401

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		459
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.91
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	99.88
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	99.87
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	99.85
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.84
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	99.84
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.83
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.82
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	99.8
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	99.78
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	99.76
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	99.74
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.57
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	99.55
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.49
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.41
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.4
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.36
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	99.35
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.34
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.33
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.32
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.3
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	99.3
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	99.26
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	99.22
4hvt_A		711	Ritya.17583.B, post-proline cleaving enzyme; ssgci	99.21
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.09
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.04
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.0
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	98.98
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	98.93
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	98.92
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	98.92
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	98.9
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	98.8
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	98.76
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	98.65
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	98.65
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	98.65
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	98.63
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	98.62
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	98.62
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	98.55
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	98.53
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	98.5
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	98.5
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	98.47
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	98.45
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	98.41
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	98.32
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	98.28
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	98.11
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	98.05
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	98.01
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	97.96
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	97.89
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	97.84
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	97.82
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	97.81
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	97.76
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	97.73
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	97.7
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	97.69
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	97.62
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	97.61
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	97.59
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	97.58
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	97.57
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	97.54
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	97.53
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	97.52
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	97.52
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	97.47
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	97.44
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	97.39
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	97.37
3ow8_A		321	WD repeat-containing protein 61; structural genomi	97.32
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	97.32
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	97.3
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	97.28
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	97.25
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	97.25
3ow8_A		321	WD repeat-containing protein 61; structural genomi	97.22
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	97.17
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	97.15
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	97.15
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	97.1
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	97.1
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	97.07
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	97.07
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	97.06
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	97.06
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	97.06
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	97.05
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	97.05
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	97.04
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	97.04
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	97.02
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	97.01
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	97.01
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	96.97
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	96.96
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	96.95
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	96.94
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	96.93
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	96.92
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	96.91
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	96.91
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	96.87
3v65_B		386	Low-density lipoprotein receptor-related protein;	96.87
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	96.78
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	96.78
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	96.76
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	96.74
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	96.71
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	96.69
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	96.68
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	96.67
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	96.64
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	96.62
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	96.58
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	96.57
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	96.55
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	96.55
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	96.49
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	96.48
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	96.48
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	96.47
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	96.47
3jrp_A		379	Fusion protein of protein transport protein SEC13	96.43
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	96.42
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	96.39
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	96.38
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	96.3
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	96.28
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	96.25
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	96.25
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	96.24
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	96.22
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	96.17
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	96.16
3v65_B		386	Low-density lipoprotein receptor-related protein;	96.15
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	96.15
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	96.14
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	96.14
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	96.13
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	96.13
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	96.05
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	96.04
2ece_A		462	462AA long hypothetical selenium-binding protein;	96.03
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	96.03
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	96.02
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	96.01
1vlq_A		337	Acetyl xylan esterase; TM0077, structural genomics	96.0
3jrp_A		379	Fusion protein of protein transport protein SEC13	96.0
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	95.95
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	95.94
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	95.93
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	95.85
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	95.85
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	95.84
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	95.81
2pm7_B		297	Protein transport protein SEC13, protein transport	95.79
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	95.75
2qm0_A		275	BES; alpha-beta structure, structural genomics, PS	95.72
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	95.71
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	95.7
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	95.68
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	95.63
4ao6_A		259	Esterase; hydrolase, thermo label; 1.60A {Unidenti	95.51
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	95.49
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	95.48
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	95.42
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	95.38
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	95.38
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	95.38
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	95.3
2pm7_B		297	Protein transport protein SEC13, protein transport	95.28
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	95.27
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	95.27
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	95.26
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	95.25
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	95.25
1gkl_A		297	Endo-1,4-beta-xylanase Y; hydrolase, esterase fami	95.24
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	95.22
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	95.22
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	95.19
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	95.06
3doh_A		380	Esterase; alpha-beta hydrolase, beta sheet; 2.60A	95.03
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	95.0
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	94.96
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	94.94
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	94.93
3jro_A		753	Fusion protein of protein transport protein SEC13	94.86
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	94.84
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	94.81
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	94.79
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	94.78
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	94.75
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	94.68
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	94.53
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	94.5
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	94.39
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	93.98
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	93.93
3jro_A		753	Fusion protein of protein transport protein SEC13	93.87
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	93.87
2gzs_A		278	IROE protein; enterobactin, salmochelin, DFP, hydr	93.82
2ece_A		462	462AA long hypothetical selenium-binding protein;	93.82
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	93.81
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	93.79
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	93.61
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	93.56
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	93.51
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	93.43
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	93.35
2qe8_A		343	Uncharacterized protein; structural genomics, join	93.19
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	93.02
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	93.01
3ls2_A		280	S-formylglutathione hydrolase; psychrophilic organ	92.97
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	92.94
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	92.9
1jjf_A		268	Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x	92.83
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	92.72
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	92.62
3nuz_A		398	Putative acetyl xylan esterase; structural genomic	92.54
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	92.38
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	92.34
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	91.92
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	91.89
2g8s_A		353	Glucose/sorbosone dehydrogenases; bladed beta-prop	91.86
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	91.83
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	91.81
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	91.63
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	91.59
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	91.58
3i6y_A		280	Esterase APC40077; lipase, structural genomics, PS	91.47
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	91.38
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	91.2
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	91.07
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	91.06
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	91.06
3a9g_A		354	Putative uncharacterized protein; PQQ dependent de	91.05
3g8y_A		391	SUSD/RAGB-associated esterase-like protein; struct	91.0
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	90.97
2qe8_A		343	Uncharacterized protein; structural genomics, join	90.87
2hdw_A		367	Hypothetical protein PA2218; alpha/beta hydrolase	90.86
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	90.82
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	90.77
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	90.7
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	90.33
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	90.17
2b9v_A		652	Alpha-amino acid ester hydrolase; catalytic triad,	89.65
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	89.56
2jbw_A		386	Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine	89.52
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	89.46
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	89.38
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	89.3
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	89.15
1mpx_A		615	Alpha-amino acid ester hydrolase; alpha/beta hydro	89.04
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	89.02
3iii_A		560	COCE/NOND family hydrolase; structural genomics, c	88.42
3das_A		347	Putative oxidoreductase; aldose sugar dehydrogenas	88.22
1l7a_A		318	Cephalosporin C deacetylase; structural genomics,	88.08
2ism_A		352	Putative oxidoreductase; BL41XU spring-8, bladed b	87.68
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	87.62
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	87.39
4b6g_A		283	Putative esterase; hydrolase, formaldehyde detoxif	87.29
2ism_A		352	Putative oxidoreductase; BL41XU spring-8, bladed b	87.19
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	86.64
3fcy_A		346	Xylan esterase 1; alpha/beta hydrolase, carbohydra	86.59
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	86.25
3gff_A		331	IROE-like serine hydrolase; NP_718593.1, structura	85.8
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	85.76
2uz0_A		263	Esterase, tributyrin esterase; alpha/beta hydrolas	85.45
1cru_A		454	Protein (soluble quinoprotein glucose dehydrogena;	85.41
3a9g_A		354	Putative uncharacterized protein; PQQ dependent de	85.39
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	85.26
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	85.22
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	84.7
2p4o_A		306	Hypothetical protein; putative lactonase, structur	84.57
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	84.41
1lns_A		763	X-prolyl dipeptidyl aminopetidase; alpha beta hydr	84.39
3e4d_A		278	Esterase D; S-formylglutathione hydrolase, hydrola	84.21
3fcx_A		282	FGH, esterase D, S-formylglutathione hydrolase; re	83.89
3f67_A		241	Putative dienelactone hydrolase; alpha-beta-alpha	83.2
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	82.94
3qh4_A		317	Esterase LIPW; structural genomics, ssgcid, seattl	82.64
3sre_A		355	PON1, serum paraoxonase; directed evolution, 6-bla	82.37
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	81.47
3das_A		347	Putative oxidoreductase; aldose sugar dehydrogenas	81.3
3c8d_A		403	Enterochelin esterase; alpha-beta-alpha sandwich,	81.02
3ebl_A		365	Gibberellin receptor GID1; alpha/beta hydrolase, l	80.82
3kya_A		496	Putative phosphatase; structural genomics, joint c	80.42
2g8s_A		353	Glucose/sorbosone dehydrogenases; bladed beta-prop	80.21
2hm7_A		310	Carboxylesterase; alpha/beta hydrolase fold, hydro	80.01

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

Probab=99.91  E-value=2.2e-22  Score=220.36  Aligned_cols=329  Identities=12%  Similarity=0.056  Sum_probs=208.6

Q ss_pred             hhcceEEEcC-CCceeecCC-CceeeecccCCCCCeEEEEEeccCcccccccCCCCcceEEEecCCceeeeeeccccccc
Q 012630           73 TTTQLVLATL-DGTVKEFGP-PAIYTAVEPSPDQKYILITSIDRPYSFTVSYTKFPQKVQVWTADGKFVRQLCELPLVEN  150 (459)
Q Consensus        73 ~~sqL~~v~~-~G~~~~l~~-~~~~~~~~~SPDG~~l~~~~~~~p~s~~v~~~~~~~~~~v~d~~g~~~~~lt~~p~~~~  150 (459)
                      ..+.+|++|+ +|+.++|+. ++....++|||||++|||++.              .+|++++++++..++|+.....+.
T Consensus        90 ~~~~~~~~d~~~~~~~~l~~~~~~~~~~~~SPdG~~la~~~~--------------~~i~~~~~~~~~~~~lt~~g~~~~  155 (740)
T 4a5s_A           90 YTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWN--------------NDIYVKIEPNLPSYRITWTGKEDI  155 (740)
T ss_dssp             EEEEEEEEETTTTEECCSSCCCTTEEEEEECSSTTCEEEEET--------------TEEEEESSTTSCCEECCSCCBTTT
T ss_pred             cceEEEEEECCCCcEEEcccCCCcceeeEECCCCCEEEEEEC--------------CeEEEEECCCCceEEEcCCCCccc
Confidence            4578999999 889888886 556689999999999999952              578999999888888876322111


Q ss_pred             cccccccc---------ccceeeeEEecCCCceEEEEEeccCCcccccc------------------------CCCCeEE
Q 012630          151 IPIAYNSV---------REGMRLISWRADRPSTLYWVETQDGGAAKVEV------------------------SPRDIIY  197 (459)
Q Consensus       151 ~P~~~~~~---------~~~~r~~~WspDg~~~l~~~~~~d~g~~~~~~------------------------~~~~~l~  197 (459)
                      .   +.+.         -...+.+.|||||+ .|+|....+..-.....                        .....|+
T Consensus       156 ~---~~g~~~~v~~ee~~~~~~~~~wSpDg~-~la~~~~d~~~v~~~~~~~~~~~~~~~~~~~~~~yp~~G~~~~~~~l~  231 (740)
T 4a5s_A          156 I---YNGITDWVYEEEVFSAYSALWWSPNGT-FLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFF  231 (740)
T ss_dssp             E---EESBCCHHHHHHTSSSSBCEEECTTSS-EEEEEEEECTTCCEEEEEECCSTTCSSCEEEEEECCBTTSCCCEEEEE
T ss_pred             e---ecCcccccccchhcCCCcceEECCCCC-EEEEEEEcccCCceEEEEeecCCCCCCCcceeecCCCCcCcCCeeEEE
Confidence            0   0000         12235689999999 88887654332111000                        0012688


Q ss_pred             eccCCCCCC---C---CceEecc------ccceeccceeCCCCcEEEEEeecCCccEEEEEEcCCCCCC------CceEE
Q 012630          198 TQPAEPVEG---E---EPEILHK------LDLRFRGVSWCDDSLALVQETWFKTTQTRTWLISPGSKDT------APLIL  259 (459)
Q Consensus       198 ~~~~~pf~g---~---~~~~L~~------~~~~~~~~~Ws~D~~al~~~~~~~~~~~~ly~v~~~~~~~------~~~~l  259 (459)
                      ++++   ++   +   +.+.|..      ....+..+.|||||..+++...+......|+++++++++.      ..+++
T Consensus       232 v~d~---~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~wspdg~~~~~~~~r~~~~~~i~~~d~~tg~~~~~~~~~~~l~  308 (740)
T 4a5s_A          232 VVNT---DSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHI  308 (740)
T ss_dssp             EEET---TSCCSSSCCCEEEECCCHHHHTSCEEEEEEEEEETTEEEEEEEESSTTEEEEEEEEEETTTTEEEECGGGCEE
T ss_pred             EEEC---CCCCCCCcceEEEecCCccCCCCCeEEEEEEEeCCCeEEEEEeCCCCCEEEEEEEECCCCccccceeEEEEee
Confidence            8888   65   5   4555543      2334567899999876665554445567899999876541      11222


Q ss_pred             eecCCCCccCC---CCCCCeeeCCCCCEEE-EEeee-------------c----------------cCCCcEEEEEcCCC
Q 012630          260 FDRSSEDVYSD---PGLPMMRKSSTGTRVI-AKIKK-------------E----------------NDQGTYILLNGRGA  306 (459)
Q Consensus       260 ~d~~~~d~y~~---pg~~~~~~~~dg~~v~-~~~~~-------------~----------------~~~~~~ly~~~~g~  306 (459)
                      .+..  +.+.+   +..+  .+++||+.++ +....             .                .-+++.||+++.+.
T Consensus       309 ~~~~--~~~v~~~~~~~p--~fspDG~~l~~~~s~~~G~~~l~~~~~~~~~~~~lT~g~~~v~~~~~~d~~~i~f~~~~~  384 (740)
T 4a5s_A          309 EMST--TGWVGRFRPSEP--HFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEY  384 (740)
T ss_dssp             EECS--SSCSSSSSCCCC--EECTTSSEEEEEEECTTSCEEEEEEETTCSSCEESCCSSSCEEEEEEECSSEEEEEESCG
T ss_pred             eccC--CceEccCcCCCc--eEcCCCCEEEEEEEcCCCceEEEEEECCCCceEecccCCEEEEEEEEEeCCEEEEEEecC
Confidence            2211  12222   1122  4578888665 32211             0                02255677766430


Q ss_pred             CCCCCcceEEEEECCCCceEEEeecC----cccceEEEEEeecCCCccccccCCCEEEEEeecCCCCcceEEEECCCcce
Q 012630          307 TPEGDVPFLDLFNINTGSKERIWESD----KEKYYETAVALNLDQSVGDVNLNQLKILTSKESKTEITQYWIQSWPHKKC  382 (459)
Q Consensus       307 s~~gd~~~l~~~~l~tg~~~~l~~~~----~~~~~e~~~~~~~~~~~~~~~~d~~~i~~~~~s~~~P~ely~~~~~~g~~  382 (459)
                      .......+|+++++++++.+....+.    .. .+..+          .++.++..+++..+++. |+.+++++..+++.
T Consensus       385 ~~~~~~~~ly~v~~~g~~~~~~lt~~~~~~~~-~~~~~----------~~S~dg~~~~~~~s~~~-~p~~~l~~~~~~~~  452 (740)
T 4a5s_A          385 KGMPGGRNLYKIQLIDYTKVTCLSCELNPERC-QYYSV----------SFSKEAKYYQLRCSGPG-LPLYTLHSSVNDKG  452 (740)
T ss_dssp             GGCTTCBEEEEEETTEEEEEEESSTTTSTTTB-CBEEE----------EECTTSSEEEEEECSBS-SCEEEEEETTTTEE
T ss_pred             CCCCceeEEEEEECCCCCcceeeccccCCCCC-ceEEE----------EECCCCCEEEEEeCCCC-CCEEEEEECCCCcE
Confidence            01123457888888766554222211    01 12121          13556678888888887 99999999877777


Q ss_pred             eecccccCC----CCCCcCCceEEEEEECCCCcEEEEEEEccCCCCCCCCCCceEEEEEcCCc
Q 012630          383 RQITDFPHP----YPLLSTLQKELIKYQRKDGVQLTAKLYLPTGYDPSKDGHLLCLFWAYPGE  441 (459)
Q Consensus       383 ~~LT~~~~~----~~~~~~~~~E~i~yks~DG~~l~g~L~lP~~yd~~k~~kyP~Il~~Yp~e  441 (459)
                      .+++..|..    +....+.++|.+++ +.||.+|+++|++|++|++++  ++|+||++|..-
T Consensus       453 ~~~l~~n~~~~~~~~~~~~~~~~~~~~-~~dg~~l~~~~~~P~~~~~~~--~~P~vv~~HGg~  512 (740)
T 4a5s_A          453 LRVLEDNSALDKMLQNVQMPSKKLDFI-ILNETKFWYQMILPPHFDKSK--KYPLLLDVYAGP  512 (740)
T ss_dssp             EEEEECCHHHHHHHTTEECCEEEEEEE-EETTEEEEEEEEECTTCCTTS--CEEEEEECCCCT
T ss_pred             EEEeccChhhhhhhhhccCCccEEEEE-ccCCeEEEEEEEeCCCCCCCC--CccEEEEECCCC
Confidence            676655432    34455678899999 789999999999999998766  899999999864

PyMOL of 4a5s

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A*	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579}	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A*	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A*	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A*	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12}	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A*	Back alignment and structure

>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa}	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A*	Back alignment and structure

>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor}	Back alignment and structure

>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B*	Back alignment and structure

>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58}	Back alignment and structure

>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP}	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis}	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae}	Back alignment and structure

>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A	Back alignment and structure

>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A*	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21	Back alignment and structure

>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0	Back alignment and structure

>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0	Back alignment and structure

>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum}	Back alignment and structure

>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A*	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor}	Back alignment and structure

>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A*	Back alignment and structure

>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A*	Back alignment and structure

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12}	Back alignment and structure

>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		459
d2bgra2		258	c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26	0.001

>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: DPP6 catalytic domain-like
domain: Dipeptidyl peptidase IV/CD26, C-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]

 Score = 37.9 bits (86), Expect = 0.001
 Identities = 9/50 (18%), Positives = 20/50 (40%)

Query: 400 KELIKYQRKDGVQLTAKLYLPTGYDPSKDGHLLCLFWAYPGEFRSKDAAG 449
            + + +   +  +   ++ LP  +D SK   LL   +A P   ++     
Sbjct: 3   SKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFR 52

PyMOL of d2bgra2

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		459
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	99.58
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	99.55
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	99.54
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.42
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.26
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	99.24
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	99.2
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.2
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.03
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	98.95
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	98.52
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	98.5
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	98.49
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	98.43
d1qfma2		280	Prolyl oligopeptidase, C-terminal domain {Pig (Sus	98.31
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	98.07
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	98.07
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	98.04
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	97.92
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	97.87
d2bgra2		258	Dipeptidyl peptidase IV/CD26, C-terminal domain {P	97.78
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	97.5
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	97.32
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	97.28
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	97.2
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	97.2
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	97.11
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	97.07
d1tbga_		340	beta1-subunit of the signal-transducing G protein	97.06
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	96.96
d2hu7a2		260	Acylamino-acid-releasing enzyme, C-terminal donain	96.95
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	96.95
d1wb4a1		273	Feruloyl esterase domain of the cellulosomal xylan	96.9
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	96.85
d1jjfa_		255	Feruloyl esterase domain of the cellulosomal xylan	96.81
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	96.8
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	96.68
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	96.67
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	96.63
d2gzsa1		265	Enterobactin and salmochelin hydrolase IroE {Esche	96.61
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	96.58
d1vlqa_		322	Acetyl xylan esterase TM0077 {Thermotoga maritima	96.56
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	96.3
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	96.29
d1l7aa_		318	Cephalosporin C deacetylase {Bacillus subtilis [Ta	96.07
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	96.07
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	96.06
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	96.05
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	96.03
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	95.98
d2hu7a1		313	Acylamino-acid-releasing enzyme, N-terminal donain	95.75
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	95.68
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	95.2
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	95.0
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	94.72
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	94.43
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	94.38
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	94.35
d3c8da2		246	Enterochelin esterase, catalytic domain {Shigella	94.03
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	94.02
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	93.95
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	93.64
d1mpxa2		381	Alpha-amino acid ester hydrolase {Xanthomonas citr	93.62
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	93.34
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	93.06
d1jkma_		358	Carboxylesterase {Bacillus subtilis, brefeldin A e	92.3
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	91.64
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	91.33
d2b9va2		385	Alpha-amino acid ester hydrolase {Acetobacter past	91.31
d1u4na_		308	Carboxylesterase {Alicyclobacillus acidocaldarius	90.9
d1tbga_		340	beta1-subunit of the signal-transducing G protein	90.52
d1lzla_		317	Heroin esterase {Rhodococcus sp. [TaxId: 1831]}	90.18
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	89.82
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	89.29
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	88.88
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	88.14
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	86.52
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	83.84
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	81.14
d1pv1a_		299	Hypothetical esterase YJL068C {Baker's yeast (Sacc	81.04

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 8-bladed beta-propeller
superfamily: DPP6 N-terminal domain-like
family: DPP6 N-terminal domain-like
domain: Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.58  E-value=2.4e-13  Score=138.42  Aligned_cols=281  Identities=14%  Similarity=0.076  Sum_probs=161.2

Q ss_pred             HHhhcceEEEcC-CCceeecCCC----ceeeecccCCCCCeEEEEEeccCcccccccCCCCcceEEEecCCceeeeeecc
Q 012630           71 HYTTTQLVLATL-DGTVKEFGPP----AIYTAVEPSPDQKYILITSIDRPYSFTVSYTKFPQKVQVWTADGKFVRQLCEL  145 (459)
Q Consensus        71 ~~~~sqL~~v~~-~G~~~~l~~~----~~~~~~~~SPDG~~l~~~~~~~p~s~~v~~~~~~~~~~v~d~~g~~~~~lt~~  145 (459)
                      |-..+++|++|+ +|+.++|+..    .....+.|||||++|||+..              .++|+++..++...+|+..
T Consensus        87 ~s~~~~~~i~d~~~~~~~~l~~~~~~~~~l~~~~wSPDG~~iafv~~--------------~nl~~~~~~~~~~~~lt~~  152 (465)
T d1xfda1          87 HSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFE--------------NNIYYCAHVGKQAIRVVST  152 (465)
T ss_dssp             SCCCSEEEEEESSSCCCEECCCTTCCSCCCSBCCBCSSTTCEEEEET--------------TEEEEESSSSSCCEEEECC
T ss_pred             eeccccEEEEEccCCceeeccCccCCccccceeeeccCCceEEEEec--------------ceEEEEecCCCceEEEecc
Confidence            345689999999 8999988753    23356999999999999963              5789999887777777763


Q ss_pred             cccccc----c--ccccccccceeeeEEecCCCceEEEEEeccCCcccccc-------------------C---CCCeEE
Q 012630          146 PLVENI----P--IAYNSVREGMRLISWRADRPSTLYWVETQDGGAAKVEV-------------------S---PRDIIY  197 (459)
Q Consensus       146 p~~~~~----P--~~~~~~~~~~r~~~WspDg~~~l~~~~~~d~g~~~~~~-------------------~---~~~~l~  197 (459)
                      .....+    |  +....+......+.|||||+ .|+|....+..-+....                   .   ..-.|+
T Consensus       153 g~~~~i~nG~~d~vyeee~~~~~~a~~WSPDgk-~iaf~~~D~s~V~~~~~~~~~~~~~p~~~~~~Yp~~G~~np~~~l~  231 (465)
T d1xfda1         153 GKEGVIYNGLSDWLYEEEILKTHIAHWWSPDGT-RLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLH  231 (465)
T ss_dssp             CBTTTEEEEECCHHHHHTTSSSSEEEEECTTSS-EEEEEEEECTTSCEEEECCCSSSSSCCCEEEECCBTTSCCCEEEEE
T ss_pred             cCcceeeccccchhhhhhhccccceEEECCCCC-eEEEEEecccccceeecccccccccceeeeeeccccCCCCCceeEE
Confidence            221111    1  00001112235788999999 78887755443221100                   0   012466


Q ss_pred             eccCCCCCCCCceEecc-------ccceeccceeCCCCcEEEEEeecCCccEEEEEEcCCCCCCCceEE-eecCCCCccC
Q 012630          198 TQPAEPVEGEEPEILHK-------LDLRFRGVSWCDDSLALVQETWFKTTQTRTWLISPGSKDTAPLIL-FDRSSEDVYS  269 (459)
Q Consensus       198 ~~~~~pf~g~~~~~L~~-------~~~~~~~~~Ws~D~~al~~~~~~~~~~~~ly~v~~~~~~~~~~~l-~d~~~~d~y~  269 (459)
                      ++++   +++..+.+..       .+.....+.|++|+..++....+.....+++.+++.++..  +.+ .+.+  +.|.
T Consensus       232 v~d~---~~~~~~~~~~~~~~~~~~~~y~~~~~W~~d~~~~~~~~nR~q~~~~i~~~d~~tg~~--~~~~~e~~--~~wv  304 (465)
T d1xfda1         232 VIGL---NGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVC--TKKHEDES--EAWL  304 (465)
T ss_dssp             EEES---SSSCCCEECCCCCCGGGSSEEEEEEEESSSSEEEEEEEETTSCEEEEEEEETTTCCE--EEEEEEEC--SSCC
T ss_pred             EEec---CCCcEEEEEeccCcCccccceeeeeEEcCCCeEEEEEEccccccceEEEEcCCCCcE--EEEEEEcC--CceE
Confidence            6666   4433222211       1112355789999876666555667788899999987643  444 3332  2333


Q ss_pred             CCCCCCeeeCCCCCEEEEEe---e----------------------------e---------ccCCCcEEEEEcCCCCCC
Q 012630          270 DPGLPMMRKSSTGTRVIAKI---K----------------------------K---------ENDQGTYILLNGRGATPE  309 (459)
Q Consensus       270 ~pg~~~~~~~~dg~~v~~~~---~----------------------------~---------~~~~~~~ly~~~~g~s~~  309 (459)
                      ++......+++||+.+++..   .                            |         .+.+++.|||++...++.
T Consensus       305 ~~~~~~p~~~~dg~~~~fi~~se~~g~~~ly~~~~~~~~~~~~~~~~~~LT~G~w~V~~i~~~d~~~~~vyF~a~~~~p~  384 (465)
T d1xfda1         305 HRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKILAYDEKGNKIYFLSTEDLPR  384 (465)
T ss_dssp             CCCCCCCEECTTSCSEEEEEEECCSSSSCEEEEEEECSSCCSSSCCCCBSCCSSSCEEEEEEEETTTTEEEEEESSSCTT
T ss_pred             eccCCceeEccCCCeeEEEEeeeecccCceEEEEeccccccCCCceeEEeccCCceEEEEEEEcCCCCEEEEEEeCCCCC
Confidence            32222223444544322110   0                            0         024567889888544332


Q ss_pred             CCcceEEEEECCCCceEEEeecC---cccceEEEEEeecCCCccccccCCCEEEEEeecCCCCcceEEEECCCcce-eec
Q 012630          310 GDVPFLDLFNINTGSKERIWESD---KEKYYETAVALNLDQSVGDVNLNQLKILTSKESKTEITQYWIQSWPHKKC-RQI  385 (459)
Q Consensus       310 gd~~~l~~~~l~tg~~~~l~~~~---~~~~~e~~~~~~~~~~~~~~~~d~~~i~~~~~s~~~P~ely~~~~~~g~~-~~L  385 (459)
                        ..||++++++++....+..+.   .. .+-.          ..++.++..++.+.+++..|+ .++++..+++. +.|
T Consensus       385 --~~hly~v~l~g~~~~~~lt~~~~~~~-~~~~----------~~~S~~~~y~v~~~s~~~~P~-~~~~~~~~~~~~~~L  450 (465)
T d1xfda1         385 --RRQLYSANTVGNFNRQCLSCDLVENC-TYFS----------ASFSHSMDFFLLKCEGPGVPM-VTVHNTTDKKKMFDL  450 (465)
T ss_dssp             --CCEEEEECSSTTCCCBCSSTTSSSSC-CCCE----------EEECTTSSEEEEECCSSSSCC-EEEEETTTCCEEEEE
T ss_pred             --ceEEEEEECCCCCcceeeccccCCCC-CEEE----------EEECCCCCEEEEEeecCCCCe-EEEEECCCCCEEEEE
Confidence              357999999876544332222   11 1111          114556788888888887776 66777655553 345


Q ss_pred             cc
Q 012630          386 TD  387 (459)
Q Consensus       386 T~  387 (459)
                      +.
T Consensus       451 e~  452 (465)
T d1xfda1         451 ET  452 (465)
T ss_dssp             EC
T ss_pred             cC
Confidence            43

PyMOL of d1xfda1

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}	Back information, alignment and structure

>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure