Citrus Sinensis ID: 012794
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 456 | ||||||
| 225450401 | 764 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.942 | 0.562 | 0.795 | 0.0 | |
| 224124522 | 775 | predicted protein [Populus trichocarpa] | 0.936 | 0.550 | 0.787 | 0.0 | |
| 118489724 | 481 | unknown [Populus trichocarpa x Populus d | 0.936 | 0.887 | 0.790 | 0.0 | |
| 224124506 | 735 | predicted protein [Populus trichocarpa] | 0.938 | 0.582 | 0.803 | 0.0 | |
| 356505715 | 771 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.960 | 0.568 | 0.785 | 0.0 | |
| 356534927 | 736 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.925 | 0.573 | 0.764 | 0.0 | |
| 357511641 | 753 | DEAD-box ATP-dependent RNA helicase [Med | 0.934 | 0.565 | 0.780 | 0.0 | |
| 255543078 | 772 | dead box ATP-dependent RNA helicase, put | 0.925 | 0.546 | 0.747 | 1e-180 | |
| 356574052 | 736 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.921 | 0.570 | 0.761 | 1e-180 | |
| 343172316 | 782 | DEAD-box ATP-dependent RNA helicase, par | 0.932 | 0.543 | 0.726 | 1e-178 |
| >gi|225450401|ref|XP_002278318.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic [Vitis vinifera] gi|296089875|emb|CBI39694.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 672 bits (1735), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 355/446 (79%), Positives = 382/446 (85%), Gaps = 16/446 (3%)
Query: 14 VGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTS 73
VG+ DEKLAEGIKLYAI TTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVS+ALT+
Sbjct: 328 VGDHDEKLAEGIKLYAIPTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSMALTN 387
Query: 74 IIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPET 133
IASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPET
Sbjct: 388 SIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPET 447
Query: 134 FVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVV 193
FVHRSGRTGRAGKEGTAILMFTSSQRRTV+SLERDVGCKFEF+SPP +E+VLESSAEQVV
Sbjct: 448 FVHRSGRTGRAGKEGTAILMFTSSQRRTVKSLERDVGCKFEFISPPAIEEVLESSAEQVV 507
Query: 194 ATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQ 253
ATLNGVHPESVEFFTPTAQ+LIEEKGT ALAAALA LSGFS+PPS RSLI+HEQGWVTLQ
Sbjct: 508 ATLNGVHPESVEFFTPTAQKLIEEKGTGALAAALAHLSGFSQPPSFRSLISHEQGWVTLQ 567
Query: 254 LTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLN 313
LTRDS +SRGF+SARSV GFLSDVYPTAADE+GKI+++AD+RVQGAVFDLPEEIAKELLN
Sbjct: 568 LTRDSGYSRGFLSARSVTGFLSDVYPTAADELGKIYLVADERVQGAVFDLPEEIAKELLN 627
Query: 314 KQIPPGNTISKITKLPALQDDGPSSDNYGRFSSRDRFSRGGGSRFSRGGARGGARGGGSM 373
KQ+PPGNTISKITKLPALQDDGP+ D YGRFS+RDR S RGG+R
Sbjct: 628 KQMPPGNTISKITKLPALQDDGPAGDYYGRFSNRDRSS------------RGGSRERRGS 675
Query: 374 DRRGFRSSRSWGSDDEDGFSSSRGGRSFRSGNNRGSRFSTSSDDDWLI---GGSRSSRSS 430
R S DD + RGGRSFRS NN SR +S+DDWLI +RSS S
Sbjct: 676 RISRGRGSSWGSDDDGGDDLNRRGGRSFRSNNN-WSRNLRTSEDDWLIGGRRSNRSSSSF 734
Query: 431 SRDSRSFGGACFNCGKSGHRASECPN 456
RSFGG+CF CG+SGHRASECPN
Sbjct: 735 GSRERSFGGSCFTCGRSGHRASECPN 760
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224124522|ref|XP_002330044.1| predicted protein [Populus trichocarpa] gi|222871469|gb|EEF08600.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118489724|gb|ABK96663.1| unknown [Populus trichocarpa x Populus deltoides] | Back alignment and taxonomy information |
|---|
| >gi|224124506|ref|XP_002330040.1| predicted protein [Populus trichocarpa] gi|222871465|gb|EEF08596.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356505715|ref|XP_003521635.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356534927|ref|XP_003536002.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357511641|ref|XP_003626109.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|87240993|gb|ABD32851.1| Helicase, C-terminal; Zinc finger, CCHC-type; GUCT [Medicago truncatula] gi|355501124|gb|AES82327.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255543078|ref|XP_002512602.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223548563|gb|EEF50054.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356574052|ref|XP_003555166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|343172316|gb|AEL98862.1| DEAD-box ATP-dependent RNA helicase, partial [Silene latifolia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 456 | ||||||
| TAIR|locus:504955106 | 748 | emb1138 "embryo defective 1138 | 0.719 | 0.438 | 0.841 | 2.4e-153 | |
| TAIR|locus:2087852 | 616 | PMH2 "putative mitochondrial R | 0.370 | 0.274 | 0.621 | 1.2e-51 | |
| TAIR|locus:2087832 | 610 | PMH1 "putative mitochondrial R | 0.405 | 0.303 | 0.562 | 3.6e-50 | |
| ZFIN|ZDB-GENE-031113-10 | 759 | ddx21 "DEAD (Asp-Glu-Ala-Asp) | 0.710 | 0.426 | 0.389 | 9.4e-50 | |
| UNIPROTKB|E2RPT4 | 687 | DDX50 "Uncharacterized protein | 0.703 | 0.467 | 0.374 | 8.5e-49 | |
| UNIPROTKB|F1MMK3 | 737 | DDX50 "Uncharacterized protein | 0.703 | 0.435 | 0.374 | 1.2e-48 | |
| UNIPROTKB|E2QTT0 | 738 | DDX50 "Uncharacterized protein | 0.703 | 0.434 | 0.374 | 1.2e-48 | |
| MGI|MGI:2182303 | 734 | Ddx50 "DEAD (Asp-Glu-Ala-Asp) | 0.703 | 0.437 | 0.368 | 2.5e-48 | |
| UNIPROTKB|Q9BQ39 | 737 | DDX50 "ATP-dependent RNA helic | 0.703 | 0.435 | 0.374 | 2.7e-48 | |
| UNIPROTKB|E1BW15 | 693 | DDX50 "Uncharacterized protein | 0.526 | 0.346 | 0.432 | 2.6e-47 |
| TAIR|locus:504955106 emb1138 "embryo defective 1138" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1425 (506.7 bits), Expect = 2.4e-153, Sum P(2) = 2.4e-153
Identities = 276/328 (84%), Positives = 307/328 (93%)
Query: 14 VGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTS 73
VG+QDEKLAEGIKLYAI+TT+TSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLAL++
Sbjct: 314 VGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALSN 373
Query: 74 IIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPET 133
IA+EALHGDISQHQRERTLN FRQGKFTVLVATDVA+RGLDIPNVDL+IHYELPNDPET
Sbjct: 374 SIATEALHGDISQHQRERTLNAFRQGKFTVLVATDVASRGLDIPNVDLVIHYELPNDPET 433
Query: 134 FVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVV 193
FVHRSGRTGRAGKEG+AILM TSSQ+RTVRSLERDVGC FEF+SPP V D+LESSA+QVV
Sbjct: 434 FVHRSGRTGRAGKEGSAILMHTSSQKRTVRSLERDVGCHFEFISPPTVGDLLESSADQVV 493
Query: 194 ATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQ 253
ATLNGVHP+S++FF+ TAQ+L EEKGTDALAAALA LSGFS+PPSSRSL++HE+GWVTLQ
Sbjct: 494 ATLNGVHPDSIKFFSATAQKLYEEKGTDALAAALAHLSGFSQPPSSRSLLSHEKGWVTLQ 553
Query: 254 LTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLN 313
L RD +RGF+SARSV GFLSD+Y TAADE+GKI +IADDR+QGAVFDLPEEIAKELL
Sbjct: 554 LIRDPTNARGFLSARSVTGFLSDLYRTAADEVGKIFLIADDRIQGAVFDLPEEIAKELLE 613
Query: 314 KQIPPGNTISKITKLPALQDDGPSSDNY 341
K +P GN++S ITKLP LQDDGPSSDNY
Sbjct: 614 KDVPEGNSLSMITKLPPLQDDGPSSDNY 641
|
|
| TAIR|locus:2087852 PMH2 "putative mitochondrial RNA helicase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2087832 PMH1 "putative mitochondrial RNA helicase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031113-10 ddx21 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 21" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RPT4 DDX50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MMK3 DDX50 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QTT0 DDX50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2182303 Ddx50 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 50" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BQ39 DDX50 "ATP-dependent RNA helicase DDX50" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BW15 DDX50 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 456 | |||
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 4e-42 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 4e-39 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 2e-34 | |
| pfam08152 | 97 | pfam08152, GUCT, GUCT (NUC152) domain | 7e-29 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 2e-27 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 2e-27 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 2e-27 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 2e-26 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 5e-26 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 2e-25 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 4e-24 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 9e-24 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 9e-24 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 2e-19 | |
| cd12938 | 74 | cd12938, GUCT_Hera, RNA-binding GUCT-like domain f | 3e-19 | |
| COG1111 | 542 | COG1111, MPH1, ERCC4-like helicases [DNA replicati | 6e-16 | |
| PRK13766 | 773 | PRK13766, PRK13766, Hef nuclease; Provisional | 3e-15 | |
| COG1061 | 442 | COG1061, SSL2, DNA or RNA helicases of superfamily | 1e-13 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 3e-13 | |
| COG0514 | 590 | COG0514, RecQ, Superfamily II DNA helicase [DNA re | 9e-13 | |
| TIGR01389 | 591 | TIGR01389, recQ, ATP-dependent DNA helicase RecQ | 5e-11 | |
| TIGR00614 | 470 | TIGR00614, recQ_fam, ATP-dependent DNA helicase, R | 9e-10 | |
| cd12937 | 86 | cd12937, GUCT_RH7_like, RNA-binding GUCT domain fo | 5e-09 | |
| COG1201 | 814 | COG1201, Lhr, Lhr-like helicases [General function | 6e-09 | |
| TIGR00631 | 655 | TIGR00631, uvrb, excinuclease ABC, B subunit | 4e-08 | |
| COG0556 | 663 | COG0556, UvrB, Helicase subunit of the DNA excisio | 6e-08 | |
| TIGR00580 | 926 | TIGR00580, mfd, transcription-repair coupling fact | 1e-07 | |
| COG1202 | 830 | COG1202, COG1202, Superfamily II helicase, archaea | 5e-07 | |
| COG1197 | 1139 | COG1197, Mfd, Transcription-repair coupling factor | 5e-07 | |
| TIGR00643 | 630 | TIGR00643, recG, ATP-dependent DNA helicase RecG | 1e-06 | |
| pfam00098 | 18 | pfam00098, zf-CCHC, Zinc knuckle | 2e-06 | |
| TIGR01587 | 358 | TIGR01587, cas3_core, CRISPR-associated helicase C | 3e-06 | |
| smart00343 | 17 | smart00343, ZnF_C2HC, zinc finger | 5e-06 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 5e-06 | |
| COG1200 | 677 | COG1200, RecG, RecG-like helicase [DNA replication | 6e-06 | |
| PRK10689 | 1147 | PRK10689, PRK10689, transcription-repair coupling | 1e-05 | |
| PRK11057 | 607 | PRK11057, PRK11057, ATP-dependent DNA helicase Rec | 1e-05 | |
| PRK09751 | 1490 | PRK09751, PRK09751, putative ATP-dependent helicas | 1e-04 | |
| cd09639 | 353 | cd09639, Cas3_I, CRISPR/Cas system-associated prot | 2e-04 | |
| PRK05580 | 679 | PRK05580, PRK05580, primosome assembly protein Pri | 5e-04 | |
| COG4098 | 441 | COG4098, comFA, Superfamily II DNA/RNA helicase re | 5e-04 | |
| PRK05298 | 652 | PRK05298, PRK05298, excinuclease ABC subunit B; Pr | 7e-04 | |
| PRK10917 | 681 | PRK10917, PRK10917, ATP-dependent DNA helicase Rec | 8e-04 | |
| TIGR03817 | 742 | TIGR03817, DECH_helic, helicase/secretion neighbor | 0.001 | |
| PLN03137 | 1195 | PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 | 0.002 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 0.002 | |
| PRK00254 | 720 | PRK00254, PRK00254, ski2-like helicase; Provisiona | 0.002 | |
| pfam06682 | 317 | pfam06682, DUF1183, Protein of unknown function (D | 0.003 | |
| TIGR04121 | 803 | TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA | 0.003 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Score = 156 bits (395), Expect = 4e-42
Identities = 74/237 (31%), Positives = 115/237 (48%), Gaps = 12/237 (5%)
Query: 16 NQDEKLAEGIKLYAIST-TATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSI 74
+ E+ + IK + + + K +L L+ +G + IVF +TKR +E++ +L
Sbjct: 238 EKLERTLKKIKQFYLEVESEEEKLELLLKLLKDEDEG-RVIVFVRTKRLVEELAESLRKR 296
Query: 75 -IASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPET 133
ALHGD+ Q +R+R L F+ G+ VLVATDVAARGLDIP+V +I+Y+LP DPE
Sbjct: 297 GFKVAALHGDLPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPED 356
Query: 134 FVHRSGRTGRAGKEGTAILMFTSS-QRRTVRSLERDVGCKFE-FVSPPVVEDVLESSAEQ 191
+VHR GRTGRAG++G AI T + + ++ +E+ + K V P+ E +
Sbjct: 357 YVHRIGRTGRAGRKGVAISFVTEEEEVKKLKRIEKRLERKLPSAVLLPLDEPEDAKLLKT 416
Query: 192 VVATLNGVHPESVE-------FFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRS 241
L S E + + LA ++ G +
Sbjct: 417 TRPGLEEESDISDEIKKLKSSKKALLRGLGVRFTLSKLLANLGKEIPGAGDAVTIDP 473
|
Length = 513 |
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|203861 pfam08152, GUCT, GUCT (NUC152) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240595 cd12938, GUCT_Hera, RNA-binding GUCT-like domain found in Thermus thermophilus heat resistant RNA-dependent ATPase (Hera) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >gnl|CDD|240594 cd12937, GUCT_RH7_like, RNA-binding GUCT domain found in plant DEAD-box ATP-dependent RNA helicase 7 (RH7) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233063 TIGR00631, uvrb, excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle | Back alignment and domain information |
|---|
| >gnl|CDD|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >gnl|CDD|197667 smart00343, ZnF_C2HC, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3 | Back alignment and domain information |
|---|
| >gnl|CDD|235514 PRK05580, PRK05580, primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236794 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183) | Back alignment and domain information |
|---|
| >gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 456 | |||
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 100.0 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 99.97 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.97 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.97 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 99.97 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 99.97 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 99.96 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 99.96 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 99.95 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 99.95 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 99.95 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 99.95 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 99.95 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.94 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.94 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.94 | |
| PTZ00110 | 545 | helicase; Provisional | 99.93 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.93 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 99.92 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.92 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 99.92 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.92 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 99.91 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 99.91 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.91 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.91 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 99.9 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.89 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 99.89 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.89 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 99.88 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 99.88 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.87 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.87 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 99.86 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 99.86 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 99.86 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.86 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 99.85 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.85 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.85 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.85 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.81 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.8 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.8 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.8 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 99.79 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.79 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.79 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 99.78 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 99.77 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.77 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.76 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.75 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.75 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 99.74 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.74 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.73 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.73 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.73 | |
| KOG0349 | 725 | consensus Putative DEAD-box RNA helicase DDX1 [RNA | 99.73 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.73 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.72 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.7 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.69 | |
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 99.68 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 99.67 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.67 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.67 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 99.66 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.64 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.64 | |
| KOG0351 | 941 | consensus ATP-dependent DNA helicase [Replication, | 99.63 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.62 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.61 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.6 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.59 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.58 | |
| KOG0352 | 641 | consensus ATP-dependent DNA helicase [Replication, | 99.54 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 99.53 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.53 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.48 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 99.48 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 99.47 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 99.46 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.39 | |
| PF08152 | 97 | GUCT: GUCT (NUC152) domain; InterPro: IPR012562 Th | 99.38 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 99.38 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.38 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 99.36 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.36 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.36 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 99.35 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.35 | |
| KOG0353 | 695 | consensus ATP-dependent DNA helicase [General func | 99.3 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.3 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 99.28 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.27 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.25 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 99.25 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.24 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.21 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.2 | |
| KOG0920 | 924 | consensus ATP-dependent RNA helicase A [RNA proces | 99.16 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 99.12 | |
| KOG0950 | 1008 | consensus DNA polymerase theta/eta, DEAD-box super | 99.1 | |
| KOG0947 | 1248 | consensus Cytoplasmic exosomal RNA helicase SKI2, | 99.03 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.03 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 98.99 | |
| KOG4150 | 1034 | consensus Predicted ATP-dependent RNA helicase [RN | 98.98 | |
| KOG0953 | 700 | consensus Mitochondrial RNA helicase SUV3, DEAD-bo | 98.89 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 98.89 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.89 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 98.87 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 98.79 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 98.78 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 98.77 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 98.74 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 98.73 | |
| KOG0384 | 1373 | consensus Chromodomain-helicase DNA-binding protei | 98.71 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 98.67 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 98.63 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 98.61 | |
| PF03880 | 74 | DbpA: DbpA RNA binding domain ; InterPro: IPR00558 | 98.6 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 98.56 | |
| PF00098 | 18 | zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi | 98.53 | |
| KOG0392 | 1549 | consensus SNF2 family DNA-dependent ATPase domain- | 98.48 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 98.47 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 98.43 | |
| KOG0391 | 1958 | consensus SNF2 family DNA-dependent ATPase [Genera | 98.43 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.4 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 98.36 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 98.25 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 98.24 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 98.16 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 98.16 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 98.15 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 98.15 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 98.09 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 98.09 | |
| KOG0388 | 1185 | consensus SNF2 family DNA-dependent ATPase [Replic | 98.07 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 98.06 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.03 | |
| KOG0949 | 1330 | consensus Predicted helicase, DEAD-box superfamily | 98.03 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 98.01 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 97.98 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.93 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.89 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 97.88 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 97.83 | |
| KOG1000 | 689 | consensus Chromatin remodeling protein HARP/SMARCA | 97.78 | |
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 97.78 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 97.49 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 97.38 | |
| KOG1015 | 1567 | consensus Transcription regulator XNP/ATRX, DEAD-b | 97.31 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 97.29 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 97.26 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 97.25 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.19 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 97.18 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 97.17 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 97.12 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.06 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 97.0 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 96.97 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 96.96 | |
| PF13871 | 278 | Helicase_C_4: Helicase_C-like | 96.84 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 96.84 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 96.76 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.71 | |
| PTZ00110 | 545 | helicase; Provisional | 96.66 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 96.65 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 96.64 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 96.61 | |
| KOG4439 | 901 | consensus RNA polymerase II transcription terminat | 96.6 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 96.55 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 96.5 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 96.29 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 96.26 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 96.05 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 96.01 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 96.0 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 96.0 | |
| PF13696 | 32 | zf-CCHC_2: Zinc knuckle | 95.93 | |
| smart00343 | 26 | ZnF_C2HC zinc finger. | 95.72 | |
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 95.63 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 95.45 | |
| PF13917 | 42 | zf-CCHC_3: Zinc knuckle | 95.29 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 95.28 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 95.25 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 95.16 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 95.13 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 94.99 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 94.98 | |
| KOG3973 | 465 | consensus Uncharacterized conserved glycine-rich p | 94.97 | |
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 94.8 | |
| smart00492 | 141 | HELICc3 helicase superfamily c-terminal domain. | 94.78 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 94.77 | |
| smart00491 | 142 | HELICc2 helicase superfamily c-terminal domain. | 94.58 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 94.55 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 94.47 | |
| KOG0701 | 1606 | consensus dsRNA-specific nuclease Dicer and relate | 94.31 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 94.28 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 94.16 | |
| KOG1016 | 1387 | consensus Predicted DNA helicase, DEAD-box superfa | 93.6 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 93.57 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 93.49 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 93.37 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 93.26 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 93.17 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 92.93 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 92.03 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 91.73 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 91.61 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 91.58 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 91.41 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 91.27 | |
| PF14787 | 36 | zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: | 91.24 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 91.16 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 91.04 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 90.78 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 90.77 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 90.73 | |
| PF15288 | 40 | zf-CCHC_6: Zinc knuckle | 90.46 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 90.37 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 89.92 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 89.27 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 89.08 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 88.34 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 87.21 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 87.03 | |
| KOG4400 | 261 | consensus E3 ubiquitin ligase interacting with arg | 87.02 | |
| PF14392 | 49 | zf-CCHC_4: Zinc knuckle | 86.42 | |
| KOG2340 | 698 | consensus Uncharacterized conserved protein [Funct | 85.74 | |
| PF10593 | 239 | Z1: Z1 domain; InterPro: IPR018310 This entry repr | 85.7 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 85.08 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 84.61 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 84.35 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 83.29 | |
| PF12683 | 275 | DUF3798: Protein of unknown function (DUF3798); In | 82.41 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 82.3 |
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4e-44 Score=384.56 Aligned_cols=304 Identities=26% Similarity=0.395 Sum_probs=257.6
Q ss_pred ccccCCCccccCCcccccccCeeEEEEEcCcccHHHHHHHHHHHHCCCCcEEEEcCChHHHHHHHHHHHh-cCCEEEEeC
Q 012794 4 YFVMFSHSTQVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTS-IIASEALHG 82 (456)
Q Consensus 4 ~l~~~~~i~~v~~~~~~~~~~i~~~~~~~~~~~k~~~L~~ll~~~~~~~~~IIF~~t~~~a~~l~~~L~~-~~~~~~lhg 82 (456)
|++++..|.+. ........+.+.|+.+....|.+.|..+|... ...++||||+|+..+++|++.|.. ++.+..+||
T Consensus 201 ~l~~~~~i~i~--~~~~~~~~i~q~~~~v~~~~k~~~L~~~L~~~-~~~~~IVF~~tk~~a~~l~~~L~~~g~~~~~lhg 277 (629)
T PRK11634 201 FMKEPQEVRIQ--SSVTTRPDISQSYWTVWGMRKNEALVRFLEAE-DFDAAIIFVRTKNATLEVAEALERNGYNSAALNG 277 (629)
T ss_pred HcCCCeEEEcc--CccccCCceEEEEEEechhhHHHHHHHHHHhc-CCCCEEEEeccHHHHHHHHHHHHhCCCCEEEeeC
Confidence 44445444433 22344567888888888888999999988765 347899999999999999999985 789999999
Q ss_pred CCCHHHHHHHHhcccCCCeEEEEeccccccccCcCccceEEecCCCCChhHHHHHhcccccCCCCceEEEeeChhhHHHH
Q 012794 83 DISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTV 162 (456)
Q Consensus 83 ~~~~~~R~~~l~~Fr~g~~~vLVaTdv~~~Gidip~v~~VI~~~~p~~~~~y~qr~GR~gR~g~~g~~i~~~~~~e~~~~ 162 (456)
+|++.+|++++++|++++++||||||++++|||+|+|++|||||+|.++++|+||+|||||+|+.|.+++|+.+.+...+
T Consensus 278 d~~q~~R~~il~~Fr~G~~~ILVATdv~arGIDip~V~~VI~~d~P~~~e~yvqRiGRtGRaGr~G~ai~~v~~~e~~~l 357 (629)
T PRK11634 278 DMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLL 357 (629)
T ss_pred CCCHHHHHHHHHHHhCCCCCEEEEcchHhcCCCcccCCEEEEeCCCCCHHHHHHHhccccCCCCcceEEEEechHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhCCCceecCCCCHHHHHHHHHHHHHHHHhcC-CcchhhhhHHHHHHHHhh-----cCHHHHHHHHHHHhCCCCC
Q 012794 163 RSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGV-HPESVEFFTPTAQRLIEE-----KGTDALAAALAQLSGFSRP 236 (456)
Q Consensus 163 ~~ie~~~~~~~~~~~~p~~~~i~~~~~~~~~~~l~~~-~~~~~~~~~~~~~~ll~~-----~~~~~~a~ala~~~~~~~~ 236 (456)
+.|++.++..++.+.+|..+++.+.....+...+... ..+.++.|.+++++|++. .+++.+|++|+.+..-..+
T Consensus 358 ~~ie~~~~~~i~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~a~a~~~~~~~~~~ 437 (629)
T PRK11634 358 RNIERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLESSDLDQYRALLAKIQPTAEGEELDLETLAAALLKMAQGERP 437 (629)
T ss_pred HHHHHHhCCCcceecCCcHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhhhccccCCHHHHHHHHHHHHcCCCc
Confidence 9999999999999999999999888888887776543 335577888888888864 6789999999988642211
Q ss_pred ------C-----C---Ccc-----------------cc--C---CCCceEEEEEeecCccccCCCChhHHHHHHHhhCCC
Q 012794 237 ------P-----S---SRS-----------------LI--N---HEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPT 280 (456)
Q Consensus 237 ------~-----~---~r~-----------------l~--~---~~~g~~t~~~~~~~~~~~~~~~~~~i~~~l~~~~~~ 280 (456)
+ . .+. .. . ...+|++++|+.|+ ++++.|++|+++|++..++
T Consensus 438 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~---~~~~~~~~~~~~i~~~~~~ 514 (629)
T PRK11634 438 LILPPDAPMRPKREFRDRDDRGPRDRNDRGPRGDREDRPRRERRDVGDMQLYRIEVGR---DDGVEVRHIVGAIANEGDI 514 (629)
T ss_pred cccccccccccccccccccccccccccccccccccccccccccccCCCCEEEEEeccc---ccCCCHHHHHHHHHhhcCC
Confidence 0 0 000 00 0 12269999999999 8999999999999999999
Q ss_pred CCCccccEEEeecCccceeeeecCHHHHHHHHhhcCC
Q 012794 281 AADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIP 317 (456)
Q Consensus 281 ~~~~ig~i~~~~~~~~~~~~~dv~~~~a~~~~~~~~~ 317 (456)
...+||+|+|+++| |+||||+++++++++....
T Consensus 515 ~~~~ig~i~i~~~~----s~v~~~~~~~~~~~~~~~~ 547 (629)
T PRK11634 515 SSRYIGNIKLFASH----STIELPKGMPGEVLQHFTR 547 (629)
T ss_pred ChhhCCcEEEeCCc----eEEEcChhhHHHHHHHhcc
Confidence 99999999999999 7999999999999987543
|
|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PF08152 GUCT: GUCT (NUC152) domain; InterPro: IPR012562 This is the C-terminal domain found in the RNA helicase II / Gu protein family [] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13871 Helicase_C_4: Helicase_C-like | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PF13696 zf-CCHC_2: Zinc knuckle | Back alignment and domain information |
|---|
| >smart00343 ZnF_C2HC zinc finger | Back alignment and domain information |
|---|
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PF13917 zf-CCHC_3: Zinc knuckle | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >smart00492 HELICc3 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >smart00491 HELICc2 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF15288 zf-CCHC_6: Zinc knuckle | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14392 zf-CCHC_4: Zinc knuckle | Back alignment and domain information |
|---|
| >KOG2340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 456 | ||||
| 3i32_A | 300 | Dimeric Structure Of A Hera Helicase Fragment Inclu | 4e-38 | ||
| 3eaq_A | 212 | Novel Dimerization Motif In The Dead Box Rna Helica | 4e-34 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 4e-26 | ||
| 2jgn_A | 185 | Ddx3 Helicase Domain Length = 185 | 8e-24 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 1e-23 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 8e-23 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 8e-23 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 2e-22 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 2e-22 | ||
| 2hjv_A | 163 | Structure Of The Second Domain (Residues 207-368) O | 2e-22 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 2e-22 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 2e-22 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 4e-21 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 3e-20 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 5e-20 | ||
| 2kbf_A | 187 | Solution Structure Of Carboxyl-Terminal Domain Of D | 1e-19 | ||
| 3peu_A | 188 | S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To | 3e-19 | ||
| 3gfp_A | 189 | Structure Of The C-Terminal Domain Of The Dead-Box | 5e-19 | ||
| 2z0m_A | 337 | Crystal Structure Of Hypothetical Atp-Dependent Rna | 5e-18 | ||
| 2p6n_A | 191 | Human Dead-box Rna Helicase Ddx41, Helicase Domain | 3e-17 | ||
| 3fho_B | 508 | Structure Of S. Pombe Dbp5 Length = 508 | 6e-17 | ||
| 2yjt_D | 170 | Crystal Structure Of E. Coli Dead-Box Protein Srmb | 1e-15 | ||
| 2wax_A | 193 | Structure Of The Human Ddx6 C-Terminal Domain In Co | 1e-15 | ||
| 2rb4_A | 175 | Crystal Structure Of The Helicase Domain Of Human D | 3e-15 | ||
| 4db4_A | 256 | Mss116p Dead-Box Helicase Domain 2 Bound To A Chima | 4e-15 | ||
| 4db2_C | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 4e-15 | ||
| 4db2_A | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 4e-15 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 5e-15 | ||
| 3sqx_A | 512 | Structure Of Mss116p (Nte And C-Tail Double Deletio | 5e-15 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 5e-15 | ||
| 3i5x_A | 563 | Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len | 6e-15 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 6e-15 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 7e-15 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 1e-14 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 1e-14 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 1e-14 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 1e-14 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 2e-13 | ||
| 1fuk_A | 165 | Crystal Structure Of The Carboxy Terminal Domain Of | 7e-13 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 9e-13 | ||
| 1xtj_A | 386 | Structure Of Human Uap56 In Complex With Adp Length | 5e-12 | ||
| 1xti_A | 391 | Structure Of Wildtype Human Uap56 Length = 391 | 5e-12 | ||
| 1xtk_A | 390 | Structure Of Decd To Dead Mutation Of Human Uap56 L | 5e-12 | ||
| 1t5i_A | 172 | Crystal Structure Of The C-Terminal Domain Of Uap56 | 7e-12 | ||
| 1wp9_A | 494 | Crystal Structure Of Pyrococcus Furiosus Hef Helica | 5e-09 | ||
| 2v1x_A | 591 | Crystal Structure Of Human Recq-Like Dna Helicase L | 3e-08 | ||
| 1oyy_A | 523 | Structure Of The Recq Catalytic Core Bound To Atp-G | 4e-08 | ||
| 1oyw_A | 523 | Structure Of The Recq Catalytic Core Length = 523 | 8e-08 | ||
| 1gm5_A | 780 | Structure Of Recg Bound To Three-Way Dna Junction L | 1e-06 | ||
| 4gl2_A | 699 | Structural Basis For Dsrna Duplex Backbone Recognit | 5e-06 | ||
| 2eyq_A | 1151 | Crystal Structure Of Escherichia Coli Transcription | 6e-06 | ||
| 2fwr_A | 472 | Structure Of Archaeoglobus Fulgidis Xpb Length = 47 | 8e-06 | ||
| 2fzl_A | 219 | Structure Of C-Terminal Domain Of Archaeoglobus Ful | 1e-05 | ||
| 3v4r_A | 667 | Crystal Structure Of A Uvrb Dimer-Dna Complex Lengt | 5e-05 | ||
| 2d7d_A | 661 | Structural Insights Into The Cryptic Dna Dependent | 5e-05 | ||
| 1d9z_A | 657 | Crystal Structure Of The Dna Repair Protein Uvrb In | 8e-05 | ||
| 1d9x_A | 658 | Crystal Structure Of The Dna Repair Protein Uvrb Le | 8e-05 | ||
| 2fdc_A | 658 | Structural Basis Of Dna Damage Recognition And Proc | 8e-05 | ||
| 1t5l_A | 658 | Crystal Structure Of The Dna Repair Protein Uvrb Po | 8e-05 | ||
| 3uwx_B | 683 | Crystal Structure Of Uvra-Uvrb Complex Length = 683 | 9e-05 | ||
| 1d2m_A | 665 | Uvrb Protein Of Thermus Thermophilus Hb8; A Nucleot | 3e-04 | ||
| 1c4o_A | 664 | Crystal Structure Of The Dna Nucleotide Excision Re | 3e-04 | ||
| 4i1s_A | 243 | Melanoma Differentiation Associated Protein-5 Helic | 3e-04 | ||
| 2p6r_A | 702 | Crystal Structure Of Superfamily 2 Helicase Hel308 | 6e-04 |
| >pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 | Back alignment and structure |
|
| >pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 | Back alignment and structure |
| >pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 | Back alignment and structure |
| >pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 | Back alignment and structure |
| >pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 | Back alignment and structure |
| >pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 | Back alignment and structure |
| >pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 | Back alignment and structure |
| >pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 | Back alignment and structure |
| >pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 | Back alignment and structure |
| >pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 | Back alignment and structure |
| >pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 | Back alignment and structure |
| >pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 | Back alignment and structure |
| >pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 | Back alignment and structure |
| >pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 | Back alignment and structure |
| >pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 | Back alignment and structure |
| >pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 | Back alignment and structure |
| >pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 | Back alignment and structure |
| >pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 | Back alignment and structure |
| >pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780 | Back alignment and structure |
| >pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 | Back alignment and structure |
| >pdb|2EYQ|A Chain A, Crystal Structure Of Escherichia Coli Transcription-Repair Coupling Factor Length = 1151 | Back alignment and structure |
| >pdb|2FWR|A Chain A, Structure Of Archaeoglobus Fulgidis Xpb Length = 472 | Back alignment and structure |
| >pdb|2FZL|A Chain A, Structure Of C-Terminal Domain Of Archaeoglobus Fulgidus Xpb Length = 219 | Back alignment and structure |
| >pdb|3V4R|A Chain A, Crystal Structure Of A Uvrb Dimer-Dna Complex Length = 667 | Back alignment and structure |
| >pdb|2D7D|A Chain A, Structural Insights Into The Cryptic Dna Dependent Atp-Ase Activity Of Uvrb Length = 661 | Back alignment and structure |
| >pdb|1D9Z|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb In Complex With Atp Length = 657 | Back alignment and structure |
| >pdb|1D9X|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Length = 658 | Back alignment and structure |
| >pdb|2FDC|A Chain A, Structural Basis Of Dna Damage Recognition And Processing By Uvrb: Crystal Structure Of A UvrbDNA COMPLEX Length = 658 | Back alignment and structure |
| >pdb|1T5L|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Point Mutant Y96a Revealing A Novel Fold For Domain 2 Length = 658 | Back alignment and structure |
| >pdb|3UWX|B Chain B, Crystal Structure Of Uvra-Uvrb Complex Length = 683 | Back alignment and structure |
| >pdb|1D2M|A Chain A, Uvrb Protein Of Thermus Thermophilus Hb8; A Nucleotide Excision Repair Enzyme Length = 665 | Back alignment and structure |
| >pdb|1C4O|A Chain A, Crystal Structure Of The Dna Nucleotide Excision Repair Enzyme Uvrb From Thermus Thermophilus Length = 664 | Back alignment and structure |
| >pdb|4I1S|A Chain A, Melanoma Differentiation Associated Protein-5 Helicase Domain Complex With Inhibitor Non-structural Protein V Length = 243 | Back alignment and structure |
| >pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 456 | |||
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 100.0 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 100.0 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 99.97 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 99.97 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 99.96 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 99.96 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 99.96 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 99.96 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 99.9 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.92 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.92 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.92 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.92 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.91 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.91 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.91 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.91 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.9 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.9 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.9 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.87 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.87 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.86 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.86 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.85 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.84 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.84 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.84 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.83 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.83 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.82 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.82 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.81 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.81 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 99.8 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.8 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.79 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 99.79 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.79 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 99.78 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.77 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.77 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.77 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.77 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.77 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.76 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.76 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.74 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.74 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.74 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.74 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.74 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.72 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.72 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.71 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.7 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.69 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.68 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.68 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.68 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.66 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.66 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.65 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.63 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.62 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.6 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.59 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.57 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.54 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.27 | |
| 2e29_A | 92 | ATP-dependent RNA helicase DDX50; ATP binding, hyd | 99.06 | |
| 1dsq_A | 26 | Nucleic acid binding protein P14; CCHC type zinc f | 98.34 | |
| 2g0c_A | 76 | ATP-dependent RNA helicase DBPA; RNA recognition m | 98.27 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 98.25 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.05 | |
| 1nc8_A | 29 | Nucleocapsid protein; HIV-2, RNA recognition, zinc | 97.98 | |
| 1a6b_B | 40 | Momulv, zinc finger protein NCP10; nucleocapsid pr | 97.92 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 97.8 | |
| 3i31_A | 88 | Heat resistant RNA dependent ATPase; RNA helicase, | 97.79 | |
| 1u6p_A | 56 | GAG polyprotein; MLV, A-minor K-turn, stem loop, b | 97.61 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 97.53 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 97.45 | |
| 2ysa_A | 55 | Retinoblastoma-binding protein 6; zinc finger, CCH | 97.44 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 97.42 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 97.41 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 97.41 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 97.38 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 97.38 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 97.34 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 97.27 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 97.19 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 97.17 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 97.1 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 97.05 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 97.01 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 96.99 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 96.97 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 96.91 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 96.75 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 96.69 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 96.06 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 96.05 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 96.03 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 95.63 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 95.44 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 95.08 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 94.5 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 94.27 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 94.19 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 94.1 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 94.03 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 93.33 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 92.86 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 92.86 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 92.66 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 92.61 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 92.55 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 92.36 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 92.28 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 92.03 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 91.37 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 91.35 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 91.14 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 89.49 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 89.04 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 88.82 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 88.11 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 87.87 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 87.62 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 87.36 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 86.44 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 86.28 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 85.17 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 84.84 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 84.81 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 84.59 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 84.39 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 81.15 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 80.75 |
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-46 Score=365.92 Aligned_cols=289 Identities=38% Similarity=0.587 Sum_probs=253.6
Q ss_pred CeeEEEEEcCcccHHHHHHHHHHHHCCCCcEEEEcCChHHHHHHHHHHHh-cCCEEEEeCCCCHHHHHHHHhcccCCCeE
Q 012794 24 GIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTS-IIASEALHGDISQHQRERTLNGFRQGKFT 102 (456)
Q Consensus 24 ~i~~~~~~~~~~~k~~~L~~ll~~~~~~~~~IIF~~t~~~a~~l~~~L~~-~~~~~~lhg~~~~~~R~~~l~~Fr~g~~~ 102 (456)
+++|+++.++..+|+++|.+++..+. ..++||||+|+++++.|+..|.. ++.+.+|||+|++.+|+.+++.|++|+++
T Consensus 2 ~v~~~~i~~~~~~K~~~L~~ll~~~~-~~~~LVF~~t~~~~~~l~~~L~~~g~~~~~lhg~l~~~~r~~~~~~f~~g~~~ 80 (300)
T 3i32_A 2 TYEEEAVPAPVRGRLEVLSDLLYVAS-PDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDMSQGERERVMGAFRQGEVR 80 (300)
T ss_dssp CSEEEEEECCSSSHHHHHHHHHHHHC-CSSEEEECSSHHHHHHHHHHHHTTTCCEEEECSCCCTHHHHHHHHHHHHTSCC
T ss_pred ceEEEEEECCHHHHHHHHHHHHHhcC-CCCEEEEECCHHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHhhcCCce
Confidence 57899999999999999999998875 68999999999999999999985 78999999999999999999999999999
Q ss_pred EEEeccccccccCcCccceEEecCCCCChhHHHHHhcccccCCCCceEEEeeChhhHHHHHHHHHHhCCCceecCCCCHH
Q 012794 103 VLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVE 182 (456)
Q Consensus 103 vLVaTdv~~~Gidip~v~~VI~~~~p~~~~~y~qr~GR~gR~g~~g~~i~~~~~~e~~~~~~ie~~~~~~~~~~~~p~~~ 182 (456)
|||||+++++|||+|++++||+|++|++.++|+||+|||||+|+.|.|++|+++.+...++.+++.++..++.+.+|+.+
T Consensus 81 vLVaT~va~~Gidi~~v~~VI~~d~p~s~~~y~Qr~GRagR~g~~G~~i~l~~~~e~~~~~~ie~~~~~~~~~~~~~~~~ 160 (300)
T 3i32_A 81 VLVATDVAARGLDIPQVDLVVHYRMPDRAEAYQHRSGRTGRAGRGGRVVLLYGPRERRDVEALERAVGRRFKRVNPPTPE 160 (300)
T ss_dssp EEEECSTTTCSTTCCCCSEEEESSCCSSTTHHHHHHTCCC-----CEEEEEECSSTHHHHHHHHHHHTCCCEECCCCCHH
T ss_pred EEEEechhhcCccccceeEEEEcCCCCCHHHHHHHccCcCcCCCCceEEEEeChHHHHHHHHHHHHhCCcceEeCCCCHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhcCCcchhhhhHHHHHHHHhhcCHHHHHHHHHHHhCCCCCCCCccccCCCCceEEEEEeecCcccc
Q 012794 183 DVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSR 262 (456)
Q Consensus 183 ~i~~~~~~~~~~~l~~~~~~~~~~~~~~~~~ll~~~~~~~~a~ala~~~~~~~~~~~r~l~~~~~g~~t~~~~~~~~~~~ 262 (456)
++.+..+..++..+..+.....+.|.+++++++++..++.+++||+.+++... ..+++++..++|+|++++.++ .
T Consensus 161 ei~~~~~~~~~~~l~~~~~~~~~~f~~~~~~l~~~~~~e~laaal~~l~~~~~--~~~~l~~~~~~~~~~~~~~g~---~ 235 (300)
T 3i32_A 161 EVLEAKWRHLLARLARVPEKDYRLYQDFAGRLFAEGRVEVVAALLALLLGGAP--AERSLLTGEEGWRTYKATGPR---L 235 (300)
T ss_dssp HHHHHHHHHHHHHHTTSCHHHHHTTHHHHHHHHHHTCHHHHHHHHHHHHTCCC--CCBCTTTCCBSCBCEEEECTT---C
T ss_pred HHHHHHHHHHHHHHHhcchhhHHHHHHHHHHHHhcCcHHHHHHHHHHHhcCCc--CccccccCCCCcEEEEEecCC---C
Confidence 99999999999999888888899999999999999999999999999998776 678898889999999999987 3
Q ss_pred CCCChhHHHHHHHhhCCCCCCccccEEEeecCccceeeeecCHHHHHHHHhhcCCCCCceeecccCCCccCCC
Q 012794 263 GFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPALQDDG 335 (456)
Q Consensus 263 ~~~~~~~i~~~l~~~~~~~~~~ig~i~~~~~~~~~~~~~dv~~~~a~~~~~~~~~~g~~l~~~t~LP~l~~~~ 335 (456)
.. |++|+ .|... +. +||.|+|.+++ +|||||++.++ ..++++++++++||+|+..+
T Consensus 236 ~~--~~~~~-~i~~~-~~---~ig~i~~~~~~----~~~dvp~~~~~------~~~~~~~~~~~~~p~~~~~~ 291 (300)
T 3i32_A 236 SL--PRLVA-LLKGQ-GL---EVGKVAEAEGG----FYVDLRPEARP------EVAGLRLEPARRVEGLLEIP 291 (300)
T ss_dssp CH--HHHHH-HHHHT-TC---CCCCEEEETTE----EEECBCSSCCC------CCTTCEEEEC----------
T ss_pred CC--cHHHH-HHHhc-CC---eECcEEEeCCE----EEEEeCHHHcC------cCCCcEEEecccCCCCccCC
Confidence 33 99997 55553 33 99999997775 89999999987 34689999999999999875
|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2e29_A ATP-dependent RNA helicase DDX50; ATP binding, hydrolase, nuclear protein, nucleotide-binding, RNA-binding, GUCT domain, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.5 | Back alignment and structure |
|---|
| >1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A | Back alignment and structure |
|---|
| >1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >3i31_A Heat resistant RNA dependent ATPase; RNA helicase, RNA recognition motif, ATP-binding, helicase, nucleotide-binding; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 456 | ||||
| d1a1va2 | 299 | c.37.1.14 (A:326-624) HCV helicase domain {Human h | 6e-34 | |
| d1gkub2 | 248 | c.37.1.16 (B:251-498) Helicase-like "domain" of re | 1e-29 | |
| d1fuka_ | 162 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 4e-26 | |
| d1wp9a2 | 286 | c.37.1.19 (A:201-486) putative ATP-dependent RNA h | 5e-25 | |
| d2j0sa2 | 168 | c.37.1.19 (A:244-411) Probable ATP-dependent RNA h | 1e-24 | |
| d1hv8a2 | 155 | c.37.1.19 (A:211-365) Putative DEAD box RNA helica | 2e-24 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 1e-22 | |
| d2rb4a1 | 168 | c.37.1.19 (A:307-474) ATP-dependent RNA helicase D | 1e-19 | |
| d1jr6a_ | 138 | c.37.1.14 (A:) HCV helicase domain {Human hepatiti | 2e-18 | |
| d1t5la2 | 181 | c.37.1.19 (A:415-595) Nucleotide excision repair e | 2e-16 | |
| d1s2ma2 | 171 | c.37.1.19 (A:252-422) Putative ATP-dependent RNA h | 2e-16 | |
| d2p6ra4 | 201 | c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob | 5e-16 | |
| d1c4oa2 | 174 | c.37.1.19 (A:410-583) Nucleotide excision repair e | 3e-15 | |
| d1oywa3 | 200 | c.37.1.19 (A:207-406) RecQ helicase domain {Escher | 1e-14 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 1e-14 | |
| d1t5ia_ | 168 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 5e-14 | |
| d2eyqa5 | 211 | c.37.1.19 (A:779-989) Transcription-repair couplin | 4e-12 | |
| d1gm5a4 | 206 | c.37.1.19 (A:550-755) RecG helicase domain {Thermo | 1e-07 | |
| d1yksa2 | 299 | c.37.1.14 (A:325-623) YFV helicase domain {Yellow | 3e-06 | |
| d2exfa1 | 42 | g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod | 1e-05 | |
| d2exfa1 | 42 | g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod | 0.002 | |
| d2e29a1 | 85 | d.58.7.5 (A:8-92) ATP-dependent RNA helicase DDX50 | 2e-04 |
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: HCV helicase domain species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]
Score = 126 bits (319), Expect = 6e-34
Identities = 37/180 (20%), Positives = 62/180 (34%), Gaps = 21/180 (11%)
Query: 25 IKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSI-IASEALHGD 83
I+ A+STT + KGG+ ++F +K+ DE++ L ++ I + A +
Sbjct: 11 IEEVALSTTG-EIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRG 69
Query: 84 ISQHQR----------ERTLNGFRQGKFTVLVATDVAARG---LDIPNVDLIIHYELPND 130
+ L G F ++ + + I LP D
Sbjct: 70 LDVSVIPTSGDVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQD 129
Query: 131 PETFVHRSGRTGRAGKEGTAILMFTSSQRR-TVRSLE----RDVGCKFEFVSPPVVEDVL 185
+ R GRTGR GK G + + S D GC + ++P L
Sbjct: 130 AVSRTQRRGRTGR-GKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRL 188
|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 211 | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 | Back information, alignment and structure |
|---|
| >d2e29a1 d.58.7.5 (A:8-92) ATP-dependent RNA helicase DDX50 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 456 | |||
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 100.0 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 100.0 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 100.0 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 99.98 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.98 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.97 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.96 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 99.93 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 99.93 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.89 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.84 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.82 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.81 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.78 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.76 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.76 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 99.72 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.5 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.46 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.45 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.4 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 99.22 | |
| d2e29a1 | 85 | ATP-dependent RNA helicase DDX50 {Human (Homo sapi | 98.73 | |
| d1nkta4 | 219 | Translocation ATPase SecA, nucleotide-binding doma | 98.65 | |
| d1nc8a_ | 29 | HIV nucleocapsid {Human immunodeficiency virus typ | 97.79 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 97.58 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 97.2 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 97.12 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.97 | |
| d1dsqa_ | 26 | Nucleic acid binding protein p14 {Mouse mammary tu | 96.44 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 94.99 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 94.41 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 94.32 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 92.51 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 91.41 | |
| d1a6bb_ | 40 | Zinc finger protein ncp10 {Moloney murine leukemia | 90.7 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 90.03 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 89.6 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 89.4 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 89.19 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 84.54 |
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Probable ATP-dependent RNA helicase DDX48 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=6.2e-33 Score=248.17 Aligned_cols=159 Identities=35% Similarity=0.593 Sum_probs=148.9
Q ss_pred cccccCeeEEEEEcCcc-cHHHHHHHHHHHHCCCCcEEEEcCChHHHHHHHHHHHh-cCCEEEEeCCCCHHHHHHHHhcc
Q 012794 19 EKLAEGIKLYAISTTAT-SKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTS-IIASEALHGDISQHQRERTLNGF 96 (456)
Q Consensus 19 ~~~~~~i~~~~~~~~~~-~k~~~L~~ll~~~~~~~~~IIF~~t~~~a~~l~~~L~~-~~~~~~lhg~~~~~~R~~~l~~F 96 (456)
+.+.++|+|+|+.++.. .|+++|.++++.+. ..++||||+|+..|+.++..|.. ++.+..+||+|++.+|..+++.|
T Consensus 2 ~~tl~~i~q~~v~v~~~~~K~~~L~~ll~~~~-~~k~iiF~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~r~~~~~~f 80 (168)
T d2j0sa2 2 ELTLEGIKQFFVAVEREEWKFDTLCDLYDTLT-ITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEF 80 (168)
T ss_dssp GCSCTTEEEEEEEESSTTHHHHHHHHHHHHHT-SSEEEEECSSHHHHHHHHHHHHHTTCCCEEECTTSCHHHHHHHHHHH
T ss_pred CCCCCCcEEEEEEecChHHHHHHHHHHHHhCC-CCceEEEeeeHHHHHHHHHHhhhcccchhhhhhhhhHHHHHHHHHHH
Confidence 46778999999998875 59999999998774 57999999999999999999985 78999999999999999999999
Q ss_pred cCCCeEEEEeccccccccCcCccceEEecCCCCChhHHHHHhcccccCCCCceEEEeeChhhHHHHHHHHHHhCCCceec
Q 012794 97 RQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFV 176 (456)
Q Consensus 97 r~g~~~vLVaTdv~~~Gidip~v~~VI~~~~p~~~~~y~qr~GR~gR~g~~g~~i~~~~~~e~~~~~~ie~~~~~~~~~~ 176 (456)
++++++||||||+++||||+|++++|||||+|++++.|+||+|||||.|+.|.+++|+.+.+...++.|++.++..++.+
T Consensus 81 k~g~~~iLv~Td~~~rGiDi~~v~~VIn~d~P~~~~~yihR~GR~gR~g~~G~~i~~~~~~d~~~~~~i~~~~~~~i~e~ 160 (168)
T d2j0sa2 81 RSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEM 160 (168)
T ss_dssp HHTSSCEEEECGGGSSSCCCTTEEEEEESSCCSSHHHHHHHHTTSSGGGCCEEEEEEEEGGGHHHHHHHHHHTTCCCEEC
T ss_pred hcCCccEEeccchhcccccccCcceEEEecCCcCHHHHHhhhccccccCCCcEEEEEECHHHHHHHHHHHHHHcCcCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999888776
Q ss_pred CC
Q 012794 177 SP 178 (456)
Q Consensus 177 ~~ 178 (456)
+.
T Consensus 161 p~ 162 (168)
T d2j0sa2 161 PM 162 (168)
T ss_dssp CS
T ss_pred Cc
Confidence 54
|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2e29a1 d.58.7.5 (A:8-92) ATP-dependent RNA helicase DDX50 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|