Citrus Sinensis ID: 012940

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450---
MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA
ccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccHHHHHHcccccccccccccccccccEEEEEEccccHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccccccccccEEEEccccEEEccEEEEEEEcccccccccccccccEEEEcccccccHHHHHHHHHccccEEEEEcccccccccEEEEEEcccccccccccEEEcccHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHcccccccccEEEEEEcccccEEEEEEEEEccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccccccEEcccccEEEcccEEEEEEEEcccHHHHHHHHHHHHHHHHccccccccccccHHHHHHcccccccccccccc
ccHHHHHccccccccccccccccccccHHHHcccEEEEEccccccccccccccccccccccHHHHHHHcccccccccccccccEEEEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHcccccccccccEEEEEccEEEEccEEEEEEccccHHHccHHHHcccEEEEcccccccHHHHHHHHccccccEEEEccccEcccccccccccccccccccccEEEcccHHHHHHHHHHHHHHHHccEEEEEEEEEEEcccccEcccccccccccccEHHHccEEEEccccHHHHHccHHHcccEEEEEEEEcccccEEEEEEEEEcccccHHHHHHHHHHHHHHcccEccEEEEcccccHHHHccccccEEEEHHHcEEEcccEEEEEEEEcccHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccccccEEEcc
mashsalapsripaitripsktthsfptqcstkrLDVAEFAGlranagatyatgardasffDAVTAqltpkvaagsvpvkKETVAKLKVAINGFGrigrnflrcwhgrkdspldVVVVNdsggvknashLLKYDSLlgtfkadvkivdnetisvdgklikvvsnrdplqlpwaelgIDIViegtgvfvdgpgagkhiQAGAKKVIItapakgadiptyvvgvnekdydhevANIVsnascttnclapfVKVMDEELGIVKGamttthsytgdqrlLDASHRDLRRARAAALnivptstgaaKAVSLVMPQLkgklngialrvptpnvsVVDLVVNVEKKGITAEDVNAAFRKAaegplkgilavcdvplvsvdfrcsdvsstidsSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVatkwpgvaaggsgdpledfcqtnpadeeckvyea
mashsalapsripaitripsktthsfptqcstKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLtpkvaagsvpvkketVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVkivdnetisvdgklikvvsnrdplqlpWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMttthsytgdqRLLDASHRDLRRARAAalnivptstgaakAVSLVMPQLKGKLNGIalrvptpnvsvVDLVVNVEKkgitaedvNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSStidssltmvmGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAGGSGDPLEDFCQtnpadeeckvyea
MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQrlldashrdlrraraaalNIVPTSTGAAKAVSLVMPQLKGKLNGIALRvptpnvsvvdlvvnvEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA
*****************************CSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAGG***********************
***********************************************************************************VAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKW**************FCQTNPADE*CKVY**
*********SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA
*******************************TKRLD**EFAGLRANA***********SFFD*******************ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query453 2.2.26 [Sep-21-2011]
P25857447 Glyceraldehyde-3-phosphat yes no 0.984 0.997 0.849 0.0
P12859451 Glyceraldehyde-3-phosphat N/A no 0.995 1.0 0.856 0.0
P12860451 Glyceraldehyde-3-phosphat N/A no 0.988 0.993 0.841 0.0
P09044438 Glyceraldehyde-3-phosphat N/A no 0.867 0.897 0.893 0.0
P19866401 Glyceraldehyde-3-phosphat N/A no 0.838 0.947 0.743 1e-156
P25856396 Glyceraldehyde-3-phosphat no no 0.838 0.959 0.749 1e-147
P09315403 Glyceraldehyde-3-phosphat N/A no 0.845 0.950 0.742 1e-147
P50362374 Glyceraldehyde-3-phosphat N/A no 0.770 0.933 0.779 1e-147
P34919414 Glyceraldehyde-3-phosphat N/A no 0.845 0.925 0.652 1e-146
P12858405 Glyceraldehyde-3-phosphat N/A no 0.838 0.938 0.723 1e-144
>sp|P25857|G3PB_ARATH Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2 Back     alignment and function desciption
 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/453 (84%), Positives = 415/453 (91%), Gaps = 7/453 (1%)

Query: 1   MASHSALAPSRIPAITRIPSKTT-HSFPTQCSTKRLDVAEFAGLRANAGATYATGARDAS 59
           MA+H+ALA SRIP   R+ SK+  HSFP QCS+KRL+VAEF+GLR       ++   +AS
Sbjct: 1   MATHAALAVSRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLR------MSSIGGEAS 54

Query: 60  FFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVN 119
           FFDAV AQ+ PK    S PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VVV+N
Sbjct: 55  FFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLN 114

Query: 120 DSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDI 179
           DSGGVKNASHLLKYDS+LGTFKA+VKIVDNETISVDGKLIKVVSNRDPL+LPWAELGIDI
Sbjct: 115 DSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDI 174

Query: 180 VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS 239
           VIEGTGVFVDGPGAGKHIQAGA KVIITAPAKGADIPTYV+GVNE+DY H+VANI+SNAS
Sbjct: 175 VIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGVNEQDYGHDVANIISNAS 234

Query: 240 CTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG 299
           CTTNCLAPF KV+DEE GIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct: 235 CTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG 294

Query: 300 AAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLK 359
           AAKAVSLV+PQLKGKLNGIALRVPTPNVSVVDLV+NVEKKG+TAEDVN AFRKAA GP+K
Sbjct: 295 AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMK 354

Query: 360 GILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV 419
           GIL VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV
Sbjct: 355 GILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV 414

Query: 420 ATKWPGVAAGGSGDPLEDFCQTNPADEECKVYE 452
           A+KWPG  A GSGDPLEDFC+TNPADEECKVY+
Sbjct: 415 ASKWPGAEAVGSGDPLEDFCKTNPADEECKVYD 447

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 3
>sp|P12859|G3PB_PEA Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2 Back     alignment and function description
>sp|P12860|G3PB_SPIOL Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1 Back     alignment and function description
>sp|P09044|G3PB_TOBAC Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1 Back     alignment and function description
>sp|P19866|G3PA_SPIOL Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2 Back     alignment and function description
>sp|P25856|G3PA_ARATH Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Arabidopsis thaliana GN=GAPA PE=1 SV=3 Back     alignment and function description
>sp|P09315|G3PA_MAIZE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1 Back     alignment and function description
>sp|P50362|G3PA_CHLRE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii GN=GAPA PE=1 SV=1 Back     alignment and function description
>sp|P34919|G3PA_CHOCR Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Chondrus crispus GN=GAPA PE=2 SV=1 Back     alignment and function description
>sp|P12858|G3PA_PEA Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query453
381393062452 glyceraldehyde-3-phosphate dehydrogenase 0.997 1.0 0.878 0.0
224086078452 predicted protein [Populus trichocarpa] 0.997 1.0 0.898 0.0
449455619451 PREDICTED: glyceraldehyde-3-phosphate de 0.995 1.0 0.871 0.0
255539282458 glyceraldehyde 3-phosphate dehydrogenase 0.997 0.986 0.884 0.0
327198779450 glyceraldehyde-3-phosphate dehydrogenase 0.993 1.0 0.860 0.0
224061855440 predicted protein [Populus trichocarpa] 0.971 1.0 0.907 0.0
351726690451 glyceraldehyde-3-phosphate dehydrogenase 0.995 1.0 0.867 0.0
255641007452 unknown [Glycine max] 0.997 1.0 0.860 0.0
147795191453 hypothetical protein VITISV_021576 [Viti 0.997 0.997 0.885 0.0
358248146451 uncharacterized protein LOC100806482 [Gl 0.995 1.0 0.867 0.0
>gi|381393062|gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri] Back     alignment and taxonomy information
 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/453 (87%), Positives = 428/453 (94%), Gaps = 1/453 (0%)

Query: 1   MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASF 60
           MASH+ALA SR+PA TR+PSK +HSFPTQC +KRL+V EF+GLR+++  TYA+  R+ SF
Sbjct: 1   MASHAALASSRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSF 60

Query: 61  FDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND 120
           FD V AQLTPK A G  PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVND
Sbjct: 61  FDTVAAQLTPKTA-GPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND 119

Query: 121 SGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIV 180
           SGGVKNASHLLKYDS+LGTFKADVKIVDNETISVDGK +KVVS+RDPL+LPWAE+GIDIV
Sbjct: 120 SGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIV 179

Query: 181 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASC 240
           IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT+VVGVNEKDY H+VANIVSNASC
Sbjct: 180 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTHVVGVNEKDYGHDVANIVSNASC 239

Query: 241 TTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA 300
           TTNCLAPFVK++DEE GIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA
Sbjct: 240 TTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA 299

Query: 301 AKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKG 360
           AKAVSLV+PQLKGKLNGIALRVPTPNVSVVDLV+NV KKGI+AEDVNAAFRKAA+GPLKG
Sbjct: 300 AKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKG 359

Query: 361 ILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA 420
           ILAVCDVPLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA
Sbjct: 360 ILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA 419

Query: 421 TKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA 453
           +KWPG A  GSGDPLEDFCQTNPADEECKVYEA
Sbjct: 420 SKWPGAAVVGSGDPLEDFCQTNPADEECKVYEA 452

Source: Pyrus x bretschneideri

Species: Pyrus x bretschneideri

Genus: Pyrus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224086078|ref|XP_002307806.1| predicted protein [Populus trichocarpa] gi|222857255|gb|EEE94802.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449455619|ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like [Cucumis sativus] gi|449485095|ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255539282|ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] gi|223551407|gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|327198779|emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|224061855|ref|XP_002300632.1| predicted protein [Populus trichocarpa] gi|222842358|gb|EEE79905.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351726690|ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max] gi|77540212|gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max] Back     alignment and taxonomy information
>gi|255641007|gb|ACU20783.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|147795191|emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248146|ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max] gi|255636463|gb|ACU18570.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query453
TAIR|locus:2009864447 GAPB "glyceraldehyde-3-phospha 0.984 0.997 0.781 4.4e-187
TAIR|locus:2010361399 GAPA-2 "glyceraldehyde 3-phosp 0.843 0.957 0.668 4.5e-130
TAIR|locus:2090802396 GAPA "glyceraldehyde 3-phospha 0.838 0.959 0.666 9.6e-128
TIGR_CMR|CHY_0280335 CHY_0280 "glyceraldehyde-3-pho 0.730 0.988 0.526 1.1e-85
TIGR_CMR|BA_5369334 BA_5369 "glyceraldehyde 3-phos 0.728 0.988 0.510 8.2e-83
UNIPROTKB|Q829W3335 gap2 "Glyceraldehyde-3-phospha 0.732 0.991 0.497 1.3e-82
UNIPROTKB|P64178339 gap "Glyceraldehyde-3-phosphat 0.726 0.970 0.501 3e-78
TIGR_CMR|DET_0590334 DET_0590 "glyceraldehyde-3-pho 0.717 0.973 0.481 3e-78
TIGR_CMR|BA_4827342 BA_4827 "glyceraldehyde 3-phos 0.721 0.956 0.484 1.6e-77
TIGR_CMR|GSU_1629333 GSU_1629 "glyceraldehyde 3-pho 0.730 0.993 0.494 2.7e-77
TAIR|locus:2009864 GAPB "glyceraldehyde-3-phosphate dehydrogenase B subunit" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1814 (643.6 bits), Expect = 4.4e-187, P = 4.4e-187
 Identities = 354/453 (78%), Positives = 383/453 (84%)

Query:     1 MASHSALAPSRIPAITRIPSKTT-HSFPTQCSTKRLDVAEFAGLRANAGATYATGARDAS 59
             MA+H+ALA SRIP   R+ SK+  HSFP QCS+KRL+VAEF+GLR ++      G  +AS
Sbjct:     1 MATHAALAVSRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSS-----IGG-EAS 54

Query:    60 FFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVN 119
             FFDAV AQ+ PK    S PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VVV+N
Sbjct:    55 FFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLN 114

Query:   120 DSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDI 179
             DSGGVKNASHLLKYDS+LGTFKA+VKIVDNETISVDGKLIKVVSNRDPL+LPWAELGIDI
Sbjct:   115 DSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDI 174

Query:   180 VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS 239
             VIEGTGVFVDGPGAGKHIQAGA KVIITAPAKGADIPTYV+GVNE+DY H+VANI+SNAS
Sbjct:   175 VIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGVNEQDYGHDVANIISNAS 234

Query:   240 CTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTG 299
             CTTNCLAPF KV+DEE GIVKG MTTTHSYTGDQ                  NIVPTSTG
Sbjct:   235 CTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG 294

Query:   300 AAKAVSLVMPQLKGKLNGIALRXXXXXXXXXXXXXXXEKKGITAEDVNAAFRKAAEGPLK 359
             AAKAVSLV+PQLKGKLNGIALR               EKKG+TAEDVN AFRKAA GP+K
Sbjct:   295 AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMK 354

Query:   360 GILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV 419
             GIL VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV
Sbjct:   355 GILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV 414

Query:   420 ATKWPGVAAGGSGDPLEDFCQTNPADEECKVYE 452
             A+KWPG  A GSGDPLEDFC+TNPADEECKVY+
Sbjct:   415 ASKWPGAEAVGSGDPLEDFCKTNPADEECKVYD 447
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006006 "glucose metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0047100 "glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity" evidence=ISS
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IEP;RCA
GO:0009744 "response to sucrose stimulus" evidence=IEP;RCA
GO:0019253 "reductive pentose-phosphate cycle" evidence=NAS
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0004365 "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity" evidence=NAS
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0009409 "response to cold" evidence=IEP;RCA
GO:0010319 "stromule" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0009637 "response to blue light" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=RCA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=RCA
GO:0015994 "chlorophyll metabolic process" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0019216 "regulation of lipid metabolic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0031408 "oxylipin biosynthetic process" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
TAIR|locus:2010361 GAPA-2 "glyceraldehyde 3-phosphate dehydrogenase A subunit 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090802 GAPA "glyceraldehyde 3-phosphate dehydrogenase A subunit" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0280 CHY_0280 "glyceraldehyde-3-phosphate dehydrogenase, type I" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5369 BA_5369 "glyceraldehyde 3-phosphate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q829W3 gap2 "Glyceraldehyde-3-phosphate dehydrogenase" [Streptomyces avermitilis MA-4680 (taxid:227882)] Back     alignment and assigned GO terms
UNIPROTKB|P64178 gap "Glyceraldehyde-3-phosphate dehydrogenase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0590 DET_0590 "glyceraldehyde-3-phosphate dehydrogenase, type I" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4827 BA_4827 "glyceraldehyde 3-phosphate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1629 GSU_1629 "glyceraldehyde 3-phosphate dehydrogenase 1" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4MQ58G3P1_BACCE1, ., 2, ., 1, ., 1, 20.57910.72840.9880yesno
Q5HF86G3P2_STAAC1, ., 2, ., 1, ., 1, 20.51660.71520.9501yesno
Q8CNY0G3P2_STAES1, ., 2, ., 1, ., 1, 20.51210.70860.9413yesno
P09315G3PA_MAIZE1, ., 2, ., 1, ., 1, 30.74220.84540.9503N/Ano
P09043G3PA_TOBAC1, ., 2, ., 1, ., 1, 30.70700.85200.9846N/Ano
P09316G3P_ZYMMO1, ., 2, ., 1, ., 1, 20.52530.73060.9821yesno
P09044G3PB_TOBAC1, ., 2, ., 1, ., 1, 30.89390.86750.8972N/Ano
P50362G3PA_CHLRE1, ., 2, ., 1, ., 1, 30.77900.77040.9331N/Ano
P12858G3PA_PEA1, ., 2, ., 1, ., 1, 30.72300.83880.9382N/Ano
P12859G3PB_PEA1, ., 2, ., 1, ., 1, 30.85610.99551.0N/Ano
P64181G3P2_STAAW1, ., 2, ., 1, ., 1, 20.51660.71520.9501yesno
P64180G3P2_STAAM1, ., 2, ., 1, ., 1, 20.51660.71520.9501yesno
P99067G3P2_STAAN1, ., 2, ., 1, ., 1, 20.51660.71520.9501yesno
P17721G3P_THEMA1, ., 2, ., 1, ., 1, 20.56020.72400.9849yesno
P94915G3P_MYCAV1, ., 2, ., 1, ., 1, 20.56670.72620.9705yesno
Q6G8N9G3P2_STAAS1, ., 2, ., 1, ., 1, 20.51660.71520.9501yesno
P50322G3PP_CUPNH1, ., 2, ., 1, ., 1, 20.52830.71080.9583yesno
P58554G3P2_NOSS11, ., 2, ., 1, ., 1, 20.66170.73950.9940yesno
P50321G3PC_CUPNH1, ., 2, ., 1, ., 1, 20.52530.71080.9583yesno
P30724G3PA_GRAGA1, ., 2, ., 1, ., 1, 30.63300.84760.9230N/Ano
P64178G3P_MYCTU1, ., 2, ., 1, ., 1, 20.56370.72620.9705yesno
P64179G3P_MYCBO1, ., 2, ., 1, ., 1, 20.56370.72620.9705yesno
P09124G3P1_BACSU1, ., 2, ., 1, ., 1, 20.57730.73060.9880yesno
O67161G3P_AQUAE1, ., 2, ., 1, ., 1, 20.54810.73060.9678yesno
Q8VXQ9G3PA_SCEVA1, ., 2, ., 1, ., 1, 30.79110.69311.0N/Ano
P12860G3PB_SPIOL1, ., 2, ., 1, ., 1, 30.84170.98890.9933N/Ano
A0QWW2G3P_MYCS21, ., 2, ., 1, ., 1, 20.54140.72620.9676yesno
P46713G3P_MYCLE1, ., 2, ., 1, ., 1, 20.53980.72180.9646yesno
P34917G3P2_ANAVT1, ., 2, ., 1, ., 1, 20.66170.73950.9940yesno
Q757I2G3P_ASHGO1, ., 2, ., 1, ., 1, 20.52970.71960.9848yesno
P46795G3P_BORBU1, ., 2, ., 1, ., 1, 20.54590.71740.9701yesno
P23722G3P_BACMD1, ., 2, ., 1, ., 1, 20.57730.73060.9880yesno
P19866G3PA_SPIOL1, ., 2, ., 1, ., 1, 30.74350.83880.9476N/Ano
P34919G3PA_CHOCR1, ., 2, ., 1, ., 1, 30.65230.84540.9251N/Ano
Q9Z518G3P_STRCO1, ., 2, ., 1, ., 1, 20.56670.73280.9880yesno
P25856G3PA_ARATH1, ., 2, ., 1, ., 1, 30.74930.83880.9595nono
P25857G3PB_ARATH1, ., 2, ., 1, ., 1, 30.84980.98450.9977yesno
Q01651G3P_CORGL1, ., 2, ., 1, ., 1, 20.55350.73060.9910yesno
Q6GG19G3P2_STAAR1, ., 2, ., 1, ., 1, 20.51350.71520.9501yesno
Q5HNL7G3P2_STAEQ1, ., 2, ., 1, ., 1, 20.51210.70860.9413yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.1.130.994
4th Layer1.2.1.59LOW CONFIDENCE prediction!
3rd Layer1.2.10.998

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query453
PLN02237442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 0.0
PLN03096395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 0.0
PRK07403337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 0.0
TIGR01534326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 1e-167
PRK07729343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 1e-163
COG0057335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 1e-162
PLN02272421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 1e-121
PTZ00023337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 1e-108
PRK08955334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 1e-108
PRK13535336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 1e-100
TIGR01532325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 1e-96
PRK15425331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 6e-96
PLN02358338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 3e-95
PTZ00434361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 1e-93
PRK08289477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 2e-89
pfam02800157 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh 5e-84
pfam00044148 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh 1e-66
smart00846149 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de 6e-63
PTZ00353342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 1e-30
pfam0267271 pfam02672, CP12, CP12 domain 0.003
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information 
 Score =  834 bits (2157), Expect = 0.0
 Identities = 401/451 (88%), Positives = 422/451 (93%), Gaps = 9/451 (1%)

Query: 3   SHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFD 62
           +H+ALA SRIPA TR+PSK +H        KRL+VAEF+GLRA++  T+A  AR+ASFFD
Sbjct: 1   THAALASSRIPATTRLPSKASH--------KRLEVAEFSGLRASSCVTFAKNAREASFFD 52

Query: 63  AVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG 122
            V +QL PK  AGS PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG
Sbjct: 53  VVASQLAPK-VAGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG 111

Query: 123 GVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIE 182
           GVKNASHLLKYDS+LGTFKADVKIVD+ETISVDGK IKVVSNRDPL+LPWAELGIDIVIE
Sbjct: 112 GVKNASHLLKYDSMLGTFKADVKIVDDETISVDGKPIKVVSNRDPLKLPWAELGIDIVIE 171

Query: 183 GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTT 242
           GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNE DYDHEVANIVSNASCTT
Sbjct: 172 GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEDDYDHEVANIVSNASCTT 231

Query: 243 NCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK 302
           NCLAPFVKV+DEE GIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct: 232 NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK 291

Query: 303 AVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGIL 362
           AVSLV+PQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAA+GPLKGIL
Sbjct: 292 AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGIL 351

Query: 363 AVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATK 422
           AVCDVPLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA K
Sbjct: 352 AVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAK 411

Query: 423 WPGVAAGGSGDPLEDFCQTNPADEECKVYEA 453
           WPG AA GSGDPLEDFC+TNPADEECKVY+A
Sbjct: 412 WPGGAAAGSGDPLEDFCKTNPADEECKVYDA 442

Length = 442
>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|202342 pfam02672, CP12, CP12 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 453
PLN02237442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 100.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 100.0
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 100.0
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
KOG0657285 consensus Glyceraldehyde 3-phosphate dehydrogenase 100.0
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 100.0
PF02800157 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 100.0
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 100.0
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 100.0
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 100.0
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 100.0
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 100.0
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 100.0
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK08040336 putative semialdehyde dehydrogenase; Provisional 100.0
PLN02383344 aspartate semialdehyde dehydrogenase 99.97
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 99.97
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 99.97
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 99.97
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 99.93
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 99.91
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 99.91
KOG4777361 consensus Aspartate-semialdehyde dehydrogenase [Am 99.87
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 99.85
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 99.75
PRK08300302 acetaldehyde dehydrogenase; Validated 99.49
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 99.3
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 99.15
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 98.97
PF02774184 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimer 98.95
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.18
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.99
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 97.78
KOG4354340 consensus N-acetyl-gamma-glutamyl-phosphate reduct 97.66
PF0267271 CP12: CP12 domain; InterPro: IPR003823 This entry 97.6
PRK13303265 L-aspartate dehydrogenase; Provisional 97.58
PRK06270341 homoserine dehydrogenase; Provisional 97.38
PLN00204126 CP12 gene family protein; Provisional 97.27
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 97.27
TIGR00036266 dapB dihydrodipicolinate reductase. 97.23
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.21
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.13
PRK06349426 homoserine dehydrogenase; Provisional 97.11
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.03
PRK00048257 dihydrodipicolinate reductase; Provisional 96.99
PRK06813346 homoserine dehydrogenase; Validated 96.97
PRK08374336 homoserine dehydrogenase; Provisional 96.91
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 96.78
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 96.71
PRK06392326 homoserine dehydrogenase; Provisional 96.57
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.48
PRK11579346 putative oxidoreductase; Provisional 96.41
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 96.39
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 95.68
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 95.63
PRK09414445 glutamate dehydrogenase; Provisional 95.55
PRK05447385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 95.51
PLN02775286 Probable dihydrodipicolinate reductase 95.5
COG0673342 MviM Predicted dehydrogenases and related proteins 95.1
PRK10206344 putative oxidoreductase; Provisional 95.09
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 94.92
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 94.71
PLN02700377 homoserine dehydrogenase family protein 94.47
PLN02696454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 94.27
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 93.61
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 93.52
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.33
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 93.13
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.07
COG2344211 AT-rich DNA-binding protein [General function pred 92.71
PRK14030445 glutamate dehydrogenase; Provisional 92.51
PLN02477410 glutamate dehydrogenase 92.25
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 92.24
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 92.1
PRK09436819 thrA bifunctional aspartokinase I/homoserine dehyd 92.02
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 91.92
CHL00194317 ycf39 Ycf39; Provisional 91.8
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 91.74
PLN00016378 RNA-binding protein; Provisional 91.56
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 90.63
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 90.18
PRK08229341 2-dehydropantoate 2-reductase; Provisional 90.15
PRK06487317 glycerate dehydrogenase; Provisional 90.01
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 89.98
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 89.82
PRK06932314 glycerate dehydrogenase; Provisional 89.22
PRK14031444 glutamate dehydrogenase; Provisional 89.21
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 88.94
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 88.82
PTZ00117319 malate dehydrogenase; Provisional 88.75
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 88.68
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 88.6
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 88.42
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 88.29
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 88.2
PLN02928347 oxidoreductase family protein 88.03
PLN03209 576 translocon at the inner envelope of chloroplast su 87.9
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 87.73
PRK07574385 formate dehydrogenase; Provisional 87.6
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 87.57
COG2910211 Putative NADH-flavin reductase [General function p 87.57
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 87.43
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 87.26
PRK06436303 glycerate dehydrogenase; Provisional 87.23
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.19
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 87.09
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 87.02
PRK13243333 glyoxylate reductase; Reviewed 86.73
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 86.6
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 86.31
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 85.58
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 85.52
PLN02306386 hydroxypyruvate reductase 84.91
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 84.76
PRK12480330 D-lactate dehydrogenase; Provisional 84.75
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 84.73
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 84.54
PLN03139386 formate dehydrogenase; Provisional 84.43
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 84.22
PRK08306296 dipicolinate synthase subunit A; Reviewed 84.02
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 83.82
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 83.74
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 83.62
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 82.82
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 82.65
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 82.4
PRK06223307 malate dehydrogenase; Reviewed 82.39
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 82.18
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 82.12
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 81.99
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 81.96
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 80.84
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 80.42
PRK08605332 D-lactate dehydrogenase; Validated 80.33
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 80.3
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 80.14
PLN02214342 cinnamoyl-CoA reductase 80.03
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information 
Probab=100.00  E-value=7.6e-138  Score=1070.32  Aligned_cols=441  Identities=90%  Similarity=1.350  Sum_probs=417.4

Q ss_pred             ccCCCCCCCCCcccccCCCCcCCCCCcccccccccccccccccccCcccccccccccchhhhhhccccccccCCCCcccc
Q 012940            3 SHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKE   82 (453)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (453)
                      +|||||++|||+++|++|+++        .+|.+|++|+|||++++++|++..++.+|++.++.|+.++ ..+..+.+..
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~   71 (442)
T PLN02237          1 THAALASSRIPATTRLPSKAS--------HKRLEVAEFSGLRASSCVTFAKNAREASFFDVVASQLAPK-VAGSTPVRGE   71 (442)
T ss_pred             CcchhcccCCccccccccccc--------cccccccccccccccccccccccccchhHHHHhhhhhhhh-hccccccccc
Confidence            699999999999999999886        3677899999999999999999989999999999999987 5557889999


Q ss_pred             ccceeeEEEEcCChhHHHHHHHHHhCCCCCceEEEEcCCCChhhhhhhhccccceeecCceEEEecCCeEEECCeEEEEE
Q 012940           83 TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVV  162 (453)
Q Consensus        83 ~~m~ikVaInGfGrIGR~vlr~l~~r~~~~ieiVaInd~~~~~~~a~LlkyDS~~G~f~~~v~~~~~~~l~v~Gk~I~v~  162 (453)
                      ++|++||||||||||||.++|+++++.++++|||+|||+.++++++|||||||+||+|+++++..+++.|.|+|++|.++
T Consensus        72 ~~~~ikVgINGFGRIGR~vlR~~~~~~~~~ievVaINd~~~~~~~ayLlkyDS~hG~f~~~v~~~~~~~L~v~Gk~I~V~  151 (442)
T PLN02237         72 TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDDETISVDGKPIKVV  151 (442)
T ss_pred             ccceEEEEEECCChHHHHHHHHHHHccCCCeEEEEECCCCCHHHHHHHHccccCCCCcCCceEECCCCEEEECCEEEEEE
Confidence            99999999999999999999998876335699999999999999999999999999999999854678999999999999


Q ss_pred             eCCCCCCCCccccCccEEEcCCCCCCChhhHHHHHHcCCCEEEEeCCCCCCCCCeEEeccCccccCccCCeEEecCCcch
Q 012940          163 SNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTT  242 (453)
Q Consensus       163 ~~~dp~~l~W~~~gvDiVie~TG~f~s~e~a~~hl~aGAkkVIISaps~d~dvPtvV~gVN~~~~~~~~~~IVSnaSCTT  242 (453)
                      ++++|.++||+++|+||||||||.|++++++++|+++|||||+||+|++++++||||||||++.|++..++|||||||||
T Consensus       152 ~~~dp~~l~W~~~gVDiViE~TG~f~s~e~a~~hl~aGAkkV~iSAP~~d~dvptvV~GVN~~~~~~~~~~IISnaSCTT  231 (442)
T PLN02237        152 SNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEDDYDHEVANIVSNASCTT  231 (442)
T ss_pred             EcCCchhCChhhcCCCEEEEccChhhhHHHHHHHHhCCCEEEEECCCCCCCCCceEecccCHHHhCcCCCCEEECCchHH
Confidence            99999999999999999999999999999999999999999999999987678999999999999864378999999999


Q ss_pred             hhhhhHHHHHhhhcCeeEEEEEeeeccccchhhhccccccchhhhhhhhccccCCCchhHHHHhhccccCCceeEEEEEe
Q 012940          243 NCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIALRV  322 (453)
Q Consensus       243 n~Lapvlk~L~d~fGI~~~~mTTiha~Tg~Q~llD~~~~d~rr~Raaa~NIIPt~tGaakav~kVlPeL~gKisgtavRV  322 (453)
                      |||+|++|+||++|||++++|||||+||++|+++|++|+||||+|++++||||++||++|++++|||+|+|||+|+++||
T Consensus       232 NcLAPvlkvL~d~fGI~~g~mTTvHs~T~dQ~~~D~~h~D~Rr~Raaa~nIIPtsTGAAkAv~~VlP~L~GKl~g~A~RV  311 (442)
T PLN02237        232 NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV  311 (442)
T ss_pred             HHHHHHHHHHHHhcCeeEEEEEEEEeccCCcccccCCCcccccccccccccccCCcchhhhhceecccCCCceeeEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eecceeEEEEEEEEcc-CCCCHHHHHHHHHHcccCCCCcceeecccCeEeecCCCCCcceEEeCCCCceecCCeEEEEEE
Q 012940          323 PTPNVSVVDLVVNVEK-KGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAW  401 (453)
Q Consensus       323 Pv~~gs~vdltv~lek-~~vt~eeI~~al~~aa~~~lkgil~~~~~~~VS~Df~~~~~S~i~D~~~t~v~~~~~vKl~~W  401 (453)
                      ||++||++||+++++| + +++||||++|+++++++|||||+|+|+|+||+||+|++||+|||+.+|+++|++|+||++|
T Consensus       312 Pt~nvS~vDLt~~l~k~~-~t~eein~~~k~aa~~~lkgil~y~~~plVS~Df~~~~~Ssi~D~~~t~v~~~~~vKv~aW  390 (442)
T PLN02237        312 PTPNVSVVDLVVNVEKKG-ITAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAW  390 (442)
T ss_pred             ccCCceEEEEEEEeCCCC-CCHHHHHHHHHHhhccccCCeeeeeCCceeeeeecCCCcceEEEcccCEEeCCCEEEEEEE
Confidence            9999999999999998 7 7999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCchhhhHHHHHHHHHhcCCCCCCCCCCChhhhhhccCCCCcccccccC
Q 012940          402 YDNEWGYSQRVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA  453 (453)
Q Consensus       402 YDNE~GYs~r~vdl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  453 (453)
                      ||||||||+||+||+.||+++|......++.||++.||.+||+++|||+|++
T Consensus       391 YDNEwGys~R~~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  442 (442)
T PLN02237        391 YDNEWGYSQRVVDLAHLVAAKWPGGAAAGSGDPLEDFCKTNPADEECKVYDA  442 (442)
T ss_pred             eCCchhHHHHHHHHHHHHHHhhccccccccccchhhhhhcCccccccccccC
Confidence            9999999999999999999987533445566799999999999999999974

>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF02774 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimerisation domain; InterPro: IPR012280 This domain contains N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>KOG4354 consensus N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02672 CP12: CP12 domain; InterPro: IPR003823 This entry represents an uncharacterised domain in proteins of unknown function Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN00204 CP12 gene family protein; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query453
2pkq_O368 Crystal Structure Of The Photosynthetic A2b2-Glycer 1e-174
2pkr_O365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 1e-151
1rm5_O337 Crystal Structure Of Mutant S188a Of Photosynthetic 1e-139
1nbo_O337 The Dual Coenzyme Specificity Of Photosynthetic Gly 1e-139
1rm3_O337 Crystal Structure Of Mutant T33a Of Photosynthetic 1e-139
1jn0_O335 Crystal Structure Of The Non-Regulatory A4 Isoform 1e-135
3k2b_A337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 1e-135
3b1j_A339 Crystal Structure Of Dehydrogenese Length = 339 1e-111
2d2i_A380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 1e-109
3dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-93
1gd1_O334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 4e-91
1dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-90
1npt_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 4e-90
1nq5_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 4e-90
2ep7_A342 Structural Study Of Project Id Aq_1065 From Aquifex 6e-83
1hdg_O332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 1e-80
4dib_A345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 1e-80
3hja_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-79
1cer_O331 Determinants Of Enzyme Thermostability Observed In 6e-79
2g82_O331 High Resolution Structures Of Thermus Aquaticus Gly 9e-78
1vc2_A331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 9e-77
3l0d_A356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 2e-75
3doc_A335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 2e-75
3gnq_A344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-74
1obf_O335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 1e-70
2i5p_O342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 7e-69
2b4r_O345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 6e-68
1ywg_O337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 7e-68
1vsu_A359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 1e-67
3e5r_O337 Crystal Structure And Functional Analysis Of Glycer 2e-67
1gad_O330 Comparison Of The Structures Of Wild Type And A N31 3e-67
3cps_A354 Crystal Structure Of Cryptosporidium Parvum Glycera 3e-67
3e6a_O336 Crystal Structure And Functional Analysis Of Glycer 3e-67
1s7c_A331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 3e-67
3cif_A359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 1e-66
1gae_O330 Comparison Of The Structures Of Wild Type And A N31 1e-66
1u8f_O335 Crystal Structure Of Human Placental Glyceraldehyde 2e-66
1znq_O338 Crsytal Structure Of Human Liver Gapdh Length = 338 2e-66
2vyn_A331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 4e-66
4iq8_A340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 5e-66
3pym_A332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 5e-66
3h9e_B346 Crystal Structure Of Human Sperm-Specific Glycerald 1e-64
1j0x_O332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 1e-64
3gpd_R334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 1e-63
1ihx_A333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 2e-63
1szj_G333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 7e-63
1gpd_G334 Studies Of Asymmetry In The Three-Dimensional Struc 3e-62
4gpd_1333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 3e-62
3sth_A361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 5e-62
1a7k_A360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 1e-61
1gyp_A358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 1e-61
1dss_G333 Structure Of Active-Site Carboxymethylated D-Glycer 1e-61
1dc4_A330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 1e-61
2vyn_D334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 2e-61
2x0n_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 5e-61
1k3t_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 9e-61
3dmt_C359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 1e-59
3k73_Q336 Crystal Structure Of Phosphate Bound Holo Glycerald 6e-59
3vaz_P344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 6e-59
3lvf_P338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 6e-59
3lc7_O339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 6e-59
3lc1_P336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 5e-58
3hq4_R336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 7e-58
3k9q_Q336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 1e-57
3ksd_Q336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 6e-57
2x5j_O339 Crystal Structure Of The Apoform Of The D-Erythrose 9e-56
2xf8_A338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 1e-55
2x5k_O339 Structure Of An Active Site Mutant Of The D-Erythro 2e-53
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure 
Iteration: 1

 Score =  608 bits (1569), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 300/368 (81%), Positives = 317/368 (86%), Gaps = 1/368 (0%)
Query: 86  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVK 145
           KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVK+A+HLLKYDS+LGTFKADVK
Sbjct: 1   KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVK 60
Query: 146 IVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 205
           I+DNET S+DGK IKVVSNRDPL+LPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI
Sbjct: 61  IIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 120
Query: 206 ITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTT 265
           ITAPAKG+DIPTYVVGVNEKDY H+VANI+SNASCTTNCLAPFVKV+DEELGIVKG MTT
Sbjct: 121 ITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTT 180
Query: 266 THSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTGAAKAVSLVMPQLKGKLNGIALRXXXX 325
           THSYTGDQ                  NIVPTSTGAAKAVSLV+PQLKGKLNGIALR    
Sbjct: 181 THSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTP 240
Query: 326 XXXXXXXXXXXEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDS 385
                      EK G+TAEDVN AFRKAA GPLKG+L VCD+PLVSVDFRCSD SSTIDS
Sbjct: 241 NVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDS 300
Query: 386 SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAG-GSGDPLEDFCQTNPA 444
           SLTMVMG DMVKVVAWYDNEWGYSQRVVDLA LVA KWPG+     SGDPLEDFC+ NPA
Sbjct: 301 SLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPA 360
Query: 445 DEECKVYE 452
           DEECK+YE
Sbjct: 361 DEECKLYE 368
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query453
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 0.0
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 0.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 0.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 0.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 0.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 0.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 0.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 0.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 0.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 0.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 0.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 0.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 0.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 1e-177
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 1e-175
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 1e-173
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 1e-172
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 1e-170
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 1e-170
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 1e-169
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 1e-166
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 1e-91
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 4e-87
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 2e-78
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 6e-64
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
 Score =  638 bits (1649), Expect = 0.0
 Identities = 223/340 (65%), Positives = 272/340 (80%), Gaps = 2/340 (0%)

Query: 86  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVK 145
            ++VAINGFGRIGRNFLRCW GR+++ L+VV +N++   + A+HLL+YDS+LG F AD+ 
Sbjct: 2   TIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYDSVLGRFNADIS 61

Query: 146 IVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 205
             D  +I+V+GK +K+V +R+PL LPW E  ID+VIE TGVFV   GA KHIQAGAKKV+
Sbjct: 62  -YDENSITVNGKTMKIVCDRNPLNLPWKEWDIDLVIESTGVFVTAEGASKHIQAGAKKVL 120

Query: 206 ITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGIVKGAMTT 265
           ITAP KG  + TYV+GVN+ +Y HE   ++SNASCTTNCLAP  KV+ +  GI+KG MTT
Sbjct: 121 ITAPGKGEGVGTYVIGVNDSEYRHEDFAVISNASCTTNCLAPVAKVLHDNFGIIKGTMTT 180

Query: 266 THSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPTP 325
           THSYT DQR+LDASHRDLRRARAAA+NIVPT+TGAAKAV+LV+P+LKGKLNGIALRVPTP
Sbjct: 181 THSYTLDQRILDASHRDLRRARAAAVNIVPTTTGAAKAVALVIPELKGKLNGIALRVPTP 240

Query: 326 NVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDS 385
           NVSVVDLVV VEK     E VN   +KA++  +KGI+   D+PLVS DFR +D SS +DS
Sbjct: 241 NVSVVDLVVQVEKP-TITEQVNEVLQKASQTTMKGIIKYSDLPLVSSDFRGTDESSIVDS 299

Query: 386 SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPG 425
           SLT+VM  D+VKV+AWYDNEWGYSQRVVDLA L A KW  
Sbjct: 300 SLTLVMDGDLVKVIAWYDNEWGYSQRVVDLAELAARKWAA 339
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query453
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 100.0
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 100.0
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 100.0
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 100.0
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 100.0
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 100.0
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 100.0
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 100.0
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 100.0
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 100.0
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 100.0
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 100.0
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 100.0
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 100.0
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 100.0
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 100.0
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 100.0
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 100.0
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 100.0
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 99.94
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 98.66
3b1j_C26 CP12; alpha/beta fold, oxidoreductase-protein bind 97.97
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.63
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.44
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.43
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.42
3qv1_G82 CP12 protein; rossman fold, calvin cycle, NAD, chl 97.41
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 97.4
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.35
2lj9_A99 CP12 domain-containing protein 2; helix, protein b 97.34
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.29
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.26
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.19
4had_A350 Probable oxidoreductase protein; structural genomi 97.17
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.14
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 97.14
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 97.11
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.07
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 97.07
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 97.06
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 97.06
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 97.05
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 97.05
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 97.04
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 97.04
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.02
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.02
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 97.0
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.0
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.98
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.94
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 96.89
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 96.89
4h3v_A390 Oxidoreductase domain protein; structural genomics 96.89
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.89
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.85
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 96.84
1ydw_A362 AX110P-like protein; structural genomics, protein 96.8
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.79
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.78
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.77
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.75
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 96.75
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 96.74
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 96.73
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.7
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.64
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 96.63
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 96.6
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 96.59
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.58
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 96.47
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 96.47
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 96.47
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 96.41
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.4
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 96.12
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 96.11
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 95.85
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 95.81
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 95.49
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 95.49
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.49
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.45
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 95.44
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 95.39
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 95.35
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 95.2
3oqb_A383 Oxidoreductase; structural genomics, protein struc 94.78
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 94.46
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 94.41
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 94.36
3ius_A286 Uncharacterized conserved protein; APC63810, silic 94.31
3btv_A438 Galactose/lactose metabolism regulatory protein GA 94.2
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 93.98
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 93.79
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 93.74
1iuk_A140 Hypothetical protein TT1466; structural genomics, 93.68
3a06_A376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 93.63
2d59_A144 Hypothetical protein PH1109; COA binding, structur 93.5
2duw_A145 Putative COA-binding protein; ligand binding prote 93.38
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 92.8
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 92.8
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 92.72
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 92.01
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.89
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 91.83
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 91.73
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 91.28
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 91.23
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 91.2
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 91.15
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 91.12
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 91.12
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 91.05
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 89.63
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 89.09
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 89.04
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 88.86
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 88.37
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 88.17
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 88.07
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 88.02
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 87.97
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 87.69
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 87.68
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 87.68
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 87.59
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 87.42
1lss_A140 TRK system potassium uptake protein TRKA homolog; 87.4
1vpd_A299 Tartronate semialdehyde reductase; structural geno 87.38
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 87.36
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 87.28
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 87.19
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 87.15
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 87.15
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 87.14
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 87.04
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 86.91
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 86.86
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 86.83
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 86.61
2wm3_A299 NMRA-like family domain containing protein 1; unkn 86.57
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 86.4
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 86.26
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 86.12
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 86.1
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 86.05
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 86.02
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 85.99
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 85.97
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 85.86
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 85.85
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 85.83
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 85.82
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 85.78
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 85.6
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 85.39
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 85.07
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 85.01
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 84.85
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 84.81
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 84.79
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 84.72
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 84.72
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 84.61
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 84.37
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 84.37
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 84.28
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 84.28
4ezb_A317 Uncharacterized conserved protein; structural geno 84.16
1id1_A153 Putative potassium channel protein; RCK domain, E. 84.02
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 83.6
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 83.57
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 83.45
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 83.35
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 83.32
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 83.19
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 83.13
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 82.9
1yb4_A295 Tartronic semialdehyde reductase; structural genom 82.75
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 82.57
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 82.54
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 82.21
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 82.01
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 81.85
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 81.66
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 81.63
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 81.26
3c85_A183 Putative glutathione-regulated potassium-efflux S 81.15
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 81.02
3qha_A296 Putative oxidoreductase; seattle structural genomi 80.82
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 80.43
2rir_A300 Dipicolinate synthase, A chain; structural genomic 80.34
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
Probab=100.00  E-value=4e-120  Score=914.81  Aligned_cols=333  Identities=52%  Similarity=0.825  Sum_probs=324.1

Q ss_pred             ceeeEEEEcCChhHHHHHHHHHhCCCCCceEEEEcCCCChhhhhhhhccccceeecCceEEEecCCeEEECCeEEEEEeC
Q 012940           85 AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSN  164 (453)
Q Consensus        85 m~ikVaInGfGrIGR~vlr~l~~r~~~~ieiVaInd~~~~~~~a~LlkyDS~~G~f~~~v~~~~~~~l~v~Gk~I~v~~~  164 (453)
                      |++||||||||||||+++|+++++..++++||||||+.++++++|||||||+||+|+++++. ++++|.|||++|+++++
T Consensus         1 m~~kv~INGfGrIGr~v~Ra~~~~~~~~~~ivaiNd~~d~~~~a~l~kyDS~hG~f~~~v~~-~~~~l~i~Gk~I~v~~e   79 (335)
T 3doc_A            1 MAVRVAINGFGRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHLLRYDSVHGRFPKEVEV-AGDTIDVGYGPIKVHAV   79 (335)
T ss_dssp             CCEEEEEECCSHHHHHHHHHHHHTTCCSEEEEEEECSSCHHHHHHHHHEETTTEECSSCCEE-CSSEEESSSSEEEEECC
T ss_pred             CCEEEEEECCCcHHHHHHHHHHhccCCCeEEEEEeCCCCHHHHHHHhcccCCCCCCCCeEEE-ecCEEEECCEEEEEEee
Confidence            67899999999999999999998733569999999999999999999999999999999997 78999999999999999


Q ss_pred             CCCCCCCccccCccEEEcCCCCCCChhhHHHHHHcCCCEEEEeCCCCCCCCCeEEeccCccccCccCCeEEecCCcchhh
Q 012940          165 RDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNC  244 (453)
Q Consensus       165 ~dp~~l~W~~~gvDiVie~TG~f~s~e~a~~hl~aGAkkVIISaps~d~dvPtvV~gVN~~~~~~~~~~IVSnaSCTTn~  244 (453)
                      ++|+++||+++|+||||||||.|+++|+|++|+++||||||||+|+++ ++||||||||++.|++. ++|||||||||||
T Consensus        80 ~dp~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViIsaps~d-~~p~vV~gVN~~~~~~~-~~IISNasCTTn~  157 (335)
T 3doc_A           80 RNPAELPWKEENVDIALECTGIFTSRDKAALHLEAGAKRVIVSAPADG-ADLTVVYGVNNDKLTKD-HLVISNASCTTNC  157 (335)
T ss_dssp             SSTTSSCTTTTTCSEEEECSSSCCSHHHHTHHHHTTCSEEEESSCCTT-CSEECCTTTTGGGCCTT-CCEEECCCHHHHH
T ss_pred             cccccccccccCCCEEEEccCccCCHHHHHHHHHcCCCEEEECCCCCC-CCCEEecccCHHHhCcc-CCeEecCchhhhh
Confidence            999999999999999999999999999999999999999999999986 57999999999999875 7999999999999


Q ss_pred             hhhHHHHHhhhcCeeEEEEEeeeccccchhhhccccccchhhhhhhhccccCCCchhHHHHhhccccCCceeEEEEEeee
Q 012940          245 LAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPT  324 (453)
Q Consensus       245 Lapvlk~L~d~fGI~~~~mTTiha~Tg~Q~llD~~~~d~rr~Raaa~NIIPt~tGaakav~kVlPeL~gKisgtavRVPv  324 (453)
                      |+|++|+|||+|||++++|||||++|++|+++|++++||||+|++++||||++||++|+++||||+|+|||+|+|+||||
T Consensus       158 Lap~lk~L~d~fGI~~g~mTTvha~T~~q~~~D~p~kd~r~~r~aa~NiIP~~tGaakav~kVlPeL~gkltg~avRVPv  237 (335)
T 3doc_A          158 LAPVAQVLNDTIGIEKGFMTTIHSYTGDQPTLDTMHKDLYRARAAALSMIPTSTGAAKAVGLVLPELKGKLDGVAIRVPT  237 (335)
T ss_dssp             HHHHHHHHHHHTCEEEEEEEEEEECCTTSCSSCCCCSSTTTTSCTTSSCEEEECCHHHHHHHHSGGGTTCEEEEEEEESC
T ss_pred             hHHhHHHHHHHcCEEEEEEEeeeeccchhhhhcCccccccccccCcceEecCCCchHHHHHHhccccCCCEEEEEEEecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cceeEEEEEEEEccCCCCHHHHHHHHHHcccCCCCcceeecccCeEeecCCCCCcceEEeCCCCceecCCeEEEEEEecC
Q 012940          325 PNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDN  404 (453)
Q Consensus       325 ~~gs~vdltv~lek~~vt~eeI~~al~~aa~~~lkgil~~~~~~~VS~Df~~~~~S~i~D~~~t~v~~~~~vKl~~WYDN  404 (453)
                      ++||++||+++|+|+ +++|||+++|+++++|+|||||+|+|+|+||+||+|++||+|||+.+|++++++|+||++||||
T Consensus       238 ~~~s~~dlt~~lek~-~t~eei~~~lk~A~~g~lkgil~yte~~~VS~Df~~~~~ssi~d~~~t~~~~~~~vk~~~WYDN  316 (335)
T 3doc_A          238 PNVSVVDLTFIAKRE-TTVEEVNNAIREAANGRLKGILGYTDEKLVSHDFNHDSHSSVFHTDQTKVMDGTMVRILSWYDN  316 (335)
T ss_dssp             SSCEEEEEEEEESSC-CCHHHHHHHHHHHHTTTTTTTEEEECSCCCGGGGTTCCCSEEEEGGGCEEETTTEEEEEEEECT
T ss_pred             ccccceEEEEEECCC-CCHHHHHHHHHHhhcCCcCCeeEEEcCCeEeeeeCCCCCccccCchhhEEEcCCEEEEEEEEcC
Confidence            999999999999998 8999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCchhhhHHHHHHHHHh
Q 012940          405 EWGYSQRVVDLAHLVAT  421 (453)
Q Consensus       405 E~GYs~r~vdl~~~~~~  421 (453)
                      ||||||||+||+.||++
T Consensus       317 E~gys~r~~dl~~~~~~  333 (335)
T 3doc_A          317 EWGFSSRMSDTAVALGK  333 (335)
T ss_dssp             THHHHHHHHHHHHHHHH
T ss_pred             ccchHHHHHHHHHHHHh
Confidence            99999999999999986
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3b1j_C CP12; alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_C* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3qv1_G CP12 protein; rossman fold, calvin cycle, NAD, chloroplast, oxidoreductase binding complex; HET: NAD; 2.00A {Arabidopsis thaliana} PDB: 3rvd_I* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>2lj9_A CP12 domain-containing protein 2; helix, protein binding, intrinsically disordered protein; NMR {Arabidopsis thaliana} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 453
d3cmco2163 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de 2e-75
d1rm4a2163 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de 2e-73
d1u8fo2164 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de 4e-71
d1obfo2162 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de 2e-66
d2g82a2162 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de 2e-62
d1rm4a1172 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp 9e-60
d1hdgo1169 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp 6e-58
d1u8fo1169 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp 3e-56
d1gado1166 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp 1e-55
d1k3ta2169 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de 3e-54
d1dssg1169 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp 4e-53
d1k3ta1190 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp 2e-50
d3cmco1171 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp 1e-48
d1cf2o1171 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp 2e-46
d2g82a1168 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp 3e-46
d2b4ro1166 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp 3e-44
d1obfo1173 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp 1e-42
d2czca2172 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp 1e-41
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 3e-39
d1b7go2162 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de 1e-33
d1cf2o2165 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de 9e-32
d1lc0a1172 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase { 0.003
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Bacillus stearothermophilus, nca 1503 [TaxId: 1422]

 Score =  231 bits (590), Expect = 2e-75
 Identities = 113/164 (68%), Positives = 136/164 (82%), Gaps = 1/164 (0%)

Query: 240 CTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG 299
           CTTNCLAPF KV+ E+ GIV+G MTT HSYT DQR+LD  H+DLRRARAAA +I+PT+TG
Sbjct: 1   CTTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDQRILDLPHKDLRRARAAAESIIPTTTG 60

Query: 300 AAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLK 359
           AAKAV+LV+P+LKGKLNG+A+RVPTPNVSVVDLV  +EK+ +T E+VNAA + AAEG LK
Sbjct: 61  AAKAVALVLPELKGKLNGMAMRVPTPNVSVVDLVAELEKE-VTVEEVNAALKAAAEGELK 119

Query: 360 GILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYD 403
           GILA  + PLVS D+  S VSSTID+  TMV+   MVKVV+WYD
Sbjct: 120 GILAYSEEPLVSRDYNGSTVSSTIDALSTMVIDGKMVKVVSWYD 163
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 172 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query453
d3cmco2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1rm4a2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo2164 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1k3ta2169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1cf2o2165 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.94
d1b7go2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.93
d1mb4a2222 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.87
d1t4ba2221 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.87
d2hjsa2190 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.84
d2gz1a2202 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.8
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.77
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.76
d2czca1162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.67
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 99.53
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.5
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.44
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.4
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.36
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.28
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.09
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.57
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.46
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.29
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.26
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.03
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 96.73
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.59
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 96.45
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.24
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.86
d2g17a2155 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.84
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 95.82
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 95.19
d2cvoa2165 Putative semialdehyde dehydrogenase {Rice (Oryza s 94.94
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.82
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.25
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 94.06
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.68
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 93.65
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 93.26
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 93.05
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.48
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 92.44
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 92.19
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 91.55
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.24
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 91.04
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 90.9
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 90.85
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 90.84
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 90.36
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 90.35
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 90.21
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 90.03
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 90.01
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 89.9
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 89.82
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 89.72
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 89.35
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 89.0
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 88.95
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 88.3
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 88.12
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 87.91
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.69
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 87.4
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 87.3
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 87.27
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 86.84
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 86.5
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 86.48
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 85.36
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 85.04
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 84.74
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 84.28
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 83.79
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 83.2
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 83.0
d1vkna2163 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 82.68
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 82.53
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 82.49
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 82.02
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 81.69
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 81.58
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 80.03
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Bacillus stearothermophilus, nca 1503 [TaxId: 1422]

Probab=100.00  E-value=1.4e-62  Score=448.79  Aligned_cols=163  Identities=69%  Similarity=1.054  Sum_probs=162.0

Q ss_pred             cchhhhhhHHHHHhhhcCeeEEEEEeeeccccchhhhccccccchhhhhhhhccccCCCchhHHHHhhccccCCceeEEE
Q 012940          240 CTTNCLAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKGKLNGIA  319 (453)
Q Consensus       240 CTTn~Lapvlk~L~d~fGI~~~~mTTiha~Tg~Q~llD~~~~d~rr~Raaa~NIIPt~tGaakav~kVlPeL~gKisgta  319 (453)
                      ||||||||++|+|||+|||++|.|||+|+||++|+++|++|+|+||+|++++||||++||++|++++|||+|+|||+|++
T Consensus         1 CTTNclaP~~kvl~~~fgI~~g~mTTvHa~T~~Q~l~D~~~~d~Rr~Raa~~niIPtsTgAakav~~vlP~L~gkl~g~a   80 (163)
T d3cmco2           1 CTTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDQRILDLPHKDLRRARAAAESIIPTTTGAAKAVALVLPELKGKLNGMA   80 (163)
T ss_dssp             HHHHHHHHHHHHHHHHHCEEEEEEEEEEECCTTSBSSSCCCSSTTTTSBTTTCCEEEECSHHHHHHHHCGGGTTTEEEEE
T ss_pred             ChhHHHHHHHHHHHhhcCeeEEEEEeeccccCcccCCCCCCcchhccchHhhCCCCccccHHHHHHHhhHHhCCCcceEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeecceeEEEEEEEEccCCCCHHHHHHHHHHcccCCCCcceeecccCeEeecCCCCCcceEEeCCCCceecCCeEEEE
Q 012940          320 LRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVV  399 (453)
Q Consensus       320 vRVPv~~gs~vdltv~lek~~vt~eeI~~al~~aa~~~lkgil~~~~~~~VS~Df~~~~~S~i~D~~~t~v~~~~~vKl~  399 (453)
                      +||||++||++||+++++|+ +++||||++|+++++++|||||+|++||+||+||+|++||+|||+.+|++++++++||+
T Consensus        81 ~RVPt~~vS~vDlt~~l~k~-~t~e~in~~~k~as~~~lkgil~~t~~plVSsDf~g~~~SsI~D~~~t~v~~~~~vKv~  159 (163)
T d3cmco2          81 MRVPTPNVSVVDLVAELEKE-VTVEEVNAALKAAAEGELKGILAYSEEPLVSRDYNGSTVSSTIDALSTMVIDGKMVKVV  159 (163)
T ss_dssp             EEESCSSCEEEEEEEEESSC-CCHHHHHHHHHHHHHTTTTTTEEEECSCCCGGGGTTCCSSEEEEGGGCEEETTTEEEEE
T ss_pred             EecCCCcceeEEEEEEecCc-CCHHHHHHHHHHHhcCCccCcceeeecccchhhccCCCccEEEEcccCEEECCCEEEEE
Confidence            99999999999999999998 89999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEec
Q 012940          400 AWYD  403 (453)
Q Consensus       400 ~WYD  403 (453)
                      +|||
T Consensus       160 aWYD  163 (163)
T d3cmco2         160 SWYD  163 (163)
T ss_dssp             EEEC
T ss_pred             EEeC
Confidence            9999
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cvoa2 d.81.1.1 (A:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure