Citrus Sinensis ID: 012978

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450--

MSQNNVQLDPIRNAQLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRVIPSTEDDVQEKEDAQISGEFRDNRAIVDDNKAQCLSGEDIDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEAYFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFNFSNEICKSIVRASVSDVTSQSETSEQSDQLESACNMEIQSNEQKSSSVSMEDISLSSENGVSDLILEANHSPVNKISKSHKVGEKASQETLKLWKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEPWLREYQVLPSRTHPCMQMSGCGGYILSGTRTATNASSQQ

cccccccccccccccccccccEEEEEcccccEEEEEEEccccEEEEcccEEEcccccccccccEEEEEcccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHcccccEEEEEcccccccccHHHHccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHcccEEEEEccccHHHcccccccccccccccccccEEEEEEEEEEccccccc

cccccccccccccccEEccccEEEEEEccccEEEEEEEEcccEEEEEcccEccHHHccccccEEEEEEccccccccEEEEccccccccHHHHcccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcEEEEccccHHHHHHHHHHccHHHHHHHcHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHcccccEEEEEccccccccHHHHHHccccHHHHHHHHcccHHHHHcccccccccccccccccHHHccccccccHHcHHHccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHcccEEEEEEEcccccccEEccccccccEEEccccEEEEEEEEEcccccccc

msqnnvqldpirnaqltwEGCSVlldindgdRLVFARltsgstlkignkncslqpligcpfgslfqvdngkegpnlsrvipsteddvqekedaqisgefrdnraivddnkaqclsgediDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKkqkkyapkvllrrpFARSICEAYFkknparigFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAErlggtgyvcntcigdslypmDIVRIFNFSNEICKSIVRASvsdvtsqsetseqsDQLESACNMEiqsneqksssvsmedislssengvSDLILEanhspvnkiskshkvgEKASQETLKLWKENGFSSMivvapeldpwsfvkdllpllsysapfaiYHQYLQPLATCMHSLQVRKMAIGLqisepwlreyqvlpsrthpcmqmsgcggyilsgtrtatnassqq

msqnnvqldpirnaQLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSrvipsteddvqeKEDAqisgefrdnraivddnkaqclsgediDEMRRQGATGEEIVEALIansatfekktsfsqekyklkkqkkyapkvllrrpFARSICEAYfkknpariGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFNFSNEICKSIVRASVSDVTSQSETSEQSDQLESACNMEIQSNEQKSSSVSMEDISLSSENGVSDLILEANHspvnkiskshkvgEKASQETLKLWKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEPWLREYQVLPSRTHPCMQMSGCGGYILSGTRTATNASSQQ

MSQNNVQLDPIRNAQLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRVIPSTEDDVQEKEDAQISGEFRDNRAIVDDNKAQCLSGEDIDEMRRQGATGEEIVEALIANSATFEKKTSFSQEkyklkkqkkyapkvllRRPFARSICEAYFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFNFSNEICKSIVRAsvsdvtsqsetseqsdQLESACNMEIQSNEQKSSSVSMEDISLSSENGVSDLILEANHSPVNKISKSHKVGEKASQETLKLWKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEPWLREYQVLPSRTHPCMQMSGCGGYILSGTRTATNASSQQ

**********IRNAQLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVD***************************************************************IVEALIAN********************KKYAPKVLLRRPFARSICEAYFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFNFSNEICKSIVRA******************************************************************************LKLWKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEPWLREYQVLPSRTHPCMQMSGCGGYILS************

***************LTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRV*****DDV******************VDDNKAQCLSGEDID***********IV*ALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEAYFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFNFSNEICKSIVRASVSDVTS*****************************************************************KASQETLKLWKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEPWLREYQVLPSRTHPCMQMSGCGGYILSGT***T******

MSQNNVQLDPIRNAQLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRVIPST**********QISGEFRDNRAIVDDNKAQCLSGEDIDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEAYFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFNFSNEICKSIVRAS******************SACNME******************SSENGVSDLILEANHSPVNK***********SQETLKLWKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEPWLREYQVLPSRTHPCMQMSGCGGYILSGTR*********

***********RNAQLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRVIPS****************************AQCLSGEDIDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEAYFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFNFSNEICKSIVRASVSDVTSQ***************************************************PVNKISKSHKVGEKASQETLKLWKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEPWLREYQVLPSRTHPCMQMSGCGGYILSGTRTATN*****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		452	2.2.26 [Sep-21-2011]
Q54UB1		521	tRNA (adenine(58)-N(1))-m	yes	no	0.907	0.786	0.344	2e-57
Q9UJA5		497	tRNA (adenine(58)-N(1))-m	yes	no	0.867	0.788	0.290	2e-40
Q8CE96		497	tRNA (adenine(58)-N(1))-m	yes	no	0.869	0.790	0.303	4e-40
Q2T9V5		497	tRNA (adenine(58)-N(1))-m	yes	no	0.856	0.778	0.303	6e-40
P0CS06		560	tRNA (adenine(58)-N(1))-m	yes	no	0.694	0.560	0.316	2e-34
P0CS07		560	tRNA (adenine(58)-N(1))-m	N/A	no	0.694	0.560	0.316	2e-34
Q6BKK7		473	tRNA (adenine(58)-N(1))-m	yes	no	0.807	0.771	0.259	2e-31
Q5A6Q4		453	tRNA (adenine(58)-N(1))-m	N/A	no	0.778	0.777	0.273	1e-30
Q9HGL4		462	tRNA (adenine(58)-N(1))-m	yes	no	0.889	0.870	0.261	2e-28
Q6CF35		487	tRNA (adenine(58)-N(1))-m	yes	no	0.794	0.737	0.25	5e-23

>sp\|Q54UB1\|TRM6_DICDI tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 OS=Dictyostelium discoideum GN=trmt6 PE=3 SV=1	Back alignment and function desciption

 Score =  223 bits (569), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 148/429 (34%), Positives = 235/429 (54%), Gaps = 19/429 (4%)

Query: 19  EGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSR 78
           EG  V+LDIN+G++    ++  GS +KIG K   +  +IG  + S FQV N  E   L R
Sbjct: 37  EGDHVILDINNGEKFSVIKVKLGSKVKIGKKQILINSIIGESYYSSFQVSN--EKNTLER 94

Query: 79  VIPSTEDDVQEKEDAQISGEFRDNRAIVDDNKAQCLSGEDIDEMRRQGATGEEIVEALIA 138
           +     DD +     +++    DNR +  +N AQ L+ EDI+EM+++G     I++ ++ 
Sbjct: 95  ITQKEIDD-RLNNLVELNQNDADNRNLDQNNTAQKLTQEDINEMKQKGTDSNTIIKTIVE 153

Query: 139 NSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEAYFKKNPARIGFLRVDMLSL 198
           NS +F+ KTSFSQ KY  KK KKY+  V + +P  +S+ EAY+KK+  +I  LR D    
Sbjct: 154 NSESFKTKTSFSQIKYLKKKIKKYSTIVKIIKPTLKSLTEAYYKKDSRKICGLRFDSFGQ 213

Query: 199 LLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFNFSNE 258
           LL++GN+ ANS VLVV+   GL+TG++AER+ G G + +  IG     + IV  F F+ +
Sbjct: 214 LLTLGNIRANSQVLVVETCMGLVTGSIAERMNGQGTILSAYIGKG-PSLSIVNNFGFNTD 272

Query: 259 ICKSI--VRASVSDVTSQSETSEQSDQLESACNMEIQSNEQKSSSVSMEDISLSSENGVS 316
           +  +I     +++ V ++ E   +     S+   + Q  E++      E++    E+G  
Sbjct: 273 VLNTIYPFNLNITSVLNKGEDISKLPPTASSGIYDKQVKEKEKEKEKDENVKDEKESG-- 330

Query: 317 DLILEANHSPVNKISKSHKVGEKASQETLKLWKENGFSSMIVVAPELDPWSFVKDLLPLL 376
               E   + +N      +  + +++  +KL K+ G  S+++V  +  P + +    P L
Sbjct: 331 ----EEAKTIIN------QRNDTSNENIVKLLKDGGVWSLVIVT-KYSPLNILLSCWPYL 379

Query: 377 SYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEPWLREYQVLPSRTHPCMQMSGCGG 436
           + S  F IY Q+ QPL      L   +MA+  QISE W+RE+QVLP RTHP M M G  G
Sbjct: 380 NSSGSFVIYSQFPQPLMEVHQFLHKNQMAVNQQISEIWMREHQVLPKRTHPMMGMDGASG 439

Query: 437 YILSGTRTA 445
           +IL GT+  
Sbjct: 440 FILYGTKVT 448

Substrate-binding subunit of tRNA (adenine-N(1)-)-methyltransferase, which catalyzes the formation of N(1)-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA.
Dictyostelium discoideum (taxid: 44689)

>sp\|Q9UJA5\|TRM6_HUMAN tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens GN=TRMT6 PE=1 SV=1	Back alignment and function description

>sp\|Q8CE96\|TRM6_MOUSE tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Mus musculus GN=Trmt6 PE=1 SV=1	Back alignment and function description

>sp\|Q2T9V5\|TRM6_BOVIN tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Bos taurus GN=TRMT6 PE=2 SV=1	Back alignment and function description

>sp\|P0CS06\|TRM6_CRYNJ tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRM6 PE=3 SV=1	Back alignment and function description

>sp\|P0CS07\|TRM6_CRYNB tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TRM6 PE=3 SV=1	Back alignment and function description

>sp\|Q6BKK7\|TRM6_DEBHA tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TRM6 PE=3 SV=2	Back alignment and function description

>sp\|Q5A6Q4\|TRM6_CANAL tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM6 PE=3 SV=1	Back alignment and function description

>sp\|Q9HGL4\|TRM6_SCHPO tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcd10 PE=3 SV=1	Back alignment and function description

>sp\|Q6CF35\|TRM6_YARLI tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRM6 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		452
225458003		464	PREDICTED: tRNA (adenine-N(1)-)-methyltr	1.0	0.974	0.727	0.0
356562401		440	PREDICTED: tRNA (adenine-N(1)-)-methyltr	0.951	0.977	0.698	1e-178
255538914		514	translation initiation factor, putative	0.944	0.830	0.696	1e-173
357438383		457	tRNA (adenine-N(1)-)-methyltransferase n	0.953	0.943	0.666	1e-173
224085855		434	predicted protein [Populus trichocarpa]	0.960	1.0	0.677	1e-171
356552066		423	PREDICTED: tRNA (adenine-N(1)-)-methyltr	0.915	0.978	0.695	1e-171
449469893		448	PREDICTED: tRNA (adenine(58)-N(1))-methy	0.962	0.970	0.671	1e-166
18406875		446	translation initiation factor eIF-3 subu	0.962	0.975	0.639	1e-151
297828295		446	eukaryotic initiation factor 3 gamma sub	0.962	0.975	0.628	1e-150
224062013		387	predicted protein [Populus trichocarpa]	0.856	1.0	0.620	1e-146

>gi\|225458003\|ref\|XP_002280127.1\| PREDICTED: tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit trm6 [Vitis vinifera] gi\|302142647\|emb\|CBI19850.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/463 (72%), Positives = 384/463 (82%), Gaps = 11/463 (2%)

Query: 1   MSQNNVQLDPIRNAQLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCP 60
           MSQN++Q D I+N ++TWEGCSVLLDINDGDRLVFARL++ +TLKIGNKNCSLQPLIGCP
Sbjct: 1   MSQNSLQNDSIQNPRVTWEGCSVLLDINDGDRLVFARLSASATLKIGNKNCSLQPLIGCP 60

Query: 61  FGSLFQVDNGKEGPNLSRVIPSTE-DDVQEKEDAQISGEFRDNRAIVDDNKAQCLSGEDI 119
           FGSLFQVDNG  GP LSRV PS E +D+QE +D Q+  E +DNRAIVD+NKAQ L+GEDI
Sbjct: 61  FGSLFQVDNGPRGPYLSRVTPSAEGNDLQETQDCQLKDEPKDNRAIVDNNKAQSLTGEDI 120

Query: 120 DEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEA 179
           DEMRRQGATG+EIVEALI+NSAT+EKKTSFSQEKY+LKKQKKY+P+VLLRRPF RSICEA
Sbjct: 121 DEMRRQGATGDEIVEALISNSATYEKKTSFSQEKYRLKKQKKYSPRVLLRRPFCRSICEA 180

Query: 180 YFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTC 239
           YFKK PARIGFLRVD LSLLLSM N+AA+SDVLVVDM GGLLTGAVAERLGGTGYVCN  
Sbjct: 181 YFKKYPARIGFLRVDTLSLLLSMANIAAHSDVLVVDMVGGLLTGAVAERLGGTGYVCNAY 240

Query: 240 IGDSLYPMDIVRIFNFSNEICKSIVRASVSDVTS-QSETSEQSDQLESACNMEIQSNEQK 298
           +GD+ YPMDIVRIFNFS+EICK IVR+ V  + S Q  TSEQ  Q +   N EIQSNEQ 
Sbjct: 241 LGDTPYPMDIVRIFNFSSEICKRIVRSPVDGLRSIQDGTSEQFFQHKGVSNSEIQSNEQM 300

Query: 299 SS------SVSMEDISLSSENGVSDLI---LEANHSPVNKISKSHKVGEKASQETLKLWK 349
           SS      S+S E+ +LSSENG+ DLI   + A+   V K  K+ K GE AS + + LWK
Sbjct: 301 SSQDSFPHSISTEETTLSSENGMLDLIPQMVTASPPQVAKTCKATKAGENASLDAINLWK 360

Query: 350 ENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQ 409
           ENGFSS+++ APELD WS V++ LP LSYSA FAIYHQYLQPLATCMH+LQ+ KMAIGLQ
Sbjct: 361 ENGFSSLLIAAPELDVWSIVQEFLPFLSYSASFAIYHQYLQPLATCMHNLQLGKMAIGLQ 420

Query: 410 ISEPWLREYQVLPSRTHPCMQMSGCGGYILSGTRTATNASSQQ 452
           ISEPWLREYQVLPSRTHPCMQMS  GGYILSGTR  ++ S  Q
Sbjct: 421 ISEPWLREYQVLPSRTHPCMQMSAFGGYILSGTRICSSDSQIQ 463

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356562401\|ref\|XP_003549460.1\| PREDICTED: tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit trm6-like [Glycine max]	Back alignment and taxonomy information

>gi\|255538914\|ref\|XP_002510522.1\| translation initiation factor, putative [Ricinus communis] gi\|223551223\|gb\|EEF52709.1\| translation initiation factor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|357438383\|ref\|XP_003589467.1\| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit trm6 [Medicago truncatula] gi\|355478515\|gb\|AES59718.1\| tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit trm6 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|224085855\|ref\|XP_002307715.1\| predicted protein [Populus trichocarpa] gi\|222857164\|gb\|EEE94711.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356552066\|ref\|XP_003544392.1\| PREDICTED: tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit trm6-like [Glycine max]	Back alignment and taxonomy information

>gi\|449469893\|ref\|XP_004152653.1\| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6-like [Cucumis sativus] gi\|449521762\|ref\|XP_004167898.1\| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|18406875\|ref\|NP_566054.1\| translation initiation factor eIF-3 subunit P62 [Arabidopsis thaliana] gi\|3386622\|gb\|AAC28552.1\| expressed protein [Arabidopsis thaliana] gi\|17473624\|gb\|AAL38275.1\| unknown protein [Arabidopsis thaliana] gi\|22136132\|gb\|AAM91144.1\| unknown protein [Arabidopsis thaliana] gi\|330255499\|gb\|AEC10593.1\| translation initiation factor eIF-3 subunit P62 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297828295\|ref\|XP_002882030.1\| eukaryotic initiation factor 3 gamma subunit family protein [Arabidopsis lyrata subsp. lyrata] gi\|297327869\|gb\|EFH58289.1\| eukaryotic initiation factor 3 gamma subunit family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|224062013\|ref\|XP_002300711.1\| predicted protein [Populus trichocarpa] gi\|222842437\|gb\|EEE79984.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		452
TAIR\|locus:2043714		446	AT2G45730 [Arabidopsis thalian	0.962	0.975	0.599	3.3e-134
DICTYBASE\|DDB_G0281175		521	trmt6 "tRNA(m1A58)-methyltrans	0.907	0.786	0.329	6.3e-53
ZFIN\|ZDB-GENE-051120-141		464	trmt6 "tRNA methyltransferase	0.823	0.801	0.301	7.3e-43
UNIPROTKB\|F1NF40		484	TRMT6 "Uncharacterized protein	0.384	0.359	0.355	6.9e-40
RGD\|1308877		495	Trmt6 "tRNA methyltransferase	0.400	0.365	0.347	1.2e-39
UNIPROTKB\|Q2T9V5		497	TRMT6 "tRNA (adenine(58)-N(1))	0.621	0.565	0.290	2.6e-39
UNIPROTKB\|F1SBM2		497	TRMT6 "Uncharacterized protein	0.384	0.350	0.333	4.4e-39
UNIPROTKB\|F1P960		497	TRMT6 "Uncharacterized protein	0.382	0.348	0.347	6.4e-39
UNIPROTKB\|Q9UJA5		497	TRMT6 "tRNA (adenine(58)-N(1))	0.382	0.348	0.347	8.2e-39
MGI\|MGI:1914176		497	Trmt6 "tRNA methyltransferase	0.400	0.364	0.347	1e-38

TAIR\|locus:2043714 AT2G45730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1315 (468.0 bits), Expect = 3.3e-134, P = 3.3e-134
 Identities = 268/447 (59%), Positives = 325/447 (72%)

Query:     1 MSQNNVQLDPIRNAQLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCP 60
             MS++    DP  N +   EGCSVLLDINDGDRLVFARL+SG+ LKIGNKN SL+PLIG P
Sbjct:    10 MSEDKKPQDP--NPRFACEGCSVLLDINDGDRLVFARLSSGAILKIGNKNYSLKPLIGAP 67

Query:    61 FGSLFQVDNGKEGPNLSRVIPSTEDDVQEKEDAQISGEFRDNRAIVDDNKAQCLSGEDID 120
             FGSLFQV+ G++G  LSR++P      QE     +  + RDNR IVD+N+AQ L+GE+I+
Sbjct:    68 FGSLFQVETGEDGSFLSRILPIK----QESNSNNVMDDSRDNREIVDNNEAQNLTGEEIE 123

Query:   121 EMRRQGATGEEIVEALIANSATFEKKTSFSQEXXXXXXXXXXXXXXXXRRPFARSICEAY 180
              MRR+GA G+EI+EALIANS TF+KK   SQE                RRPFARSICEAY
Sbjct:   124 AMRREGAKGDEIIEALIANSKTFDKKFQLSQEKYKLKKQKKYAPKLLLRRPFARSICEAY 183

Query:   181 FKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCI 240
             FKK PARIGFLRVD LSLLL+M NV A SDVLVVDM GGL+TGAVAERLGGTGYVCNT  
Sbjct:   184 FKKYPARIGFLRVDALSLLLTMANVTAYSDVLVVDMVGGLVTGAVAERLGGTGYVCNTYK 243

Query:   241 GDSLYPMDIVRIFNFSNEICKSIVRAXXXXXXXXXXXXXXXX-QLESACNMEIQSNEQKS 299
             G S YP+++VR+FNFS+++ K IV++                 Q E  C  E   NE  +
Sbjct:   244 GSSPYPVEMVRMFNFSDKVLKRIVQSSINELSSAKTASTEGNNQQEGVCKAENNINETAT 303

Query:   300 SSVSMEDISLSSENGVSDLILEANHSPVNKISKSHKVGEKASQETLKLWKENGFSSMIVV 359
             S V +E+IS+++E GV D+++     P +KI K+ K G KAS+ET+++W+ENGFSS+I+ 
Sbjct:   304 SDVMVEEISVTTEAGVVDIVV-----PESKIIKAAKAGAKASKETIEMWQENGFSSLIMA 358

Query:   360 APELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEPWLREYQ 419
             A + DPW   KD+LPLLSYSAPFAIYHQYLQPLATCMH LQ  KMAI LQI+EPWLREYQ
Sbjct:   359 AQDQDPWIVAKDVLPLLSYSAPFAIYHQYLQPLATCMHKLQQGKMAINLQITEPWLREYQ 418

Query:   420 VLPSRTHPCMQMSGCGGYILSGTRTAT 446
             VLPSR+HP MQMS  GGY+LSG R +T
Sbjct:   419 VLPSRSHPHMQMSSFGGYVLSGIRIST 445

GO:0003743 "translation initiation factor activity" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

GO:0006446 "regulation of translational initiation" evidence=ISS

GO:0000278 "mitotic cell cycle" evidence=RCA

GO:0006396 "RNA processing" evidence=RCA

GO:0006606 "protein import into nucleus" evidence=RCA

GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA

DICTYBASE\|DDB_G0281175 trmt6 "tRNA(m1A58)-methyltransferase subunit" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-051120-141 trmt6 "tRNA methyltransferase 6 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NF40 TRMT6 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|1308877 Trmt6 "tRNA methyltransferase 6 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2T9V5 TRMT6 "tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SBM2 TRMT6 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P960 TRMT6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UJA5 TRMT6 "tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1914176 Trmt6 "tRNA methyltransferase 6" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		452
pfam04189		299	pfam04189, Gcd10p, Gcd10p family	5e-73

>gnl\|CDD\|217952 pfam04189, Gcd10p, Gcd10p family	Back alignment and domain information

 Score =  231 bits (591), Expect = 5e-73
 Identities = 95/262 (36%), Positives = 141/262 (53%), Gaps = 9/262 (3%)

Query: 19  EGCSVLLDINDGDRLVFARLTSGSTLKIGN-KNCSLQPLIGCPFGSLFQVDN-------G 70
           EG  V+L     +RL   +L     + +G   +     +IG P+G+ F++D        G
Sbjct: 6   EGDHVIL-RLPSERLKIVKLQPNGKVSLGKFGSFPANDIIGLPYGTTFEIDEDKELRVIG 64

Query: 71  KEGPNLSRVIPSTEDDVQEKEDAQISGEFRDNRAIVDDNKAQCLSGEDIDEMRRQGATGE 130
           +    L     S E D  + E  +IS   RDNR IVDD  +Q L+ E+I+ ++++GA+GE
Sbjct: 65  RVEVLLQLYPDSDETDSDDPETLEISESSRDNRNIVDDGSSQKLTMEEIEALKKEGASGE 124

Query: 131 EIVEALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARSICEAYFKKNPARIGF 190
           EI+E L+ NS TF  KT+FSQEKY  +K+KKY  +  + RP    + E Y +K+P +I  
Sbjct: 125 EIIEKLVENSETFHTKTAFSQEKYLKRKKKKYLKRFTVLRPSISLLAEYYIEKDPQKILD 184

Query: 191 LRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIV 250
           LR D L L+L++ NV      LVVD  GGLL  A+ ER+GG G +     G+    +D++
Sbjct: 185 LRFDTLGLILTLANVRPGGRYLVVDETGGLLVAAMLERMGGEGKIVQIHEGEHPPNLDLL 244

Query: 251 RIFNFSNEICKSIVRASVSDVT 272
           +  NF  E  KS+        T
Sbjct: 245 KYMNFPPEFLKSVEPIDAHLKT 266

eIF-3 is a multi-subunit complex that stimulates translation initiation in vitro at several different steps. This family corresponds to the gamma subunit if eIF3. The Yeast protein Gcd10p has also been shown to be part of a complex with the methyltransferase Gcd14p that is involved in modifying tRNA. Length = 299

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		452
KOG1416		475	consensus tRNA(1-methyladenosine) methyltransferas	100.0
PF04189		299	Gcd10p: Gcd10p family; InterPro: IPR007316 eIF-3 i	100.0
COG2519		256	GCD14 tRNA(1-methyladenosine) methyltransferase an	100.0
PF08704		247	GCD14: tRNA methyltransferase complex GCD14 subuni	99.95
KOG2915		314	consensus tRNA(1-methyladenosine) methyltransferas	99.93
PRK00377		198	cbiT cobalt-precorrin-6Y C(15)-methyltransferase;	98.64
PF14801		54	GCD14_N: tRNA methyltransferase complex GCD14 subu	98.28
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	98.06
COG2242		187	CobL Precorrin-6B methylase 2 [Coenzyme metabolism	97.97
PLN02476		278	O-methyltransferase	97.93
PRK07402		196	precorrin-6B methylase; Provisional	97.87
PF01135		209	PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl	97.73
PRK04266		226	fibrillarin; Provisional	97.72
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	97.7
PLN02781		234	Probable caffeoyl-CoA O-methyltransferase	97.54
PRK11933		470	yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF;	97.47
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	97.44
COG2518		209	Pcm Protein-L-isoaspartate carboxylmethyltransfera	97.42
PRK14902		444	16S rRNA methyltransferase B; Provisional	97.31
COG4122		219	Predicted O-methyltransferase [General function pr	97.31
PRK14967		223	putative methyltransferase; Provisional	97.31
PLN02589		247	caffeoyl-CoA O-methyltransferase	97.22
KOG1661		237	consensus Protein-L-isoaspartate(D-aspartate) O-me	97.2
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	97.2
PF01596		205	Methyltransf_3: O-methyltransferase; InterPro: IPR	97.15
TIGR00438		188	rrmJ cell division protein FtsJ.	96.98
PRK10901		427	16S rRNA methyltransferase B; Provisional	96.95
PRK14903		431	16S rRNA methyltransferase B; Provisional	96.91
TIGR00446		264	nop2p NOL1/NOP2/sun family putative RNA methylase.	96.89
PTZ00146		293	fibrillarin; Provisional	96.88
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	96.86
PRK14901		434	16S rRNA methyltransferase B; Provisional	96.8
PRK00121		202	trmB tRNA (guanine-N(7)-)-methyltransferase; Revie	96.78
PRK13943		322	protein-L-isoaspartate O-methyltransferase; Provis	96.78
PRK11873		272	arsM arsenite S-adenosylmethyltransferase; Reviewe	96.76
PRK14968		188	putative methyltransferase; Provisional	96.61
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	96.44
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	96.38
PRK14904		445	16S rRNA methyltransferase B; Provisional	96.38
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	96.34
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	96.25
TIGR00537		179	hemK_rel_arch HemK-related putative methylase. The	96.23
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	96.23
PLN02233		261	ubiquinone biosynthesis methyltransferase	96.17
TIGR00091		194	tRNA (guanine-N(7)-)-methyltransferase. In E. coli	95.99
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	95.91
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	95.49
PRK00811		283	spermidine synthase; Provisional	95.46
PRK01581		374	speE spermidine synthase; Validated	95.41
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	94.96
PLN03075		296	nicotianamine synthase; Provisional	94.89
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	94.81
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	94.77
PRK04457		262	spermidine synthase; Provisional	94.63
PRK11705		383	cyclopropane fatty acyl phospholipid synthase; Pro	94.62
TIGR00563		426	rsmB ribosomal RNA small subunit methyltransferase	94.22
PRK08317		241	hypothetical protein; Provisional	93.99
PLN02366		308	spermidine synthase	93.81
PRK15451		247	tRNA cmo(5)U34 methyltransferase; Provisional	93.77
TIGR00406		288	prmA ribosomal protein L11 methyltransferase. Ribo	93.65
TIGR00452		314	methyltransferase, putative. Known examples to dat	93.36
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	93.35
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	93.3
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	93.14
PRK15068		322	tRNA mo(5)U34 methyltransferase; Provisional	92.98
PRK14121		390	tRNA (guanine-N(7)-)-methyltransferase; Provisiona	92.95
PRK03612		521	spermidine synthase; Provisional	92.92
TIGR01934		223	MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis	92.67
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	92.52
PLN02244		340	tocopherol O-methyltransferase	92.03
TIGR00740		239	methyltransferase, putative. A simple BLAST search	91.9
PRK15128		396	23S rRNA m(5)C1962 methyltransferase; Provisional	91.6
KOG1709		271	consensus Guanidinoacetate methyltransferase and r	90.89
PLN02823		336	spermine synthase	90.72
COG3963		194	Phospholipid N-methyltransferase [Lipid metabolism	90.55
PF01269		229	Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr	90.38
PF13659		117	Methyltransf_26: Methyltransferase domain; PDB: 3G	90.11
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	90.07
COG0144		355	Sun tRNA and rRNA cytosine-C5-methylases [Translat	89.93
KOG1663		237	consensus O-methyltransferase [Secondary metabolit	89.92
PLN02396		322	hexaprenyldihydroxybenzoate methyltransferase	89.76
COG0421		282	SpeE Spermidine synthase [Amino acid transport and	89.39
PLN02490		340	MPBQ/MSBQ methyltransferase	89.22
TIGR03704		251	PrmC_rel_meth putative protein-(glutamine-N5) meth	89.14
TIGR01848		107	PHA_reg_PhaR polyhydroxyalkanoate synthesis repres	88.73
PRK00216		239	ubiE ubiquinone/menaquinone biosynthesis methyltra	88.15
TIGR01177		329	conserved hypothetical protein TIGR01177. This fam	88.13
PRK15001		378	SAM-dependent 23S ribosomal RNA mG1835 methyltrans	88.05
PRK09489		342	rsmC 16S ribosomal RNA m2G1207 methyltransferase;	87.63
PF13847		152	Methyltransf_31: Methyltransferase domain; PDB: 3T	87.47
KOG1596		317	consensus Fibrillarin and related nucleolar RNA-bi	87.23
smart00650		169	rADc Ribosomal RNA adenine dimethylases.	86.88
PRK13168		443	rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe	86.88
PF05175		170	MTS: Methyltransferase small domain; InterPro: IPR	86.85
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	86.83
cd08239		339	THR_DH_like L-threonine dehydrogenase (TDH)-like.	86.26
PLN02336		475	phosphoethanolamine N-methyltransferase	86.15
PRK10481		224	hypothetical protein; Provisional	85.58
TIGR03533		284	L3_gln_methyl protein-(glutamine-N5) methyltransfe	85.53
PRK11805		307	N5-glutamine S-adenosyl-L-methionine-dependent met	85.29
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	85.29
PRK09328		275	N5-glutamine S-adenosyl-L-methionine-dependent met	85.22
PRK00274		272	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	84.54
PF05401		201	NodS: Nodulation protein S (NodS); InterPro: IPR00	84.21
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	84.02
PRK10258		251	biotin biosynthesis protein BioC; Provisional	83.86
KOG0024		354	consensus Sorbitol dehydrogenase [Secondary metabo	83.85
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	83.53
TIGR02825		325	B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15	82.58
PRK06922		677	hypothetical protein; Provisional	82.42
TIGR00536		284	hemK_fam HemK family putative methylases. The gene	82.31
COG4798		238	Predicted methyltransferase [General function pred	82.12
PHA03411		279	putative methyltransferase; Provisional	81.19
PRK11207		197	tellurite resistance protein TehB; Provisional	80.82
PRK14966		423	unknown domain/N5-glutamine S-adenosyl-L-methionin	80.64
COG1063		350	Tdh Threonine dehydrogenase and related Zn-depende	80.08
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	80.06
TIGR00479		431	rumA 23S rRNA (uracil-5-)-methyltransferase RumA.	80.01

>KOG1416 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD10 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=3.2e-97  Score=744.44  Aligned_cols=423  Identities=40%  Similarity=0.578  Sum_probs=336.0

Q ss_pred             CCCCCccCCCEEEEEeCCCCeEEEEEEccCCEEEEcceeeecCCccCCC----CCcEEEEeCCCCCCCccccCCCCcchh
Q 012978           12 RNAQLTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCP----FGSLFQVDNGKEGPNLSRVIPSTEDDV   87 (452)
Q Consensus        12 ~~~~~i~eGd~Vll~~~~g~~~~~v~l~~~~~v~~gK~~f~~~~lIG~p----yG~~fei~~~~~~~~~~~~~~~~d~~~   87 (452)
                      ++...|+.|++|+|...||.+..+++..++++|.+||..|.+|+++|+|    ||+.|++..+.......+..+    ..
T Consensus        13 ps~~~i~~g~~v~L~k~d~~~~v~v~~~~~~~i~~~k~~f~~d~~~gkpk~~~~g~~fe~~~~e~~~~~s~~~~----~~   88 (475)
T KOG1416|consen   13 PSKIEIKSGTSVKLQKFDGFRVVDVRGGPTKKILIGKEGFSADNLFGKPKNRLLGQEFEVTNEEKDDGLSSPPL----SK   88 (475)
T ss_pred             CCceeecCCceEEeeccCCceeeeeecccccEEEeccccccchhhhCCCCccccchhhhhhcccccccccccCc----cc
Confidence            3446889999999999999877776777999999999669999999999    999999988743222111110    01


Q ss_pred             hhhhhhhccccccCccccccCcccccCCHHHHHHHHHcCCChHHHHHHHHhccccccccccccHHHHHHHhhhccCCcEE
Q 012978           88 QEKEDAQISGEFRDNRAIVDDNKAQCLSGEDIDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKYAPKVL  167 (452)
Q Consensus        88 ~~~~~~~~~~~~~dNr~i~Dd~~~QkLs~eeI~~lK~~g~sG~eII~~LvenS~tF~~KT~FSqeKYlkkK~kKy~~~~~  167 (452)
                      .+.+..+..++++|||+|+|++++|+||.|||++||++|++|+|||++||+||+||++||+||||||++||+|||+.+|+
T Consensus        89 ~e~ev~~~~e~s~dNr~ivd~~kaQ~Lt~EeI~~mr~eg~~g~EiI~kLienSkTF~~KT~fSQeKYv~rK~kKy~~~~~  168 (475)
T KOG1416|consen   89 KEREVLEISESSADNREIVDDGKAQKLTQEEIEEMRQEGLSGEEIIEKLIENSKTFHNKTVFSQEKYVLRKKKKYAKRFQ  168 (475)
T ss_pred             cccccccccccCCCchhhhcccccccCCHHHHHHHHHhccCHHHHHHHHHhcCcccccchhhhHHHHHHHHhhhhhhhee
Confidence            12445778899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCChHHHHHHHHhcCcccccccchhHHHHHHHhcCCCCCCeEEEEeCCCcHHHHHHHHHhCCCceEEEeecCCCCCch
Q 012978          168 LRRPFARSICEAYFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPM  247 (452)
Q Consensus       168 i~~pt~~~l~e~y~~Kdp~Ki~~lR~DtLa~iL~~anI~~g~rvLv~d~~~GlltaAv~ermgg~G~v~~~~~~~~~~~~  247 (452)
                      |++||+|+||++||.|||+||++||.|+|||||+||||++|++|||+|.|+||++|||+|||||.|.|+++|+|.+|+ .
T Consensus       169 v~rPt~r~l~~~yy~kdp~rI~~lr~D~Lsl~Ltlanv~~g~~~Lv~d~tgGL~~galleRmgG~G~i~~~hpG~vp~-~  247 (475)
T KOG1416|consen  169 VLRPTIRLLLQAYYDKDPQRILDLRADTLSLLLTLANVQAGGNYLVVDETGGLLLGALLERMGGTGDIIHKHPGKVPQ-I  247 (475)
T ss_pred             eechhHHHHHHHHHHhChHHHhhhhHHHHHHHHHHhCcccCCeEEEEecCCcchHHHHHHHhcCCceeEEecCCCCch-H
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999997 8


Q ss_pred             hhhhhcCCCHHHHHhhhccccccccccC---cCccc--chhhhhhhhhhcccccccCCCCccccccccccccc-chhhhh
Q 012978          248 DIVRIFNFSNEICKSIVRASVSDVTSQS---ETSEQ--SDQLESACNMEIQSNEQKSSSVSMEDISLSSENGV-SDLILE  321 (452)
Q Consensus       248 ~~~~~~nf~~~~~~~~~~~~l~~l~~~~---~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~  321 (452)
                      .++..|||+...+++++.+||+.+.++.   ...+.  +...+++.+.    ++.. .++...+.+...+.+. .+.. +
T Consensus       248 ~~~~~~~~~d~~l~~lv~~~i~~vl~~~h~~~~~~~~~~~ve~~e~~l----~E~~-~~~~~~eE~~a~~~~~~~~~i-~  321 (475)
T KOG1416|consen  248 SAVLIFNFPDANLDRLVQVNINEVLSKKHVTTDANLLYSVVEPPENEL----NETQ-LSPLPKEEPEAIEPGKLKNTI-D  321 (475)
T ss_pred             HHHHHhcCchhhhhheeeccHHHHhHhhhcCCccccccceecCCCCch----hhhc-cCCcccccchhcCCCcccccc-c
Confidence            9999999999999999999999885311   11110  0111111111    1100 0000111110000000 0000 0


Q ss_pred             cCCCccccccccccc--cccchHHHHHHhhhcCcceEEEeCCCCChHHHHHhHHh---cccCCCcEEEEeCChHHHHHHH
Q 012978          322 ANHSPVNKISKSHKV--GEKASQETLKLWKENGFSSMIVVAPELDPWSFVKDLLP---LLSYSAPFAIYHQYLQPLATCM  396 (452)
Q Consensus       322 ~~~~~~~~~~k~~~~--~~~~~~~~~~~~~~~~~D~liia~~~~dP~~il~~ll~---~L~pS~p~VVYsp~~epL~e~~  396 (452)
                          ...+..++.+.  ......+..+.|...++-++++.....|||.+++.++|   +|+|||||||||||.|||++||
T Consensus       322 ----~~~~~~r~~~~~~s~~~~~~~~~~~~~~~~~s~~~~~~~~d~~vvae~~hpll~~l~pSrp~viy~q~ke~L~e~~  397 (475)
T KOG1416|consen  322 ----HKESLIRKAKWYNSQWQIKEGIEEWLYEGLVSAILMHRPTDPLVVAEKIHPLLDNLAPSRPIVIYSQYKEPLQECY  397 (475)
T ss_pred             ----cchhhhhhhhhhhhhhhhhhhhhhhhhcchhhhhhhcccccchhhHHHhcccccccCCCCCEEEeechhHHHHHHH
Confidence                00011111111  01123445567777777777777666788888877766   9999999999999999999999


Q ss_pred             HHHHhccCccceeeeeeeeeeeeecCCCCCCCCcccCceEEEEEEEEecCCCC
Q 012978          397 HSLQVRKMAIGLQISEPWLREYQVLPSRTHPCMQMSGCGGYILSGTRTATNAS  449 (452)
Q Consensus       397 ~~L~~~~~~v~l~l~E~~lR~yQVLP~RTHP~m~m~~~~GyiLsg~kv~~~~~  449 (452)
                      ++|++.+.++|++|+|+|+|.|||||+||||.|+|+|.|||||||+||.+.+.
T Consensus       398 ~~L~~~~~vinL~ite~wlR~YQVLP~RtHP~M~msg~gGylLsGikv~~~~~  450 (475)
T KOG1416|consen  398 HKLYQRGKVINLSITETWLRPYQVLPDRTHPLMTMSGGGGYLLSGIKVITAPE  450 (475)
T ss_pred             HHHhhcCceEeeeechhhccceeecCCCCCcceEeecCCceEEeeeEEecCcc
Confidence            99999999999999999999999999999999999999999999999987653

>PF04189 Gcd10p: Gcd10p family; InterPro: IPR007316 eIF-3 is a multisubunit complex that stimulates translation initiation in vitro at several different steps	Back alignment and domain information

>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []	Back alignment and domain information

>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional	Back alignment and domain information

>PF14801 GCD14_N: tRNA methyltransferase complex GCD14 subunit N-term; PDB: 1I9G_A	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]	Back alignment and domain information

>PLN02476 O-methyltransferase	Back alignment and domain information

>PRK07402 precorrin-6B methylase; Provisional	Back alignment and domain information

>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>PLN02781 Probable caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14902 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>COG4122 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>PLN02589 caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>PRK10901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK14903 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase	Back alignment and domain information

>PTZ00146 fibrillarin; Provisional	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>PRK14901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed	Back alignment and domain information

>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed	Back alignment and domain information

>PRK14968 putative methyltransferase; Provisional	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>PRK14904 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>TIGR00537 hemK_rel_arch HemK-related putative methylase	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>PRK01581 speE spermidine synthase; Validated	Back alignment and domain information

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>PLN03075 nicotianamine synthase; Provisional	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK04457 spermidine synthase; Provisional	Back alignment and domain information

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional	Back alignment and domain information

>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>PLN02366 spermidine synthase	Back alignment and domain information

>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>TIGR00406 prmA ribosomal protein L11 methyltransferase	Back alignment and domain information

>TIGR00452 methyltransferase, putative	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional	Back alignment and domain information

>PRK03612 spermidine synthase; Provisional	Back alignment and domain information

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>TIGR00740 methyltransferase, putative	Back alignment and domain information

>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional	Back alignment and domain information

>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02823 spermine synthase	Back alignment and domain information

>COG3963 Phospholipid N-methyltransferase [Lipid metabolism]	Back alignment and domain information

>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ]	Back alignment and domain information

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PLN02396 hexaprenyldihydroxybenzoate methyltransferase	Back alignment and domain information

>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific	Back alignment and domain information

>TIGR01848 PHA_reg_PhaR polyhydroxyalkanoate synthesis repressor PhaR	Back alignment and domain information

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed	Back alignment and domain information

>TIGR01177 conserved hypothetical protein TIGR01177	Back alignment and domain information

>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional	Back alignment and domain information

>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional	Back alignment and domain information

>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A	Back alignment and domain information

>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>smart00650 rADc Ribosomal RNA adenine dimethylases	Back alignment and domain information

>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed	Back alignment and domain information

>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PRK10481 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific	Back alignment and domain information

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed	Back alignment and domain information

>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase	Back alignment and domain information

>PRK06922 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00536 hemK_fam HemK family putative methylases	Back alignment and domain information

>COG4798 Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PHA03411 putative methyltransferase; Provisional	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional	Back alignment and domain information

>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		452
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-04
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	8e-07
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	1e-06
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	1e-04
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	3e-04
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	4e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 59.1 bits (142), Expect = 2e-09
 Identities = 72/475 (15%), Positives = 141/475 (29%), Gaps = 158/475 (33%)

Query: 79  VIPSTEDDVQEKEDAQISGEFRDNRAIVDDNKAQCLSGEDIDEMRRQG------------ 126
           ++   ED   +  D       +D    V D     LS E+ID +                
Sbjct: 21  ILSVFEDAFVDNFD------CKD----VQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWT 70

Query: 127 --ATGEEIVEALIANS------------ATFEKKTSFSQEKYKLKKQKKY-APKVLLRRP 171
             +  EE+V+  +                T +++ S     Y  ++ + Y   +V  +  
Sbjct: 71  LLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYN 130

Query: 172 FAR-----SICEAYFKKNPARIGFLRVD-ML----SLL--------------------LS 201
            +R      + +A  +  PA+   + +D +L    + +                    L+
Sbjct: 131 VSRLQPYLKLRQALLELRPAK--NVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLN 188

Query: 202 MGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNT-------------CIGDSLYP-- 246
           + N   NS   V++M   LL          + +  N               +    Y   
Sbjct: 189 LKNC--NSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENC 246

Query: 247 ---MD------IVRIFNFSNEICKSIV--R-ASVSDVTSQSE-------------TSEQS 281
              +           FN S   CK ++  R   V+D  S +              T ++ 
Sbjct: 247 LLVLLNVQNAKAWNAFNLS---CKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEV 303

Query: 282 DQLESAC-NMEIQS--NEQKSSS---VSMEDISLSSENGVS--DLILEANHSPVNK-ISK 332
             L     +   Q    E  +++   +S+  I+ S  +G++  D     N   +   I  
Sbjct: 304 KSLLLKYLDCRPQDLPREVLTTNPRRLSI--IAESIRDGLATWDNWKHVNCDKLTTIIES 361

Query: 333 SHKV------------------GEKASQETLK-LWKENGFSSMIVVAPELDPWSFVKDLL 373
           S  V                          L  +W +   S ++VV  +L  +S V+   
Sbjct: 362 SLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQP 421

Query: 374 PLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAI----------GLQISEPWLREY 418
              + S    I   YL+      +   + +  +             +  P+L +Y
Sbjct: 422 KESTIS----IPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQY 472

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Length = 280	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		452
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	99.95
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	99.92
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	99.92
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	99.9
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	99.86
2b25_A		336	Hypothetical protein; structural genomics, methyl	99.85
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	99.56
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	98.54
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	98.24
2yxd_A		183	Probable cobalt-precorrin-6Y C(15)-methyltransfer	98.23
3duw_A		223	OMT, O-methyltransferase, putative; alternating of	97.93
3tfw_A		248	Putative O-methyltransferase; PSI-biology, nysgrc,	97.89
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	97.85
3tr6_A		225	O-methyltransferase; cellular processes; HET: SAH;	97.74
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	97.61
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	97.57
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	97.48
2avd_A		229	Catechol-O-methyltransferase; structural genomics,	97.46
3r3h_A		242	O-methyltransferase, SAM-dependent; structural gen	97.45
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	97.43
1sui_A		247	Caffeoyl-COA O-methyltransferase; rossmann fold, p	97.34
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	97.27
3cbg_A		232	O-methyltransferase; cyanobacterium; HET: SAH FER	97.27
3c3y_A		237	Pfomt, O-methyltransferase; plant secondary metabo	97.25
3u81_A		221	Catechol O-methyltransferase; neurotransmitter deg	97.23
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	97.18
2xyq_A		290	Putative 2'-O-methyl transferase; transferase-vira	97.09
2hnk_A		239	SAM-dependent O-methyltransferase; modified rossma	96.97
1ixk_A		315	Methyltransferase; open beta sheet; 1.90A {Pyrococ	96.96
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	96.94
3m4x_A		456	NOL1/NOP2/SUN family protein; mtase domain, PUA do	96.93
3fpf_A		298	Mtnas, putative uncharacterized protein; thermonic	96.88
3c3p_A		210	Methyltransferase; NP_951602.1, structural genomic	96.87
2gpy_A		233	O-methyltransferase; structural genomics, PSI, pro	96.78
3ajd_A		274	Putative methyltransferase MJ0026; tRNA, M5C, ross	96.69
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	96.63
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	96.63
3kr9_A		225	SAM-dependent methyltransferase; class I rossmann-	96.47
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	96.47
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	96.42
3m6w_A		464	RRNA methylase; rRNA methyltransferase, 5-methylcy	96.41
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	96.39
4dzr_A		215	Protein-(glutamine-N5) methyltransferase, release	96.39
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	96.34
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	96.28
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	96.28
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	96.25
2bm8_A		236	Cephalosporin hydroxylase CMCI; cephamycin biosynt	96.24
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	96.19
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	96.19
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	96.14
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	96.09
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	96.07
3a27_A		272	TYW2, uncharacterized protein MJ1557; wybutosine m	96.05
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	96.0
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	95.99
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	95.98
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	95.97
3lpm_A		259	Putative methyltransferase; structural genomics, p	95.89
2b9e_A		309	NOL1/NOP2/SUN domain family, member 5 isoform 2; m	95.88
2yxl_A		450	PH0851 protein, 450AA long hypothetical FMU protei	95.84
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	95.84
2frx_A		479	Hypothetical protein YEBU; rossmann-type S-adenosy	95.77
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	95.74
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	95.64
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	95.62
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	95.62
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	95.57
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	95.57
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	95.53
2cmg_A		262	Spermidine synthase; transferase, putrescine amino	95.52
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	95.5
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	95.5
3f4k_A		257	Putative methyltransferase; structural genomics, P	95.5
3ckk_A		235	TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-	95.48
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	95.42
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	95.35
2fca_A		213	TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac	95.34
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	95.19
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	95.16
1sqg_A		429	SUN protein, FMU protein; rossmann-fold, mixed bet	95.1
2esr_A		177	Methyltransferase; structural genomics, hypothetic	95.05
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	95.0
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	95.0
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	94.99
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	94.95
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	94.89
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	94.81
3lec_A		230	NADB-rossmann superfamily protein; PSI, MCSG, stru	94.74
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	94.74
1u2z_A		433	Histone-lysine N-methyltransferase, H3 lysine-79 s	94.61
1dl5_A		317	Protein-L-isoaspartate O-methyltransferase; isoasp	94.6
2i7c_A		283	Spermidine synthase; transferase, structural genom	94.53
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	94.48
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	94.46
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	94.36
3mq2_A		218	16S rRNA methyltransferase; methyltranferase, ribo	94.34
2frn_A		278	Hypothetical protein PH0793; structural genomics,	94.34
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	94.23
3gnl_A		244	Uncharacterized protein, DUF633, LMOF2365_1472; st	94.22
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	94.2
2qm3_A		373	Predicted methyltransferase; putative methyltransf	94.18
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	94.15
3tma_A		354	Methyltransferase; thump domain; 2.05A {Thermus th	94.09
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	94.04
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	94.03
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	93.98
3i9f_A		170	Putative type 11 methyltransferase; structural gen	93.97
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	93.91
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	93.9
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	93.88
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	93.62
2o07_A		304	Spermidine synthase; structural genomics, structur	93.61
2pt6_A		321	Spermidine synthase; transferase, structural genom	93.52
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	93.38
4dcm_A		375	Ribosomal RNA large subunit methyltransferase G; 2	93.13
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	93.11
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	92.98
4e2x_A		416	TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s	92.96
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	92.76
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	92.73
2b3t_A		276	Protein methyltransferase HEMK; translation termin	92.62
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	92.49
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	92.43
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	92.39
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	92.22
2igt_A		332	SAM dependent methyltransferase; alpha-beta sandwi	92.2
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	92.17
3k6r_A		278	Putative transferase PH0793; structural genomics,	91.93
3ocj_A		305	Putative exported protein; structural genomics, PS	91.87
1vlm_A		219	SAM-dependent methyltransferase; possible histamin	91.82
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	91.77
3bzb_A		281	Uncharacterized protein; RED ALGA, protein structu	91.56
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	91.47
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	91.36
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	91.2
3jwh_A		217	HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena	91.03
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	90.99
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	90.94
2qfm_A		364	Spermine synthase; spermidine aminopropyltransfera	90.88
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	90.85
1xxl_A		239	YCGJ protein; structural genomics, protein structu	90.85
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	90.67
2b78_A		385	Hypothetical protein SMU.776; structure genomics,	90.46
4fzv_A		359	Putative methyltransferase NSUN4; mterf fold, meth	90.33
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	90.25
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	90.09
2aot_A		292	HMT, histamine N-methyltransferase; classic methyl	90.07
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	89.98
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	89.46
3jwg_A		219	HEN1, methyltransferase type 12; 1.90A {Clostridiu	89.34
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	89.31
2as0_A		396	Hypothetical protein PH1915; RNA methyltransferase	89.09
1nv8_A		284	HEMK protein; class I adoMet-dependent methyltrans	89.08
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	89.01
3ege_A		261	Putative methyltransferase from antibiotic biosyn	89.01
3uwp_A		438	Histone-lysine N-methyltransferase, H3 lysine-79;	88.93
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	88.93
3hp7_A		291	Hemolysin, putative; structural genomics, APC64019	88.74
1ws6_A		171	Methyltransferase; structural genomics, riken stru	88.66
3cc8_A		230	Putative methyltransferase; structural genomics, j	88.66
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	88.64
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	88.37
3iv6_A		261	Putative Zn-dependent alcohol dehydrogenase; alpha	88.36
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	88.35
2p7i_A		250	Hypothetical protein; putative methyltransferase,	88.18
3lcc_A		235	Putative methyl chloride transferase; halide methy	88.08
3uko_A		378	Alcohol dehydrogenase class-3; alcohol dehydrogena	88.07
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	88.02
3s2e_A		340	Zinc-containing alcohol dehydrogenase superfamily;	87.96
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	87.91
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	87.88
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	87.81
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	87.65
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	87.47
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	87.3
3opn_A		232	Putative hemolysin; structural genomics, PSI-2, pr	87.13
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	87.01
1cdo_A		374	Alcohol dehydrogenase; oxidoreductase, oxidoreduct	86.89
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	86.83
2qy6_A		257	UPF0209 protein YFCK; structural genomics, unknown	86.83
3o4f_A		294	Spermidine synthase; aminopropyltransferase, polya	86.78
1f8f_A		371	Benzyl alcohol dehydrogenase; rossmann fold, oxido	86.74
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	86.74
2fzw_A		373	Alcohol dehydrogenase class III CHI chain; S-nitro	86.73
2p41_A		305	Type II methyltransferase; vizier, viral enzymes i	86.51
1p0f_A		373	NADP-dependent alcohol dehydrogenase; ADH topology	86.49
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	86.41
3tm4_A		373	TRNA (guanine N2-)-methyltransferase TRM14; rossma	86.39
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	86.29
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	86.24
2wa2_A		276	Non-structural protein 5; transferase, S-adenosyl-	86.16
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	86.06
3g07_A		292	7SK snRNA methylphosphate capping enzyme; structur	85.67
1e3i_A		376	Alcohol dehydrogenase, class II; HET: NAD; 2.08A {	85.61
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	85.51
3gru_A		295	Dimethyladenosine transferase; rossman fold, ribos	85.43
2yx1_A		336	Hypothetical protein MJ0883; methyl transferase, t	85.35
2dph_A		398	Formaldehyde dismutase; dismutation of aldehydes,	85.31
3ggd_A		245	SAM-dependent methyltransferase; YP_325210.1, stru	85.19
1pl8_A		356	Human sorbitol dehydrogenase; NAD, oxidoreductase;	85.18
2jhf_A		374	Alcohol dehydrogenase E chain; oxidoreductase, met	85.12
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	84.99
3cvo_A		202	Methyltransferase-like protein of unknown functio;	84.95
1e3j_A		352	NADP(H)-dependent ketose reductase; oxidoreductase	84.85
3uog_A		363	Alcohol dehydrogenase; structural genomics, protei	84.47
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	84.35
3gdh_A		241	Trimethylguanosine synthase homolog; M7G, CAP, dim	84.16
2r3s_A		335	Uncharacterized protein; methyltransferase domain,	83.87
2dul_A		378	N(2),N(2)-dimethylguanosine tRNA methyltransferas;	83.31
4dvj_A		363	Putative zinc-dependent alcohol dehydrogenase Pro;	83.31
3uzu_A		279	Ribosomal RNA small subunit methyltransferase A; s	82.92
3fpc_A		352	NADP-dependent alcohol dehydrogenase; oxydoreducta	82.85
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	82.74
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	82.49
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	81.95
4ej6_A		370	Putative zinc-binding dehydrogenase; structural ge	81.78
3ip1_A		404	Alcohol dehydrogenase, zinc-containing; structural	81.77
3bkx_A		275	SAM-dependent methyltransferase; YP_807781.1, cycl	81.56
1kol_A		398	Formaldehyde dehydrogenase; oxidoreductase; HET: N	81.39
2wk1_A		282	NOVP; transferase, O-methyltransferase, novobiocin	81.33
3jv7_A		345	ADH-A; dehydrogenase, nucleotide binding, rossmann	81.05
2hcy_A		347	Alcohol dehydrogenase 1; tetramer of asymmetric di	80.41

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

Probab=99.95  E-value=6.6e-27  Score=224.75  Aligned_cols=253  Identities=16%  Similarity=0.160  Sum_probs=195.3

Q ss_pred             CccCCCEEEEEeCCCCeEEEEEEccCCEEEEcceeeecCCccCCCCCcEEEEeCCCCCCCccccCCCCcchhhhhhhhhc
Q 012978           16 LTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRVIPSTEDDVQEKEDAQI   95 (452)
Q Consensus        16 ~i~eGd~Vll~~~~g~~~~~v~l~~~~~v~~gK~~f~~~~lIG~pyG~~fei~~~~~~~~~~~~~~~~d~~~~~~~~~~~   95 (452)
                      +|++||.|++..+.+ +.+.+++.+| .++..+|.|.++++||++||..+....+.                        
T Consensus         1 ~~~~Gd~v~~~~~~~-~~~~~~~~~~-~~~~~~g~~~~~~~ig~~~g~~i~~~~g~------------------------   54 (255)
T 3mb5_A            1 MIREGDKVVLVDPRG-KRYLITVSKR-DFHTDLGILKLEEIIGRNFGEAIKSHKGH------------------------   54 (255)
T ss_dssp             CCCTTCEEEEECTTS-CEEEEECCSS-EEEETTEEEEGGGGTTCCTTCEEECTTCC------------------------
T ss_pred             CCCCCCEEEEEECCC-cEEEEEecCC-eEecCCEEEEHHHhcCCCCCcEEEECCCc------------------------
Confidence            589999999999876 4558889988 88888899999999999999988754332                        


Q ss_pred             cccccCccccccCcccccCCHHHHHHHHHcCCChHHHHHHHHhccccccccccccHHHHHHHhhhccCCcEEEeCCChHH
Q 012978           96 SGEFRDNRAIVDDNKAQCLSGEDIDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFARS  175 (452)
Q Consensus        96 ~~~~~dNr~i~Dd~~~QkLs~eeI~~lK~~g~sG~eII~~LvenS~tF~~KT~FSqeKYlkkK~kKy~~~~~i~~pt~~~  175 (452)
                                                                                           .+.+++|+...
T Consensus        55 ---------------------------------------------------------------------~~~~~~p~~~~   65 (255)
T 3mb5_A           55 ---------------------------------------------------------------------EFKILRPRIVD   65 (255)
T ss_dssp             ---------------------------------------------------------------------EEEEECCCHHH
T ss_pred             ---------------------------------------------------------------------EEEEeCCCHHH
Confidence                                                                                 23455666554


Q ss_pred             HHHHHHhcCcccccccchhHHHHHHHhcCCCCCCeEEEEeCCCcHHHHHHHHHhCCCceEEEeecCCCCCchhhhhhcCC
Q 012978          176 ICEAYFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFNF  255 (452)
Q Consensus       176 l~e~y~~Kdp~Ki~~lR~DtLa~iL~~anI~~g~rvLv~d~~~GlltaAv~ermgg~G~v~~~~~~~~~~~~~~~~~~nf  255 (452)
                      ...    ..+.....+.++..++|+.++++.+|.+||.++.++|.++.++++++|+.++|+.++..              
T Consensus        66 ~~~----~~~~~~~~~~~~~~~~i~~~~~~~~~~~vldiG~G~G~~~~~l~~~~~~~~~v~~~D~~--------------  127 (255)
T 3mb5_A           66 YLD----KMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIR--------------  127 (255)
T ss_dssp             HHH----HSCCCSCCCCHHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEECSC--------------
T ss_pred             HHh----hCccccccccHhHHHHHHHhhCCCCCCEEEEecCCchHHHHHHHHHhCCCeEEEEEecC--------------
Confidence            333    33444456777888999999999999999999999999999999999988999988653              


Q ss_pred             CHHHHHhhhccccccccccCcCcccchhhhhhhhhhcccccccCCCCcccccccccccccchhhhhcCCCcccccccccc
Q 012978          256 SNEICKSIVRASVSDVTSQSETSEQSDQLESACNMEIQSNEQKSSSVSMEDISLSSENGVSDLILEANHSPVNKISKSHK  335 (452)
Q Consensus       256 ~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~  335 (452)
                       ++..+.+.. ++.... ...                                                           
T Consensus       128 -~~~~~~a~~-~~~~~~-~~~-----------------------------------------------------------  145 (255)
T 3mb5_A          128 -EDFAKLAWE-NIKWAG-FDD-----------------------------------------------------------  145 (255)
T ss_dssp             -HHHHHHHHH-HHHHHT-CTT-----------------------------------------------------------
T ss_pred             -HHHHHHHHH-HHHHcC-CCC-----------------------------------------------------------
Confidence             222222211 111100 000                                                           


Q ss_pred             ccccchHHHHHHhhhcCcceEEEeCCCCChHHHHHhHHhcccCCCcEEEEeCChHHHHHHHHHHHhccC-ccceeeeeee
Q 012978          336 VGEKASQETLKLWKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKM-AIGLQISEPW  414 (452)
Q Consensus       336 ~~~~~~~~~~~~~~~~~~D~liia~~~~dP~~il~~ll~~L~pS~p~VVYsp~~epL~e~~~~L~~~~~-~v~l~l~E~~  414 (452)
                      +......+..+.+..+.||.++++.+  +|+.++..+...|+|+|.+++++|+.+++.++...|+..+. |..+++.|.+
T Consensus       146 ~v~~~~~d~~~~~~~~~~D~v~~~~~--~~~~~l~~~~~~L~~gG~l~~~~~~~~~~~~~~~~l~~~g~~f~~~~~~e~~  223 (255)
T 3mb5_A          146 RVTIKLKDIYEGIEEENVDHVILDLP--QPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVL  223 (255)
T ss_dssp             TEEEECSCGGGCCCCCSEEEEEECSS--CGGGGHHHHHHHEEEEEEEEEEESSHHHHHHHHHHHHHTGGGBSCCEEECCC
T ss_pred             ceEEEECchhhccCCCCcCEEEECCC--CHHHHHHHHHHHcCCCCEEEEEECCHHHHHHHHHHHHHcCCCccccEEEEEe
Confidence            00000001111122356998888765  89999999999999999999999999999999999997653 9999999999


Q ss_pred             eeeeeecCCCCCCCCcccCceEEEEEEEEec
Q 012978          415 LREYQVLPSRTHPCMQMSGCGGYILSGTRTA  445 (452)
Q Consensus       415 lR~yQVLP~RTHP~m~m~~~~GyiLsg~kv~  445 (452)
                      .|+|++.|.++||.++|.+|+|||++|+||.
T Consensus       224 ~r~~~~~~~~~rp~~~~~~htg~l~~ark~~  254 (255)
T 3mb5_A          224 VFDQEVKKECMRPRTTALVHTGYITFARRIL  254 (255)
T ss_dssp             CCCEEEETTEEEECSCCCCCSCEEEEEEBCC
T ss_pred             eeeeEecCCccCCCcccccccEEEEEEEEec
Confidence            9999999999999999999999999999985

PyMOL of 3mb5

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*	Back alignment and structure

>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1	Back alignment and structure

>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp}	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP}	Back alignment and structure

>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum}	Back alignment and structure

>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ...	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A*	Back alignment and structure

>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}	Back alignment and structure

>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}	Back alignment and structure

>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A*	Back alignment and structure

>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca}	Back alignment and structure

>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans}	Back alignment and structure

>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A*	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A*	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A*	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38	Back alignment and structure

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii}	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli}	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae}	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31	Back alignment and structure

>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP}	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus}	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli}	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A*	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A*	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae}	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A*	Back alignment and structure

>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A*	Back alignment and structure

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*	Back alignment and structure

>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51	Back alignment and structure

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A*	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus}	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides}	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus}	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana}	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A*	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A*	Back alignment and structure

>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli}	Back alignment and structure

>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli}	Back alignment and structure

>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A*	Back alignment and structure

>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A*	Back alignment and structure

>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A*	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A*	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A*	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}	Back alignment and structure

>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A*	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A*	Back alignment and structure

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A*	Back alignment and structure

>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida}	Back alignment and structure

>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}	Back alignment and structure

>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A	Back alignment and structure

>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ...	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021}	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*	Back alignment and structure

>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme}	Back alignment and structure

>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A*	Back alignment and structure

>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli}	Back alignment and structure

>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei}	Back alignment and structure

>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A*	Back alignment and structure

>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima}	Back alignment and structure

>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei}	Back alignment and structure

>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus}	Back alignment and structure

>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A*	Back alignment and structure

>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		452
d1o54a_		266	c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo	2e-05
d1i9ga_		264	c.66.1.13 (A:) Probable methyltransferase Rv2118c	0.003

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: tRNA(1-methyladenosine) methyltransferase-like
domain: Hypothetical protein TM0748
species: Thermotoga maritima [TaxId: 2336]

 Score = 43.6 bits (102), Expect = 2e-05
 Identities = 20/100 (20%), Positives = 38/100 (38%), Gaps = 3/100 (3%)

Query: 348 WKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIG 407
           + E    ++ +  P  DPW+++      L     FA        +   +  LQ     I 
Sbjct: 168 FDEKDVDALFLDVP--DPWNYIDKCWEALKGGGRFATVCPTTNQVQETLKKLQELPF-IR 224

Query: 408 LQISEPWLREYQVLPSRTHPCMQMSGCGGYILSGTRTATN 447
           +++ E   R Y+ +P R  P  +M     Y++  T+    
Sbjct: 225 IEVWESLFRPYKPVPERLRPVDRMVAHTAYMIFATKVCRR 264

PyMOL of d1o54a_

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		452
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	100.0
d1o54a_		266	Hypothetical protein TM0748 {Thermotoga maritima [	100.0
d2b25a1		324	Hypothetical protein FLJ20628 {Human (Homo sapiens	100.0
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	99.96
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	98.48
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	98.36
d1i1na_		224	Protein-L-isoaspartyl O-methyltransferase {Human (	98.16
d1jg1a_		215	Protein-L-isoaspartyl O-methyltransferase {Archaeo	97.97
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	97.53
d1r18a_		223	Protein-L-isoaspartyl O-methyltransferase {Fruit f	97.42
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	97.31
d1g8aa_		227	Fibrillarin homologue {Archaeon Pyrococcus horikos	97.3
d1susa1		227	Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag	96.93
d2avda1		219	COMT domain-containing protein 1, COMTD1 {Human (H	96.91
d1nkva_		245	Hypothetical Protein YjhP {Escherichia coli [TaxId	96.69
d1g8sa_		230	Fibrillarin homologue {Archaeon Methanococcus jann	96.13
d2as0a2		324	Hypothetical protein PH1915, middle and C-terminal	95.89
d2cl5a1		214	Catechol O-methyltransferase, COMT {Rat (Rattus no	95.44
d1f8fa2		174	Benzyl alcohol dehydrogenase {Acinetobacter calcoa	95.41
d1e3ja2		170	Ketose reductase (sorbitol dehydrogenase) {Silverl	95.05
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	95.03
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	94.85
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	94.58
d1e3ia2		174	Alcohol dehydrogenase {Mouse (Mus musculus), class	94.25
d1vj0a2		182	Hypothetical protein TM0436 {Thermotoga maritima [	94.04
d1pl8a2		171	Ketose reductase (sorbitol dehydrogenase) {Human (	93.97
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	93.96
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	93.94
d1p0fa2		174	Alcohol dehydrogenase {Frog (Rana perezi) [TaxId:	93.92
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	93.8
d2fcaa1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil	93.57
d2frna1		260	Hypothetical protein PH0793 {Pyrococcus horikoshii	93.53
d1jqba2		174	Bacterial secondary alcohol dehydrogenase {Clostri	93.5
d1yb5a2		174	Quinone oxidoreductase {Human (Homo sapiens) [TaxI	93.44
d1vlma_		208	Possible histamine N-methyltransferase TM1293 {The	93.42
d1m6ya2		192	TM0872, methyltransferase domain {Thermotoga marit	93.22
d1u2za_		406	Catalytic, N-terminal domain of histone methyltran	93.17
d2fk8a1		280	Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri	92.91
d2jhfa2		176	Alcohol dehydrogenase {Horse (Equus caballus) [Tax	92.51
d1llua2		166	Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax	92.46
d1kola2		195	Formaldehyde dehydrogenase {Pseudomonas putida [Ta	92.36
d1kpia_		291	CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	92.27
d1jvba2		170	Alcohol dehydrogenase {Archaeon Sulfolobus solfata	92.26
d2fzwa2		176	Alcohol dehydrogenase {Human (Homo sapiens), diffe	92.04
d1sqga2		284	Ribosomal RNA small subunit methyltransferase B, R	91.97
d1v3va2		182	Leukotriene b4 12-hydroxydehydrogenase/prostagland	91.75
d1cdoa2		175	Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI	91.73
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	91.66
d1uira_		312	Spermidine synthase {Thermus thermophilus [TaxId:	91.51
d1ixka_		313	Hypothetical methyltransferase PH1374 {Archaeon Py	91.43
d1d1ta2		176	Alcohol dehydrogenase {Human (Homo sapiens), diffe	91.39
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	91.3
d1h2ba2		172	Alcohol dehydrogenase {Archaeon Aeropyrum pernix [	91.19
d1inla_		295	Spermidine synthase {Thermotoga maritima [TaxId: 2	91.19
d1mjfa_		276	Putative spermidine synthetase PF0127 (SpeE) {Arch	90.99
d1pqwa_		183	Putative enoyl reductase domain of polyketide synt	90.61
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	88.89
d1rjwa2		168	Alcohol dehydrogenase {Bacillus stearothermophilus	88.67
d1iy9a_		274	Spermidine synthase {Bacillus subtilis [TaxId: 142	88.53
d1uufa2		168	Hypothetical protein YahK {Escherichia coli [TaxId	88.24
d1nt2a_		209	Fibrillarin homologue {Archaeon Archaeoglobus fulg	88.01
d2b78a2		317	Hypothetical protein SMu776, middle and C-terminal	86.64
d1xj5a_		290	Spermidine synthase {Thale cress (Arabidopsis thal	86.6
d1jqea_		280	Histamine methyltransferase {Human (Homo sapiens)	86.18
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	84.88
d2b2ca1		312	Spermidine synthase {Caenorhabditis elegans [TaxId	84.59
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	84.51
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	84.11
d1yuba_		245	rRNA adenine dimethylase {Streptococcus pneumoniae	83.94
d1iz0a2		171	Quinone oxidoreductase {Thermus thermophilus [TaxI	83.76
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	83.55
d1qora2		179	Quinone oxidoreductase {Escherichia coli [TaxId: 5	83.34
d1wg8a2		182	TM0872, methyltransferase domain {Thermus thermoph	81.91
d2b3ta1		274	N5-glutamine methyltransferase, HemK {Escherichia	81.76
d1qama_		235	rRNA adenine dimethylase {Bacillus subtilis, Ermc'	81.21
d2o07a1		285	Spermidine synthase {Human (Homo sapiens) [TaxId:	81.19
d2p41a1		257	An RNA cap (nucleoside-2'-O-)-methyltransferase do	81.01
d1yzha1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep	80.75

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: tRNA(1-methyladenosine) methyltransferase-like
domain: Probable methyltransferase Rv2118c
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=1.2e-38  Score=309.70  Aligned_cols=257  Identities=18%  Similarity=0.217  Sum_probs=203.8

Q ss_pred             CccCCCEEEEEeCCCCeEEEEEEccCCEEEEcceeeecCCccCCCCCcEEEEeCCCCCCCccccCCCCcchhhhhhhhhc
Q 012978           16 LTWEGCSVLLDINDGDRLVFARLTSGSTLKIGNKNCSLQPLIGCPFGSLFQVDNGKEGPNLSRVIPSTEDDVQEKEDAQI   95 (452)
Q Consensus        16 ~i~eGd~Vll~~~~g~~~~~v~l~~~~~v~~gK~~f~~~~lIG~pyG~~fei~~~~~~~~~~~~~~~~d~~~~~~~~~~~   95 (452)
                      -+++||+|+|....|+ ++++++++|+.++..+|.|+++++||++||+.++.+.|..+.++   .|              
T Consensus         3 ~f~~Gd~Vll~~~~~~-~~~~~l~~g~~~~t~~G~~~h~~iiGk~~G~~v~t~~g~~~~v~---~p--------------   64 (264)
T d1i9ga_           3 PFSIGERVQLTDAKGR-RYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVL---RP--------------   64 (264)
T ss_dssp             SCCTTCEEEEEETTCC-EEEEECCTTCEEEETTEEEEHHHHTTCCTTEEEECSSCCEEEEE---CC--------------
T ss_pred             CCCCCCEEEEEECCCC-EEEEEECCCCEEEcCCeeEeHHHhcCCCCCeEEEeCCCCEEEEe---CC--------------
Confidence            4799999999999875 55899999999999999999999999999999987766544331   12              


Q ss_pred             cccccCccccccCcccccCCHHH-HHHHHHcCCChHHHHHHHHhccccccccccccHHHHHHHhhhccCCcEEEeCCChH
Q 012978           96 SGEFRDNRAIVDDNKAQCLSGED-IDEMRRQGATGEEIVEALIANSATFEKKTSFSQEKYKLKKQKKYAPKVLLRRPFAR  174 (452)
Q Consensus        96 ~~~~~dNr~i~Dd~~~QkLs~ee-I~~lK~~g~sG~eII~~LvenS~tF~~KT~FSqeKYlkkK~kKy~~~~~i~~pt~~  174 (452)
                                         |-+| +..||+.                                        .||+     
T Consensus        65 -------------------t~~~~~~~~~r~----------------------------------------tqii-----   80 (264)
T d1i9ga_          65 -------------------LLVDYVMSMPRG----------------------------------------PQVI-----   80 (264)
T ss_dssp             -------------------CHHHHHTTSCSC----------------------------------------SCCC-----
T ss_pred             -------------------CHHHHHhhccCC----------------------------------------cccc-----
Confidence                               3333 2344442                                        3555     


Q ss_pred             HHHHHHHhcCcccccccchhHHHHHHHhcCCCCCCeEEEEeCCCcHHHHHHHHHhCCCceEEEeecCCCCCchhhhhhcC
Q 012978          175 SICEAYFKKNPARIGFLRVDMLSLLLSMGNVAANSDVLVVDMAGGLLTGAVAERLGGTGYVCNTCIGDSLYPMDIVRIFN  254 (452)
Q Consensus       175 ~l~e~y~~Kdp~Ki~~lR~DtLa~iL~~anI~~g~rvLv~d~~~GlltaAv~ermgg~G~v~~~~~~~~~~~~~~~~~~n  254 (452)
                            |+||           .|+|+.+++|+||++||.+++++|.+|.++|.++|++|+|+.++..             
T Consensus        81 ------ypkD-----------~s~Ii~~l~i~PG~~VLE~G~GsG~lt~~La~~vgp~G~V~~~d~~-------------  130 (264)
T d1i9ga_          81 ------YPKD-----------AAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQR-------------  130 (264)
T ss_dssp             ------CHHH-----------HHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEECSC-------------
T ss_pred             ------chHH-----------HHHHHHHhCCCCCCEEEecCcCCcHHHHHHHHhhCCCcEEEEecCC-------------
Confidence                  8888           6999999999999999999999999999999999999999999763             


Q ss_pred             CCHHHHHhhhccccccccccCcCcccchhhhhhhhhhcccccccCCCCcccccccccccccchhhhhcCCCccccccccc
Q 012978          255 FSNEICKSIVRASVSDVTSQSETSEQSDQLESACNMEIQSNEQKSSSVSMEDISLSSENGVSDLILEANHSPVNKISKSH  334 (452)
Q Consensus       255 f~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~  334 (452)
                        +++.+.+.. ++..+......                                    +                    
T Consensus       131 --~~~~~~Ar~-n~~~~~~~~~~------------------------------------n--------------------  151 (264)
T d1i9ga_         131 --ADHAEHARR-NVSGCYGQPPD------------------------------------N--------------------  151 (264)
T ss_dssp             --HHHHHHHHH-HHHHHHTSCCT------------------------------------T--------------------
T ss_pred             --HHHHHHHHH-hhhhhccCCCc------------------------------------e--------------------
Confidence              233333222 33222000000                                    0                    


Q ss_pred             cccccchHHHHH-HhhhcCcceEEEeCCCCChHHHHHhHHhcccCCCcEEEEeCChHHHHHHHHHHHhccCccceeeeee
Q 012978          335 KVGEKASQETLK-LWKENGFSSMIVVAPELDPWSFVKDLLPLLSYSAPFAIYHQYLQPLATCMHSLQVRKMAIGLQISEP  413 (452)
Q Consensus       335 ~~~~~~~~~~~~-~~~~~~~D~liia~~~~dP~~il~~ll~~L~pS~p~VVYsp~~epL~e~~~~L~~~~~~v~l~l~E~  413 (452)
                        +.....+..+ .+.++.||++|++.|  +||+++..+...|+|+|.+|+|+|+.+|+.++..+|+..+.|+++++.|+
T Consensus       152 --v~~~~~d~~~~~~~~~~fDaV~ldlp--~P~~~l~~~~~~LkpGG~lv~~~P~i~Qv~~~~~~l~~~~~f~~i~~~E~  227 (264)
T d1i9ga_         152 --WRLVVSDLADSELPDGSVDRAVLDML--APWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWET  227 (264)
T ss_dssp             --EEEECSCGGGCCCCTTCEEEEEEESS--CGGGGHHHHHHHEEEEEEEEEEESSHHHHHHHHHHHHHHSSBCCCEEECC
T ss_pred             --EEEEecccccccccCCCcceEEEecC--CHHHHHHHHHhccCCCCEEEEEeCccChHHHHHHHHHHcCCeecceEEEE
Confidence              0000000000 123468999999997  99999999999999999999999999999999999997778999999999


Q ss_pred             eeeeeeecCCCCCCCCcccCceEEEEEEEEecCC
Q 012978          414 WLREYQVLPSRTHPCMQMSGCGGYILSGTRTATN  447 (452)
Q Consensus       414 ~lR~yQVLP~RTHP~m~m~~~~GyiLsg~kv~~~  447 (452)
                      ..|+|+|-+.++||...|.||+|||.+|+|+.+-
T Consensus       228 l~R~~~v~~~~~RP~~~~vgHTgfl~~ark~~~~  261 (264)
T d1i9ga_         228 LQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPG  261 (264)
T ss_dssp             CCCCEEEETTEEEECSCCCCCSCEEEEEEBCCTT
T ss_pred             EEEEEEeccCeeCCCCCCccchHHHhhhhhccCC
Confidence            9999999999999999999999999999999874

PyMOL of d1i9ga_

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}	Back information, alignment and structure

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}	Back information, alignment and structure

>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}	Back information, alignment and structure

>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}	Back information, alignment and structure

>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}	Back information, alignment and structure

>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]}	Back information, alignment and structure

>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}	Back information, alignment and structure

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]}	Back information, alignment and structure

>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]}	Back information, alignment and structure

>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]}	Back information, alignment and structure

>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure