Citrus Sinensis ID: 013047


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450
MLQLFLIYILIFPLKQICGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFSDGNSKVKLRARLSNPMPKTQAVKGGMSGGFRIGHGSSRTFSRYGRGSGRAGHHFNRANFQRGRGFYQHGRNHSSRMGPTEYDFDNRYTEFHGRQFIGRGGRSFRGGYNAPSRAAAGAGPSRSNPTRLWPDGPDRGYGEHHSYRRQPFSQGEDFDRPFIGRQVDDPYFYDDRAHGVKRSFHVMDHEPDYMGPRRFRPRLDYNDPVIPFHGSHHHDNVGACSNHYSDDYHVPNYGAHPPYPPYYGDDRLYGGGYFY
cHHHHHHHHHHcccccccccccccccccccccEEEccccccccHHHHHHHHHHHccccEEEEEEEEccccccccccEEEEEEccHHHHHHHHHHHccccEEcccccccEEEccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccccccccEEEEEEccHHHHHHHHHHHcccEEccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEEEEEEcccccHHccccEEEEEcccccccEEEccccccccHHHHHHHHHHcccccEEEEEEEEcccccccccEEEEEEEccHHHHHHHHHHHccccccccccccEEEEEcccccccccHHHHHccEEEEEccccccccHHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHHHcccEEcccEEEEEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEc
MLQLFLIYILIFPlkqicgkrcgtapsedndtlfVGNICNTWTKEAIKQKLKDygvegveniNLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKrlqkpdvvfghpertVKVAfaeplrepdpeimAHVKTVfldgvpphwkenqirDQIKGYGDVIRIVLARNmstakrkdygfidfSTHEAAVACINAinnkefsdgnsKVKLRArlsnpmpktqavkggmsggfrighgssrtfsrygrgsgraghhfnranfqrgrgfyqhgrnhssrmgpteydfdnrytefhgrqfigrggrsfrggynapsraaagagpsrsnptrlwpdgpdrgygehhsyrrqpfsqgedfdrpfigrqvddpyfyddrahgvkrsfhvmdhepdymgprrfrprldyndpvipfhgshhhdnvgacsnhysddyhvpnygahppyppyygddrlygggyfy
MLQLFLIYILIFPLKQICGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVKVAFaeplrepdpEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAinnkefsdgnSKVKLrarlsnpmpktqavkggmsggfrigHGSSRTFSRYGRGSGRAGHHFNRANFQRGRGFYQHgrnhssrmgpteYDFDNRYTEFHGRQFIGRGGRSFRGGYNAPSraaagagpsrsnptrlWPDGPDRGYGEHHSyrrqpfsqgedfdrpFIGRQVDDPYFYDDRAHGVKrsfhvmdhepdyMGPRRFRPRLDYNDPVIPFHGSHHHDNVGACSNHYSDDYHVPNYGAHPPYPPYYGDDRLYGGGYFY
MLQLFLIYILIFPLKQICGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFSDGNSKVKLRARLSNPMPKTQAVKGGMSGGFRIGHGSSRTFSRYGRGSGRAGHHFNRANFQRGRGFYQHGRNHSSRMGPTEYDFDNRYTEFHgrqfigrggrsfrggYnapsraaagagpsrsnpTRLWPDGPDRGYGEHHSYRRQPFSQGEDFDRPFIGRQVDDPYFYDDRAHGVKRSFHVMDHEPDYMGPRRFRPRLDYNDPVIPFHGSHHHDNVGACSNHYSDDYHVpnygahppyppyygddrlygggyfy
**QLFLIYILIFPLKQICGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNK***********************************************************************************YDFDNRYTEFHGRQFIGRG*******************************************************RPFIGRQVDDPYFYDDRAHGVKRSFHVMDHEPDYMGPRRFRPRLDYNDPVIPFHGSHHHDNVGACSNHYSDDYHVPNYGAHPPYPPYYGDDRLYGGGYF*
**Q*FLIYILIFPLKQICGKRCG*APSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVK********************VFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFSDGNSKVK*******************************************************************************************************************************************************************************************************************************************************
MLQLFLIYILIFPLKQICGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFSDGNSKVKLRARLSNPMPKTQAVKGGMSGGFRIGHGSSRTFSRYGRGSGRAGHHFNRANFQRGRGFYQHGRNHSSRMGPTEYDFDNRYTEFHGRQFIGRGGRSFRGGYNAP************NPTRLWPDGPDRGYGEHHSYRRQPFSQGEDFDRPFIGRQVDDPYFYDDRAHGVKRSFHVMDHEPDYMGPRRFRPRLDYNDPVIPFHGSHHHDNVGACSNHYSDDYHVPNYGAHPPYPPYYGDDRLYGGGYFY
MLQLFLIYILIFPLKQICGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFSDGNSKVKLRARLSNPMPKTQAVKGGMSGGFRIGHGSSRTFSRYGRGSGRAGHHFNRANFQRGRGFYQHGRNHSSRMGPTEYDFDNRYTEFHGRQFIGRGGRSFRGGYNAPSRAAAGAGPSRSNPTRLWPDGPDRGYGEHHSYRRQPFSQGEDFDRPFIGRQVDDPYFYDDRAHGVKRSFHVMDHEPDYMGPRRFRPRLDYNDPVIPFHGSHHHDNVGACSNHYSDDYHVPNYGAHPPYPPYYGDDRLYGGGYFY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQLFLIYILIFPLKQICGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFSDGNSKVKLRARLSNPMPKTQAVKGGMSGGFRIGHGSSRTFSRYGRGSGRAGHHFNRANFQRGRGFYQHGRNHSSRMGPTEYDFDNRYTEFHGRQFIGRGGRSFRGGYNAPSRAAAGAGPSRSNPTRLWPDGPDRGYGEHHSYRRQPFSQGEDFDRPFIGRQVDDPYFYDDRAHGVKRSFHVMDHEPDYMGPRRFRPRLDYNDPVIPFHGSHHHDNVGACSNHYSDDYHVPNYGAHPPYPPYYGDDRLYGGGYFY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query450 2.2.26 [Sep-21-2011]
Q7TP47533 Heterogeneous nuclear rib yes no 0.384 0.324 0.301 1e-15
O43390633 Heterogeneous nuclear rib no no 0.362 0.257 0.323 2e-15
Q7TMK9623 Heterogeneous nuclear rib yes no 0.384 0.277 0.301 2e-15
O60506623 Heterogeneous nuclear rib no no 0.384 0.277 0.301 2e-15
Q0P4R6534 Probable RNA-binding prot no no 0.435 0.367 0.314 2e-15
Q5R9H4587 APOBEC1 complementation f no no 0.564 0.432 0.280 1e-13
Q8TBY0533 Probable RNA-binding prot no no 0.422 0.356 0.301 2e-12
Q9NQ94594 APOBEC1 complementation f no no 0.411 0.311 0.308 2e-12
Q4R2Z0485 Probable RNA-binding prot N/A no 0.422 0.391 0.301 3e-12
P86049533 Probable RNA-binding prot no no 0.422 0.356 0.301 3e-12
>sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 Back     alignment and function desciption
 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 89/186 (47%), Gaps = 13/186 (6%)

Query: 18  CGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGF 77
            GK  G   S  N+ LFVG+I  + TKE I ++      EG+ ++ L      +  +RGF
Sbjct: 140 SGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKV-TEGLTDVILYHQPDDKKKNRGF 198

Query: 78  AFVMFSCHVDAMAAYKRLQKPDV-VFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGV 136
            F+ +  H  A  A +RL    V V+G+      V +A+P+ +PDPE+MA VK +F+  +
Sbjct: 199 CFLEYEDHKTAAQARRRLMSGKVKVWGN---VGTVEWADPIEDPDPEVMAKVKVLFVRNL 255

Query: 137 PPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFS 196
                E  +      +G + R+         K KDY FI F   + AV  +  +N K+  
Sbjct: 256 ANTVTEEILEKSFSQFGKLERV--------KKLKDYAFIHFDERDGAVKAMEEMNGKDLE 307

Query: 197 DGNSKV 202
             N ++
Sbjct: 308 GENIEI 313




Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. Component of the CRD-mediated complex that promotes MYC mRNA stability. Is associated in vitro with pre-mRNA, splicing intermediates and mature mRNA protein complexes. Binds to apoB mRNA AU-rich sequences. Part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. May be involved in cytoplasmic vesicle-based mRNA transport through interaction with synaptotagmins.
Rattus norvegicus (taxid: 10116)
>sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 Back     alignment and function description
>sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 Back     alignment and function description
>sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 Back     alignment and function description
>sp|Q0P4R6|RBM46_XENTR Probable RNA-binding protein 46 OS=Xenopus tropicalis GN=rbm46 PE=2 SV=1 Back     alignment and function description
>sp|Q5R9H4|A1CF_PONAB APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1 Back     alignment and function description
>sp|Q8TBY0|RBM46_HUMAN Probable RNA-binding protein 46 OS=Homo sapiens GN=RBM46 PE=2 SV=1 Back     alignment and function description
>sp|Q9NQ94|A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1 Back     alignment and function description
>sp|Q4R2Z0|RBM46_MACFA Probable RNA-binding protein 46 OS=Macaca fascicularis GN=RBM46 PE=2 SV=2 Back     alignment and function description
>sp|P86049|RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus GN=Rbm46 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query450
255581424 841 RNA binding protein, putative [Ricinus c 0.957 0.512 0.674 1e-171
356561166 953 PREDICTED: uncharacterized protein LOC10 0.951 0.449 0.637 1e-148
359476835 827 PREDICTED: uncharacterized protein LOC10 0.955 0.519 0.629 1e-146
356502130 884 PREDICTED: uncharacterized protein LOC10 0.951 0.484 0.637 1e-145
147803493 837 hypothetical protein VITISV_002726 [Viti 0.88 0.473 0.630 1e-135
357518111 989 Heterogeneous nuclear ribonucleoprotein 0.953 0.433 0.530 1e-133
357114605 1019 PREDICTED: uncharacterized protein LOC10 0.913 0.403 0.497 1e-104
326507886 751 predicted protein [Hordeum vulgare subsp 0.868 0.520 0.490 6e-97
343172764507 RNA recognition motif-containing protein 0.526 0.467 0.684 1e-95
343172766507 RNA recognition motif-containing protein 0.526 0.467 0.680 2e-95
>gi|255581424|ref|XP_002531520.1| RNA binding protein, putative [Ricinus communis] gi|223528873|gb|EEF30874.1| RNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 294/436 (67%), Positives = 341/436 (78%), Gaps = 5/436 (1%)

Query: 17  ICGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRG 76
           ICGKRCGTAPSEDNDTLF+GNICNTWTKEAI+QKLKDYGVEGVENI LV+D+QHEG SRG
Sbjct: 409 ICGKRCGTAPSEDNDTLFLGNICNTWTKEAIRQKLKDYGVEGVENITLVADVQHEGRSRG 468

Query: 77  FAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGV 136
           FAF+ FSCH DAM AYKRLQKPDVVFGHPERT KVAFAEP+REPDPE+MAHVKTVFLDG+
Sbjct: 469 FAFLEFSCHADAMHAYKRLQKPDVVFGHPERTAKVAFAEPIREPDPEVMAHVKTVFLDGL 528

Query: 137 PPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFS 196
           PPHW E+++R+Q++GYG+++RIVLARNMSTAKRKD+GF+DFS+HEAA+ACI  INN E  
Sbjct: 529 PPHWDEDRVREQLRGYGEIMRIVLARNMSTAKRKDFGFVDFSSHEAAIACIERINNAELG 588

Query: 197 DGNSKVKLRARLSNPMPKTQAVKGGMSGGFRIGHGSSRTFSRYGRGSGRAGHHFNRANFQ 256
           DGNSK +++ARLSNPMPKTQAVKGGM GGF I    S T SR+GR  GR GHHFN  NFQ
Sbjct: 589 DGNSKTRVKARLSNPMPKTQAVKGGMCGGFLIDRTGSGTSSRFGRSFGRGGHHFNWGNFQ 648

Query: 257 RGRGFYQHGRNHSSRMGPTEYDFDNRYTEFHGRQFIGR--GGRSFRGGYNAPSRAAAGAG 314
           RGRGFY  GR  SSRMG  EYDF+NRY  F+GRQ  G+       RGGY    R  +G G
Sbjct: 649 RGRGFYHRGRGQSSRMGSNEYDFNNRYNPFYGRQITGQGGRRGPPRGGYYPAGRGVSGTG 708

Query: 315 PSRSNPTRLWPDGPDRGYGEHHSYRRQPFSQGEDFDRPFIGRQVDDPYFYDDRAHGVKRS 374
           PSR+N  R W D P+RG+G+H S RRQPFS    F R ++GR  DDPY  DD AHG+KR 
Sbjct: 709 PSRTNFNRPWYDAPERGHGDHPSSRRQPFSPEAAFHRSYVGRNFDDPYLCDDGAHGMKRP 768

Query: 375 FHVMDHEPDYMGPRRFRPRLDYNDPVIPFHGSHHHDNVGACSNHYSDDYHVPNYGAHPPY 434
           F++ DH+PDY  P R RPRLDY+DP +PF  +H+HD  GA  + YS  Y+ P+ GA    
Sbjct: 769 FYMTDHDPDYAEPSRHRPRLDYSDPAVPFREAHYHDMYGAGGDPYSHGYYGPDSGAQ--- 825

Query: 435 PPYYGDDRLYGGGYFY 450
           PPYY  D  Y GGY+Y
Sbjct: 826 PPYYRGDGPYRGGYYY 841




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356561166|ref|XP_003548856.1| PREDICTED: uncharacterized protein LOC100819035 [Glycine max] Back     alignment and taxonomy information
>gi|359476835|ref|XP_002266579.2| PREDICTED: uncharacterized protein LOC100259067 [Vitis vinifera] gi|297735034|emb|CBI17396.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356502130|ref|XP_003519874.1| PREDICTED: uncharacterized protein LOC100784338 [Glycine max] Back     alignment and taxonomy information
>gi|147803493|emb|CAN64286.1| hypothetical protein VITISV_002726 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357518111|ref|XP_003629344.1| Heterogeneous nuclear ribonucleoprotein Q [Medicago truncatula] gi|355523366|gb|AET03820.1| Heterogeneous nuclear ribonucleoprotein Q [Medicago truncatula] Back     alignment and taxonomy information
>gi|357114605|ref|XP_003559089.1| PREDICTED: uncharacterized protein LOC100837927 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326507886|dbj|BAJ86686.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|343172764|gb|AEL99085.1| RNA recognition motif-containing protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|343172766|gb|AEL99086.1| RNA recognition motif-containing protein, partial [Silene latifolia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query450
TAIR|locus:2042366 809 AT2G44710 [Arabidopsis thalian 0.5 0.278 0.493 1.1e-60
UNIPROTKB|E7ETM7473 HNRNPR "Heterogeneous nuclear 0.56 0.532 0.277 1.4e-15
UNIPROTKB|Q2L7G6595 HNRNPR "Heterogeneous nuclear 0.56 0.423 0.277 2.3e-15
UNIPROTKB|A3KMV6633 HNRNPR "Uncharacterized protei 0.56 0.398 0.277 2.6e-15
UNIPROTKB|E2RE36633 HNRNPR "Uncharacterized protei 0.56 0.398 0.277 2.6e-15
UNIPROTKB|O43390633 HNRNPR "Heterogeneous nuclear 0.56 0.398 0.277 2.6e-15
TAIR|locus:2134638495 LIF2 "LHP1-Interacting Factor 0.417 0.379 0.292 3.4e-15
RGD|631348632 Hnrnpr "heterogeneous nuclear 0.562 0.400 0.276 1.6e-14
UNIPROTKB|Q566E4632 Hnrnpr "Heterogeneous nuclear 0.562 0.400 0.276 1.6e-14
UNIPROTKB|F1LUZ6381 Hnrnpr "Protein Hnrnpr" [Rattu 0.386 0.456 0.315 1.7e-14
TAIR|locus:2042366 AT2G44710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 580 (209.2 bits), Expect = 1.1e-60, Sum P(2) = 1.1e-60
 Identities = 119/241 (49%), Positives = 161/241 (66%)

Query:    17 ICGKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRG 76
             I GK+CG   S+DNDTLFVGNIC  WT EA+++KLK YGVE +++I LV D  +  ++RG
Sbjct:   280 INGKKCGVTASQDNDTLFVGNICKIWTPEALREKLKHYGVENMDDITLVEDSNNVNMNRG 339

Query:    77 FAFVMFSCHVDAMAAYKRLQKPDVVFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGV 136
             +AF+ FS   DAM A+KRL K DV+FG  E+  KV+F +   + + EIMA VKT+F+DG+
Sbjct:   340 YAFLEFSSRSDAMDAHKRLVKKDVMFG-VEKPAKVSFTDSFLDLEDEIMAQVKTIFIDGL 398

Query:   137 PPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFS 196
              P W E ++RD +K YG + ++ LARNM +A+RKD+GF+ F THEAAV+C   INN E  
Sbjct:   399 LPSWNEERVRDLLKPYGKLEKVELARNMPSARRKDFGFVTFDTHEAAVSCAKFINNSELG 458

Query:   197 DGNSKVKLRARLSNPMPKTQAVKGGMSGGFRIGHGSSRTFSRYGRGSGRAGHHFNRANFQ 256
             +G  K K+RARLS P+ K  A KG  S         SR+  R   G+GR+G    R++F 
Sbjct:   459 EGEDKAKVRARLSRPLQK--AGKGRQS---------SRSDQRSRHGAGRSG----RSSFA 503

Query:   257 R 257
             R
Sbjct:   504 R 504


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=RCA
UNIPROTKB|E7ETM7 HNRNPR "Heterogeneous nuclear ribonucleoprotein R" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2L7G6 HNRNPR "Heterogeneous nuclear ribonucleoprotein R" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A3KMV6 HNRNPR "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE36 HNRNPR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43390 HNRNPR "Heterogeneous nuclear ribonucleoprotein R" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2134638 LIF2 "LHP1-Interacting Factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|631348 Hnrnpr "heterogeneous nuclear ribonucleoprotein R" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q566E4 Hnrnpr "Heterogeneous nuclear ribonucleoprotein R" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LUZ6 Hnrnpr "Protein Hnrnpr" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
BRADI1G00520.1
annotation not avaliable (709 aa)
(Brachypodium distachyon)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query450
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 3e-17
smart0036073 smart00360, RRM, RNA recognition motif 4e-13
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 3e-11
smart0036073 smart00360, RRM, RNA recognition motif 2e-09
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-09
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-08
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-08
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 6e-08
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 9e-08
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 9e-08
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 9e-08
cd1249285 cd12492, RRM2_RBM46, RNA recognition motif 2 found 1e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-07
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-07
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-07
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 3e-07
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 6e-07
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 6e-07
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 2e-06
cd1256286 cd12562, RRM2_RBM5_like, RNA recognition motif 2 i 3e-06
cd1225082 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 4e-06
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 5e-06
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 8e-06
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 9e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-05
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 1e-05
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 1e-05
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-05
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 2e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-05
cd1275487 cd12754, RRM2_RBM10, RNA recognition motif 2 in ve 3e-05
cd1249085 cd12490, RRM2_ACF, RNA recognition motif 2 in vert 4e-05
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 5e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 8e-05
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 9e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 9e-05
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-04
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 1e-04
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-04
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-04
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 2e-04
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 2e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 2e-04
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 2e-04
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 2e-04
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 3e-04
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 3e-04
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 4e-04
cd1275586 cd12755, RRM2_RBM5, RNA recognition motif 2 in ver 4e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 4e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 4e-04
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 5e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 5e-04
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 5e-04
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 6e-04
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 7e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 7e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 8e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 0.001
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 0.001
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 0.001
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 0.001
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 0.001
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 0.001
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 0.001
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 0.002
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 0.002
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.002
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 0.002
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 0.002
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 0.002
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 0.002
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 0.002
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 0.002
cd1248885 cd12488, RRM2_hnRNPR, RNA recognition motif 2 in v 0.002
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 0.002
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 0.002
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 0.002
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 0.002
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 0.003
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 0.003
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 0.003
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 0.003
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 0.003
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 0.003
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 0.004
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 0.004
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
 Score = 83.9 bits (207), Expect = 3e-17
 Identities = 83/328 (25%), Positives = 128/328 (39%), Gaps = 40/328 (12%)

Query: 19  GKRCGTAPSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFA 78
           G+  G   S DN  LFVG I     +E I ++      EGV ++ +      +  +RGFA
Sbjct: 127 GRLLGVCISVDNCRLFVGGIPKNKKREEILEEFSKV-TEGVVDVIVYHSAADKKKNRGFA 185

Query: 79  FVMFSCHVDAMAAYKRLQKPDV-VFGHPERTVKVAFAEPLREPDPEIMAHVKTVFLDGVP 137
           FV +  H  A  A ++L    + ++GH    + V +AEP  E D ++MA VK +++  + 
Sbjct: 186 FVEYESHRAAAMARRKLMPGRIQLWGH---VIAVDWAEPEEEVDEDVMAKVKILYVRNLM 242

Query: 138 PHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFSD 197
               E  I    K + +     + R     K +DY F+ F   E AV  ++ +N KE  +
Sbjct: 243 TTTTEEIIE---KSFSEFKPGKVER---VKKIRDYAFVHFEDREDAVKAMDELNGKEL-E 295

Query: 198 GNSKVKLRARLSNPMPKTQAVK--------GGMSGGFRIGHG-----SSRTFSRYG---- 240
           G+    +   L+ P+ K   V+        G      R   G     +SR+ +       
Sbjct: 296 GSE---IEVTLAKPVDKKSYVRYTRGTGGRGKERQAARQSLGQVYDPASRSLAYEDYYYH 352

Query: 241 RGSGRAGHHFNRANFQRGRGFYQHGRNHSSRMGPTEYDFDNRYTEFHGRQFIGRGGRSFR 300
                + H        RGRG    G   S   G   Y     Y  ++G      G   +R
Sbjct: 353 PPYAPSLHFPRMPGPIRGRG---RGGAPSRAAGGRGY-PPYGYEAYYG---DYYGYHDYR 405

Query: 301 GGYNAPSRA-AAGAGPSRSNPTRLWPDG 327
           G Y         G   +  NP R  P G
Sbjct: 406 GKYEDKYYGYDPGMELTPMNPVRGKPGG 433


Sequences in this subfamily include the human heterogeneous nuclear ribonucleoproteins (hnRNP) R , Q and APOBEC-1 complementation factor (aka APOBEC-1 stimulating protein). These proteins contain three RNA recognition domains (rrm: pfam00076) and a somewhat variable C-terminal domain. Length = 578

>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240936 cd12492, RRM2_RBM46, RNA recognition motif 2 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241006 cd12562, RRM2_RBM5_like, RNA recognition motif 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240696 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241198 cd12754, RRM2_RBM10, RNA recognition motif 2 in vertebrate RNA-binding protein 10 (RBM10) Back     alignment and domain information
>gnl|CDD|240934 cd12490, RRM2_ACF, RNA recognition motif 2 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241199 cd12755, RRM2_RBM5, RNA recognition motif 2 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240932 cd12488, RRM2_hnRNPR, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 450
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 100.0
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.97
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.97
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.97
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.97
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.96
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.96
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.96
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.95
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.95
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.95
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.94
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.94
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.94
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.93
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.93
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.93
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.93
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.92
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.91
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.91
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.91
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.9
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.89
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.89
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.89
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.88
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.86
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.85
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.85
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.84
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.84
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.83
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.82
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.78
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.78
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.74
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.73
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.73
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.72
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.68
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.68
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.67
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.67
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.65
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.6
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.57
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.57
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.53
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.52
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.52
KOG0122270 consensus Translation initiation factor 3, subunit 99.51
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.51
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.49
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.48
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.47
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.47
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.46
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.46
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.46
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.44
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.43
PLN03120260 nucleic acid binding protein; Provisional 99.43
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.41
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.41
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.4
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.4
KOG4207256 consensus Predicted splicing factor, SR protein su 99.4
KOG4207256 consensus Predicted splicing factor, SR protein su 99.38
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.38
KOG0122270 consensus Translation initiation factor 3, subunit 99.37
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.37
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.37
smart0036272 RRM_2 RNA recognition motif. 99.37
KOG0108435 consensus mRNA cleavage and polyadenylation factor 99.37
KOG0129520 consensus Predicted RNA-binding protein (RRM super 99.37
PLN03120260 nucleic acid binding protein; Provisional 99.36
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.36
PLN03213 759 repressor of silencing 3; Provisional 99.35
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.33
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.33
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.33
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.33
smart0036071 RRM RNA recognition motif. 99.31
PLN03213 759 repressor of silencing 3; Provisional 99.3
smart0036272 RRM_2 RNA recognition motif. 99.29
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.29
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.28
PLN03121243 nucleic acid binding protein; Provisional 99.28
smart0036071 RRM RNA recognition motif. 99.28
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.27
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.25
PLN03121243 nucleic acid binding protein; Provisional 99.24
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.23
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 99.22
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.2
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.19
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.17
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 99.15
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.15
smart0036170 RRM_1 RNA recognition motif. 99.14
smart0036170 RRM_1 RNA recognition motif. 99.13
KOG0108435 consensus mRNA cleavage and polyadenylation factor 99.11
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.1
KOG4210285 consensus Nuclear localization sequence binding pr 99.05
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.04
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 99.04
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.0
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.98
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.97
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.97
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.95
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.91
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.91
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.88
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.86
KOG0226290 consensus RNA-binding proteins [General function p 98.85
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.81
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.81
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.78
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 98.77
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.76
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.74
KOG4660549 consensus Protein Mei2, essential for commitment t 98.74
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.71
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.68
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.68
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.65
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.6
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.55
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.55
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 98.53
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 98.47
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.45
KOG0226290 consensus RNA-binding proteins [General function p 98.4
KOG1995351 consensus Conserved Zn-finger protein [General fun 98.39
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.37
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.3
KOG1995351 consensus Conserved Zn-finger protein [General fun 98.23
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.19
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.18
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.15
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 98.14
KOG0151 877 consensus Predicted splicing regulator, contains R 98.13
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.13
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 98.12
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.0
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.94
KOG0151 877 consensus Predicted splicing regulator, contains R 97.91
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.82
KOG1855484 consensus Predicted RNA-binding protein [General f 97.76
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.69
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.66
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.64
KOG4210285 consensus Nuclear localization sequence binding pr 97.62
KOG2314 698 consensus Translation initiation factor 3, subunit 97.59
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 97.58
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.45
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.42
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.38
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 97.26
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 97.16
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.15
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 97.12
KOG1855484 consensus Predicted RNA-binding protein [General f 97.03
KOG2591684 consensus c-Mpl binding protein, contains La domai 96.95
KOG2314 698 consensus Translation initiation factor 3, subunit 96.93
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.88
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 96.78
KOG1996378 consensus mRNA splicing factor [RNA processing and 96.73
KOG3152278 consensus TBP-binding protein, activator of basal 96.52
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.29
KOG09211282 consensus Dosage compensation complex, subunit MLE 96.25
PF0808145 RBM1CTR: RBM1CTR (NUC064) family; InterPro: IPR012 96.11
KOG3152278 consensus TBP-binding protein, activator of basal 96.1
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.0
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 95.92
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.91
KOG2135526 consensus Proteins containing the RNA recognition 95.8
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.79
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 95.77
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.68
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.56
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 95.55
KOG1996378 consensus mRNA splicing factor [RNA processing and 95.42
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 94.98
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 94.92
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 94.9
KOG3973465 consensus Uncharacterized conserved glycine-rich p 94.74
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 94.61
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 94.17
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 93.96
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 93.92
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 93.91
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 93.9
KOG2591 684 consensus c-Mpl binding protein, contains La domai 93.9
KOG2068327 consensus MOT2 transcription factor [Transcription 93.88
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 93.77
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 93.31
KOG2068327 consensus MOT2 transcription factor [Transcription 93.23
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 93.12
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.07
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 92.88
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.05
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 91.77
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 90.85
KOG2135526 consensus Proteins containing the RNA recognition 90.47
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 90.36
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 89.82
KOG4213205 consensus RNA-binding protein La [RNA processing a 89.78
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 89.78
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 87.76
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 87.24
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 86.4
KOG4483528 consensus Uncharacterized conserved protein [Funct 86.29
KOG2318 650 consensus Uncharacterized conserved protein [Funct 85.69
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 85.29
PF14111153 DUF4283: Domain of unknown function (DUF4283) 84.66
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 83.17
KOG4483528 consensus Uncharacterized conserved protein [Funct 83.04
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 82.91
PRK1454884 50S ribosomal protein L23P; Provisional 82.57
TIGR0363677 L23_arch archaeal ribosomal protein L23. This mode 81.76
KOG2891445 consensus Surface glycoprotein [General function p 80.75
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
Probab=100.00  E-value=5.3e-36  Score=299.17  Aligned_cols=173  Identities=22%  Similarity=0.392  Sum_probs=155.6

Q ss_pred             CCCCCCeEEEcCCCCCCcHHHHHHHHhhcCCCCeeEEEEEeCCCCCCCeeeEEEEEeCCHHHHHHHHHHhCCCCcccCCC
Q 013047           26 PSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHP  105 (450)
Q Consensus        26 ~~~~~~~lyV~nLp~~~te~dL~~~F~~~G~~~V~~i~l~~d~~~tg~skG~aFVeF~~~edA~~Al~~l~~~~~~~g~~  105 (450)
                      .....++|||+|||+++|+++|+++|++||+  |++|+|++|+. |++++|||||+|+++++|++||+.|++..+    .
T Consensus       103 ~~~~~~~LfVgnLp~~~te~~L~~lF~~~G~--V~~v~i~~d~~-tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l----~  175 (346)
T TIGR01659       103 TNNSGTNLIVNYLPQDMTDRELYALFRTIGP--INTCRIMRDYK-TGYSFGYAFVDFGSEADSQRAIKNLNGITV----R  175 (346)
T ss_pred             CCCCCcEEEEeCCCCCCCHHHHHHHHHhcCC--EEEEEEEecCC-CCccCcEEEEEEccHHHHHHHHHHcCCCcc----C
Confidence            3445789999999999999999999999999  99999999976 899999999999999999999999999887    5


Q ss_pred             CceEEEeecCCCCCCCccccCCccEEEEcCCCCCchhHHHHHhhhccCceEEEEEEecCCCCCcceEEEEEeCCHHHHHH
Q 013047          106 ERTVKVAFAEPLREPDPEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVA  185 (450)
Q Consensus       106 gr~i~v~~a~~~~~~~~~~~~~~~~lfV~nLp~~~te~dL~~~F~~~G~v~~v~i~~d~~~g~~rG~afV~F~s~e~A~~  185 (450)
                      +++|+|.++.+..+.     ...++|||+||++.+||++|+++|++||+|+.|.|+.++.++++++||||+|++.++|++
T Consensus       176 gr~i~V~~a~p~~~~-----~~~~~lfV~nLp~~vtee~L~~~F~~fG~V~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~  250 (346)
T TIGR01659       176 NKRLKVSYARPGGES-----IKDTNLYVTNLPRTITDDQLDTIFGKYGQIVQKNILRDKLTGTPRGVAFVRFNKREEAQE  250 (346)
T ss_pred             Cceeeeecccccccc-----cccceeEEeCCCCcccHHHHHHHHHhcCCEEEEEEeecCCCCccceEEEEEECCHHHHHH
Confidence            899999998764322     235689999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCeecCCeeEEEEEEeeCC
Q 013047          186 CINAINNKEFSDGNSKVKLRARLSN  210 (450)
Q Consensus       186 Ai~~l~g~~~~g~~i~v~v~~~~~~  210 (450)
                      ||++||++.|.+....|.|+++...
T Consensus       251 Ai~~lng~~~~g~~~~l~V~~a~~~  275 (346)
T TIGR01659       251 AISALNNVIPEGGSQPLTVRLAEEH  275 (346)
T ss_pred             HHHHhCCCccCCCceeEEEEECCcc
Confidence            9999999999987666666655443



This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF08081 RBM1CTR: RBM1CTR (NUC064) family; InterPro: IPR012604 This region is found in RBM1-like RNA binding hnRNPs [] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4213 consensus RNA-binding protein La [RNA processing and modification] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4483 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4483 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PRK14548 50S ribosomal protein L23P; Provisional Back     alignment and domain information
>TIGR03636 L23_arch archaeal ribosomal protein L23 Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query450
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 3e-06
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 7e-06
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 7e-06
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 9e-06
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 9e-06
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 1e-05
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 1e-05
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-05
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-05
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 1e-05
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 3e-05
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 9e-05
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 2e-04
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 2e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 3e-04
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 4e-04
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 4e-04
1wtb_A79 Complex Structure Of The C-Terminal Rna-Binding Dom 5e-04
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 6e-04
2dis_A109 Solution Structure Of The Rrm Domain Of Unnamed Pro 6e-04
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 43/190 (22%), Positives = 92/190 (48%), Gaps = 21/190 (11%) Query: 33 LFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSD---IQHEGLSRGFAFVMFSCHVDAM 89 ++VG+I ++ I+Q +G +++I++ D ++H +GFAFV + A Sbjct: 31 VYVGSIYYELGEDTIRQAFAPFGP--IKSIDMSWDSVTMKH----KGFAFVEYEVPEAAQ 84 Query: 90 AAYKRLQKPDVVFGHPERTVKVA------FAEPLREPDPEIMAHVKTVFLDGVPPHWKEN 143 A +++ V+ G R +KV A+P+ + E +++ V ++ Sbjct: 85 LALEQMN--SVMLGG--RNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDD 140 Query: 144 QIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACINAINNKEFSDGNSKVK 203 I+ + +G + LAR+ +T K K YGFI++ +++ ++++N F G ++ Sbjct: 141 DIKSVFEAFGKIKSATLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMN--LFDLGGQYLR 198 Query: 204 LRARLSNPMP 213 + ++ PMP Sbjct: 199 VGKAVTPPMP 208
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2DIS|A Chain A, Solution Structure Of The Rrm Domain Of Unnamed Protein Product Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query450
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.98
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.97
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.97
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.97
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.96
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.95
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.95
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.88
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.87
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.83
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.82
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.81
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.79
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.78
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.78
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.77
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.77
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.77
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.76
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.76
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.76
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.75
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.75
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.75
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.75
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.75
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.75
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.75
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.75
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.75
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.75
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.75
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.75
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.75
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.75
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.75
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.75
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.75
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.74
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.74
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.74
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.74
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.74
2div_A99 TRNA selenocysteine associated protein; structural 99.74
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.74
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.74
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.74
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.74
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.74
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.74
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.73
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.73
2dis_A109 Unnamed protein product; structural genomics, RRM 99.73
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.73
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.73
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.73
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.73
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.73
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.73
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.73
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.72
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.72
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.72
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.72
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.72
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.72
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.72
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.72
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.72
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.72
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.72
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.72
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.71
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.71
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.71
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.71
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.71
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.71
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.71
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.71
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.71
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.71
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.7
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.7
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.7
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.7
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.7
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.7
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.7
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.7
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.7
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.7
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.7
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.7
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.7
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.69
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.69
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.69
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.69
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.69
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.69
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.69
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.69
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.69
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.69
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.69
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.69
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.69
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.69
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.69
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.69
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.69
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.69
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.69
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.69
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.68
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.68
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.68
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.68
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.68
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.68
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.68
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.68
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.68
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.68
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.68
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.68
2div_A99 TRNA selenocysteine associated protein; structural 99.68
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.68
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.68
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.68
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.68
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.68
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.67
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.67
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.67
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.67
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.67
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.67
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.67
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.67
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.67
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.67
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.67
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.67
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.67
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.67
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.67
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.67
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.67
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.67
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.67
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.67
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.66
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.66
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.66
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.66
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.66
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.66
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.66
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.66
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.66
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.66
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.66
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.66
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.66
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.66
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.65
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.65
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.65
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.65
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.65
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.65
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.65
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.65
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.65
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.65
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.65
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.65
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.65
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.65
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.65
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.65
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.65
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.65
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.64
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.64
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.64
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.64
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.64
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.64
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.64
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.64
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.64
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.64
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.64
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.64
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.64
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.64
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.64
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.64
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.64
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.63
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.63
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.63
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.63
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.43
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.63
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.63
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.63
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.63
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.63
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.63
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.63
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.63
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.63
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.62
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.62
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.62
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.62
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.62
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.62
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.62
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.62
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.62
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.62
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.62
2dis_A109 Unnamed protein product; structural genomics, RRM 99.62
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.62
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.62
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.62
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.61
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.61
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.61
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.61
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.61
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.61
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.61
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.61
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.61
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.6
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.6
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.6
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.6
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.6
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.6
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.6
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.6
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.6
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.6
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.6
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.6
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.6
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.6
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.6
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.6
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.6
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.6
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.59
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.59
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.59
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.59
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.59
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.59
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.59
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.59
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.59
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.59
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.59
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.59
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.59
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.59
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.59
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.59
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.58
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.58
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.58
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.58
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.58
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.58
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.57
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.57
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.57
1x5p_A97 Negative elongation factor E; structure genomics, 99.57
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.56
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.56
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.56
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.56
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.56
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.56
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.56
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.55
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.55
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.32
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.55
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.55
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.55
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.55
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.55
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.55
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.55
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.55
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.55
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.54
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.54
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.54
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.54
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.53
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.53
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.53
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.53
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.53
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.53
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.52
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.52
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.52
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.52
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.52
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.52
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.51
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.51
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.51
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.5
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.5
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.5
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.5
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.49
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.49
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.49
1x5p_A97 Negative elongation factor E; structure genomics, 99.48
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.48
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.48
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.47
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.47
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.47
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.47
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.47
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.46
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.44
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.44
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.43
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.41
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.41
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.39
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.37
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.37
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.36
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.34
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.34
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.34
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.33
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.32
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.3
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.19
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.15
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.11
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.1
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.02
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.96
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.86
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.83
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.83
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.74
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.67
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.62
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.34
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.24
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.21
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.54
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.42
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.42
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.21
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.14
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.12
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.94
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.92
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.45
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.39
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.19
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.06
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.65
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.57
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 94.16
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 92.04
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 90.05
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 88.52
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 81.7
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
Probab=100.00  E-value=7.9e-34  Score=265.59  Aligned_cols=168  Identities=21%  Similarity=0.345  Sum_probs=148.1

Q ss_pred             CCCCCCeEEEcCCCCCCcHHHHHHHHhhcCCCCeeEEEEEeCCCCCCCeeeEEEEEeCCHHHHHHHHHHhCCCCcccCCC
Q 013047           26 PSEDNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHP  105 (450)
Q Consensus        26 ~~~~~~~lyV~nLp~~~te~dL~~~F~~~G~~~V~~i~l~~d~~~tg~skG~aFVeF~~~edA~~Al~~l~~~~~~~g~~  105 (450)
                      ++...++|||+|||+++|+++|+++|++||+  |++|+|++|+. +++++|||||+|.+.++|++||+.+++..+    .
T Consensus        11 p~~p~~tlfVgnLp~~~te~~L~~~F~~~G~--I~~v~i~~d~~-tg~~~G~afV~F~~~~~A~~Ai~~~~~~~~----~   83 (213)
T 4f02_A           11 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGP--ILSIRVCRDMI-TRRSLGYAYVNFQQPADAERALDTMNFDVI----K   83 (213)
T ss_dssp             ----CCEEEEESCCTTCCHHHHHHHHGGGSC--EEEEEEEECTT-TCCEEEEEEEEESSHHHHHHHHHHHTTCEE----T
T ss_pred             CCCCCcEEEEeCCCCCCCHHHHHHHHHhhCC--EEEEEEecccC-CCCccccccceeCCHHHHHHHHHHhhhhhc----C
Confidence            4556789999999999999999999999999  99999999876 899999999999999999999999999877    5


Q ss_pred             CceEEEeecCCCCCCCccccCCccEEEEcCCCCCchhHHHHHhhhccCceEEEEEEecCCCCCcceEEEEEeCCHHHHHH
Q 013047          106 ERTVKVAFAEPLREPDPEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVA  185 (450)
Q Consensus       106 gr~i~v~~a~~~~~~~~~~~~~~~~lfV~nLp~~~te~dL~~~F~~~G~v~~v~i~~d~~~g~~rG~afV~F~s~e~A~~  185 (450)
                      ++.|++.++.....   ......++|||+||++++|+++|+++|++||.|+.|.|+.+.  +.++|||||+|++.++|++
T Consensus        84 g~~i~~~~~~~~~~---~~~~~~~~l~v~nl~~~~t~~~l~~~F~~~G~i~~~~i~~d~--~~~~g~~fV~f~~~~~a~~  158 (213)
T 4f02_A           84 GKPVRIMWSQRDPS---LRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYGFVHFETQEAAER  158 (213)
T ss_dssp             TEECEEEECCCCTH---HHHHCTTEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEEET--TEEEEEEEEEESSHHHHHH
T ss_pred             Cccccccccccccc---ccccccccceECCcccccHHHHHHHHHhhcCCeEEEEeeccC--CCCceEEEEEeCCHHHHHH
Confidence            89999998865432   222345789999999999999999999999999999999985  4479999999999999999


Q ss_pred             HHHHhCCCeecCCeeEEEEE
Q 013047          186 CINAINNKEFSDGNSKVKLR  205 (450)
Q Consensus       186 Ai~~l~g~~~~g~~i~v~v~  205 (450)
                      ||++|||..|.|+.|.|.+.
T Consensus       159 Ai~~lng~~~~g~~i~V~~a  178 (213)
T 4f02_A          159 AIEKMNGMLLNDRKVFVGRF  178 (213)
T ss_dssp             HHHHHTTCEETTEECEEEEC
T ss_pred             HHHHhCCCEECCEEEEEEEc
Confidence            99999999999998766553



>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 450
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-17
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-11
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-05
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-11
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-09
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-09
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 6e-04
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-07
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-04
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-08
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-06
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-07
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 5e-06
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-04
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 4e-07
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 5e-05
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 5e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 0.001
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 8e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 4e-06
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-06
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-04
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-06
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-04
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-06
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-05
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-06
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 0.001
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 3e-06
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-04
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 4e-06
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-04
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 5e-06
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 8e-06
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-05
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-05
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-05
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 4e-04
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 0.002
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-05
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-05
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-05
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-05
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-05
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-05
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-04
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 5e-05
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-05
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 6e-05
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 6e-05
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 6e-05
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 7e-05
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 7e-05
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-05
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 0.003
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-04
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 3e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 4e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 5e-04
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 8e-04
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 0.001
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 0.001
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 0.001
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 0.002
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 0.002
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 0.002
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 0.003
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 0.003
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 0.004
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Hypothetical protein FLJ20273
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 74.3 bits (182), Expect = 4e-17
 Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 3/99 (3%)

Query: 30  NDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAM 89
           N  LF+G I     +E I +++     EGV ++ + +    +  +RGFAFV +  H  A 
Sbjct: 1   NCRLFIGGIPKMKKREEILEEIAKVT-EGVLDVIVYASAADKMKNRGFAFVEYESHRAAA 59

Query: 90  AAYKRLQKPDVVFGHPERTVKVAFAEPLREPDPEIMAHV 128
            A ++L    +        + V +AEP  + D ++M  V
Sbjct: 60  MARRKLMPGRIQLW--GHQIAVDWAEPEIDVDEDVMETV 96


>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query450
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.97
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.81
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.81
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.81
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.81
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.81
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.8
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.8
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.8
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.79
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.79
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.79
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.78
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.78
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.77
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.77
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.77
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.77
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.77
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.77
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.77
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.77
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.76
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.76
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.76
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.76
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.76
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.76
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.75
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.75
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.75
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.74
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.74
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.74
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.74
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.74
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.74
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.74
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.73
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.73
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.73
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.73
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.73
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.73
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.72
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.72
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.72
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.72
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.72
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.72
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.72
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.72
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.72
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.71
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.71
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.71
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.71
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.71
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.71
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.7
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.7
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.7
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.7
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.69
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.69
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.69
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.69
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.69
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.68
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.68
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.68
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.68
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.68
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.68
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.67
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.67
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.67
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.67
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.67
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.67
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.67
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.67
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.67
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.67
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.66
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.66
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.66
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.66
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.66
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.66
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.65
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.65
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.65
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.64
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.64
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.64
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.64
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.64
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.64
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.63
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.63
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.63
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.63
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.63
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.62
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.62
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.62
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.62
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.62
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.61
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.61
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.6
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.6
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.59
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.59
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.59
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.59
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.59
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.59
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.59
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.59
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.58
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.58
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.58
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.58
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.57
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.57
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.57
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.57
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.56
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.55
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.55
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.55
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.54
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.54
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.54
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.53
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.53
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.53
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.52
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.51
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.51
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.48
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.47
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.46
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.46
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.43
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.42
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.39
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.38
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.36
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.36
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.33
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.33
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.24
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.23
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.22
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.18
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.14
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.58
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.02
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.99
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.96
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.53
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.18
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.16
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 92.7
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.4e-30  Score=235.14  Aligned_cols=166  Identities=22%  Similarity=0.407  Sum_probs=142.6

Q ss_pred             CCCeEEEcCCCCCCcHHHHHHHHhhcCCCCeeEEEEEeCCCCCCCeeeEEEEEeCCHHHHHHHHHHhCCCCcccCCCCce
Q 013047           29 DNDTLFVGNICNTWTKEAIKQKLKDYGVEGVENINLVSDIQHEGLSRGFAFVMFSCHVDAMAAYKRLQKPDVVFGHPERT  108 (450)
Q Consensus        29 ~~~~lyV~nLp~~~te~dL~~~F~~~G~~~V~~i~l~~d~~~tg~skG~aFVeF~~~edA~~Al~~l~~~~~~~g~~gr~  108 (450)
                      ..++|||+|||+++|+++|+++|++||.  |++|+|+++.. ++.++|||||+|.+.++|++|++.++.. +    ..+.
T Consensus         5 ~~r~lfV~nLp~~~te~~L~~~F~~~G~--v~~~~~~~~~~-~~~~~g~afv~f~~~~~a~~a~~~~~~~-~----~~~~   76 (183)
T d1u1qa_           5 QLRKLFIGGLSFETTDESLRSHFEQWGT--LTDCVVMRDPN-TKRSRGFGFVTYATVEEVDAAMNARPHK-V----DGRV   76 (183)
T ss_dssp             HHHEEEEESCCTTCCHHHHHHHHGGGSC--EEEEEEEECTT-TCCEEEEEEEEESSHHHHHHHHHTCSCE-E----TTEE
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHcCC--EEEEEeeeccc-CCCccCceecccCCHHHHHHHHHhcCCc-c----cccc
Confidence            3579999999999999999999999999  99999999876 8999999999999999999999865543 3    2566


Q ss_pred             EEEeecCCCCC-CCccccCCccEEEEcCCCCCchhHHHHHhhhccCceEEEEEEecCCCCCcceEEEEEeCCHHHHHHHH
Q 013047          109 VKVAFAEPLRE-PDPEIMAHVKTVFLDGVPPHWKENQIRDQIKGYGDVIRIVLARNMSTAKRKDYGFIDFSTHEAAVACI  187 (450)
Q Consensus       109 i~v~~a~~~~~-~~~~~~~~~~~lfV~nLp~~~te~dL~~~F~~~G~v~~v~i~~d~~~g~~rG~afV~F~s~e~A~~Ai  187 (450)
                      +.+.+...... .........++|||+|||+.+|+++|+++|++||.|+.|.|+.+..++.++|+|||+|++.++|++||
T Consensus        77 ~~~~~~~~~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al  156 (183)
T d1u1qa_          77 VEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV  156 (183)
T ss_dssp             CEEEECCCTTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHH
T ss_pred             hhhhhhhhcccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHH
Confidence            66666544332 22233446689999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhCCCeecCCeeEEE
Q 013047          188 NAINNKEFSDGNSKVK  203 (450)
Q Consensus       188 ~~l~g~~~~g~~i~v~  203 (450)
                      + ++++.|.|+.++|.
T Consensus       157 ~-~~~~~~~G~~i~V~  171 (183)
T d1u1qa_         157 I-QKYHTVNGHNCEVR  171 (183)
T ss_dssp             T-SSCEEETTEEEEEE
T ss_pred             H-hCCCeECCEEEEEE
Confidence            6 79999999865543



>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure