Citrus Sinensis ID: 013048

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450
MHGRPRKPLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINW
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccEEEccccccccccEEccccccccccccEEEEEcccccccccccccccEEEEcccccccccccccccccccccEEEEEEEEcccHHHHHccccccccccccccccccccccccccccccccccccccccccHHHcHHHHHHHHHHHHHHHHHHcc
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcHcccccccccEEEcccccccEEEEcccccEEEEccccEEEEEEccccEEEEEEEccccccccccEEEEEEcccccccEEEEEcccccccccEEEEEEEEcccccccccccEEEEEEEcccccEEEcccccccccEEEEEEEEEEcccccccccccccEEEEcccccccccccccccccccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccc
mhgrprkplkpedAAASAAKAEKLRVLQSQFLHnhhnhiysKEAVELSTKLLETNPELYTAWNYRKLAVQHkltendsdpdslkSILDEELRVVESALRQNFKsygawhhrkwilskghssiDNELRLLDKFQkadsrnfhaWNYRRFVAASMNRSEEDELKYTEDmicnnfsnysaWHNRSLLLSNLLKRKVEgfvskekvlpdeyEFVHQaiftdpddqsgwfyHLWLLDQtvrvdspqlvsswptpgsdlillgdrcldgcasspftrfhldsrtfpLVLYFNQAVEGVNSSTITVdselntnkdlvwkplsscnskAAQVWVTQlnlpdgnthsskvfPVEVSlghsqgiisssgfhysnpfcFAFRVSLqfvetqpvEALGKEIISWRDesfhnynahsqdsspisslYQLSikndneltDFEWRAATIAKEIDHFRELLSLINW
mhgrprkplkpedAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLtendsdpdsLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKadsrnfhawnyRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINW
MHGRPRKPLKPEDaaasaakaEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHnrslllsnllkrkVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINW
************************RVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHK*************ILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVA*************TEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYN**********SLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLI**
MHGRPRK***********AKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNT*********VSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLI**
********************AEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYN********ISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINW
*******PLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHGRPRKPLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query450 2.2.26 [Sep-21-2011]
Q08602 567 Geranylgeranyl transferas yes no 0.608 0.483 0.383 1e-42
Q5NVK5 567 Geranylgeranyl transferas yes no 0.515 0.409 0.402 1e-41
Q92696 567 Geranylgeranyl transferas yes no 0.515 0.409 0.402 1e-41
Q9JHK4 567 Geranylgeranyl transferas yes no 0.515 0.409 0.414 3e-41
A5A779 567 Geranylgeranyl transferas yes no 0.515 0.409 0.398 5e-41
Q5EA80 567 Geranylgeranyl transferas yes no 0.515 0.409 0.406 2e-40
O94412344 Geranylgeranyl transferas yes no 0.502 0.656 0.362 3e-35
Q55DQ4311 Geranylgeranyl transferas yes no 0.495 0.717 0.362 3e-34
Q00618327 Geranylgeranyl transferas yes no 0.504 0.694 0.330 9e-28
O93829371 Geranylgeranyl transferas N/A no 0.511 0.619 0.308 2e-26
>sp|Q08602|PGTA_RAT Geranylgeranyl transferase type-2 subunit alpha OS=Rattus norvegicus GN=Rabggta PE=1 SV=1 Back     alignment and function desciption
 Score =  174 bits (440), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 154/295 (52%), Gaps = 21/295 (7%)

Query: 1   MHGRPRKPLKPEDAAASAAKAE-KLRVLQSQ---FLHNHHNHIYSKEAVELSTKLLETNP 56
           MHGR +     E A A   + E KL++ QS               +  +EL++++L  NP
Sbjct: 1   MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60

Query: 57  ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116
           +  T WN R+  +QH   E +  P+   +++  EL  +ES LR N KSYG WHHR W+LS
Sbjct: 61  DFATLWNCRREVLQH--LETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118

Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175
           +    +   EL L  +F +AD RNFH W+YRRFVAA    +  +EL +T+ +I  NFSNY
Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178

Query: 176 SAWHNRSLLLSNLLKRKVEGFVSK--EKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233
           S+WH RS LL  L  +   G   +  E VL  E E V  A FTDP+DQS WFYH WLL +
Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238

Query: 234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQA 288
               D    V          +   + CL  C S P T   + SR   L+L  ++A
Sbjct: 239 AEPHDVLCCVH---------VSREEACLSVCFSRPLT---VGSRMGTLLLMVDEA 281
Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 6EC: 0
>sp|Q5NVK5|PGTA_PONAB Geranylgeranyl transferase type-2 subunit alpha OS=Pongo abelii GN=RABGGTA PE=2 SV=1 Back     alignment and function description
>sp|Q92696|PGTA_HUMAN Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens GN=RABGGTA PE=1 SV=2 Back     alignment and function description
>sp|Q9JHK4|PGTA_MOUSE Geranylgeranyl transferase type-2 subunit alpha OS=Mus musculus GN=Rabggta PE=1 SV=1 Back     alignment and function description
>sp|A5A779|PGTA_PIG Geranylgeranyl transferase type-2 subunit alpha OS=Sus scrofa GN=RABGGTA PE=2 SV=1 Back     alignment and function description
>sp|Q5EA80|PGTA_BOVIN Geranylgeranyl transferase type-2 subunit alpha OS=Bos taurus GN=RABGGTA PE=2 SV=1 Back     alignment and function description
>sp|O94412|PGTA_SCHPO Geranylgeranyl transferase type-2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet4 PE=3 SV=1 Back     alignment and function description
>sp|Q55DQ4|PGTA_DICDI Geranylgeranyl transferase type-2 subunit alpha OS=Dictyostelium discoideum GN=rabggta PE=3 SV=2 Back     alignment and function description
>sp|Q00618|PGTA_YEAST Geranylgeranyl transferase type-2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET4 PE=1 SV=3 Back     alignment and function description
>sp|O93829|PGTA_CANAX Geranylgeranyl transferase type-2 subunit alpha OS=Candida albicans GN=BET4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query450
147781066542 hypothetical protein VITISV_043707 [Viti 0.997 0.828 0.665 1e-170
225459067 704 PREDICTED: uncharacterized protein LOC10 0.997 0.637 0.665 1e-170
224092154 696 predicted protein [Populus trichocarpa] 0.988 0.639 0.656 1e-168
255545992 696 protein with unknown function [Ricinus c 0.986 0.637 0.650 1e-164
356515736 691 PREDICTED: uncharacterized protein LOC10 0.971 0.632 0.603 1e-151
356510126 691 PREDICTED: uncharacterized protein LOC10 0.971 0.632 0.614 1e-148
357465223 705 Geranylgeranyl transferase type-2 subuni 0.962 0.614 0.591 1e-148
297799558 677 protein binding protein [Arabidopsis lyr 0.946 0.629 0.596 1e-140
449433595 695 PREDICTED: geranylgeranyl transferase ty 0.964 0.624 0.582 1e-139
7269299 661 Rab geranylgeranyl transferase like prot 0.946 0.644 0.582 1e-137
>gi|147781066|emb|CAN68129.1| hypothetical protein VITISV_043707 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  605 bits (1560), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 299/449 (66%), Positives = 360/449 (80%)

Query: 1   MHGRPRKPLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYT 60
           MHGRPRK  KPEDAAASAAKAEKLR LQSQ LHNHHN IY+KEA+E+S KLLE NPE YT
Sbjct: 1   MHGRPRKAPKPEDAAASAAKAEKLRALQSQLLHNHHNQIYTKEALEISAKLLEANPESYT 60

Query: 61  AWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHS 120
           AWNYRKLAV+H L+ ++SDPD++KSI  EELRVVE++L+QNFKSYGAWHHRKW+LSKGHS
Sbjct: 61  AWNYRKLAVEHNLSHSESDPDTVKSIFSEELRVVENSLKQNFKSYGAWHHRKWVLSKGHS 120

Query: 121 SIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHN 180
           S+D+EL+LLD+FQ+ADSRNFHAWNYRRF+AA     +E+ELKYT  +I  NFSNYSAWHN
Sbjct: 121 SVDHELQLLDRFQRADSRNFHAWNYRRFIAALKGIPDEEELKYTTKLIETNFSNYSAWHN 180

Query: 181 RSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSP 240
           RS+LLS+LL+ KV+GF  KEKVL +EYEFVHQA+FTDPDDQSGWFYHLWLLDQTV+ ++P
Sbjct: 181 RSVLLSHLLQNKVKGFFPKEKVLVEEYEFVHQALFTDPDDQSGWFYHLWLLDQTVKPETP 240

Query: 241 QLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVD 300
            LVS+WP  GSD+I+  + CLDG A SPFT FH D+ TFPL+LYFN+AVEGVNSST+TV 
Sbjct: 241 LLVSTWPAHGSDIIVSAEGCLDGRALSPFTSFHSDAGTFPLILYFNEAVEGVNSSTVTVK 300

Query: 301 SELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGF 360
           S    NKDLVWKPL++  S AAQ WVT LN+PD   H S  +P+EV+LG SQGIIS SG 
Sbjct: 301 SVFTENKDLVWKPLATSKSCAAQAWVTHLNVPDVKLHPSTAYPIEVNLGDSQGIISLSGS 360

Query: 361 HYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKN 420
           H S+P  FAF V +Q + ++  E    E+I WRD +FH Y+AH Q+SSPI+   +LSIK 
Sbjct: 361 HCSHPSRFAFTVCVQPLSSKHAERQSVEMILWRDVNFHFYDAHVQESSPIAYFDRLSIKK 420

Query: 421 DNELTDFEWRAATIAKEIDHFRELLSLIN 449
           D+E    +W A T+  EI   R+LLS I+
Sbjct: 421 DHEPAASKWHAKTLVNEIALVRQLLSEID 449

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225459067|ref|XP_002283768.1| PREDICTED: uncharacterized protein LOC100248920 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224092154|ref|XP_002309487.1| predicted protein [Populus trichocarpa] gi|222855463|gb|EEE93010.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255545992|ref|XP_002514056.1| protein with unknown function [Ricinus communis] gi|223547142|gb|EEF48639.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|356515736|ref|XP_003526554.1| PREDICTED: uncharacterized protein LOC100783193 [Glycine max] Back     alignment and taxonomy information
>gi|356510126|ref|XP_003523791.1| PREDICTED: uncharacterized protein LOC100807900 [Glycine max] Back     alignment and taxonomy information
>gi|357465223|ref|XP_003602893.1| Geranylgeranyl transferase type-2 subunit alpha [Medicago truncatula] gi|355491941|gb|AES73144.1| Geranylgeranyl transferase type-2 subunit alpha [Medicago truncatula] Back     alignment and taxonomy information
>gi|297799558|ref|XP_002867663.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297313499|gb|EFH43922.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449433595|ref|XP_004134583.1| PREDICTED: geranylgeranyl transferase type-2 subunit alpha-like [Cucumis sativus] gi|449490592|ref|XP_004158649.1| PREDICTED: geranylgeranyl transferase type-2 subunit alpha-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|7269299|emb|CAB79359.1| Rab geranylgeranyl transferase like protein (fragment) [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query450
TAIR|locus:2121860 678 RGTA1 "RAB geranylgeranyl tran 0.946 0.628 0.551 1.4e-126
TAIR|locus:2153015 687 RGTA2 "RAB geranylgeranyl tran 0.944 0.618 0.481 2e-95
ZFIN|ZDB-GENE-060929-1042 580 rabggta "Rab geranylgeranyltra 0.393 0.305 0.353 8.7e-41
UNIPROTKB|F1PIE1 567 RABGGTA "Uncharacterized prote 0.508 0.403 0.394 3.6e-40
RGD|621697 567 Rabggta "Rab geranylgeranyltra 0.608 0.483 0.369 5.3e-40
MGI|MGI:1860443 567 Rabggta "Rab geranylgeranyl tr 0.508 0.403 0.403 3.7e-39
UNIPROTKB|F1MGN1333 RABGGTA "Geranylgeranyl transf 0.508 0.687 0.394 7e-38
UNIPROTKB|Q5EA80 567 RABGGTA "Geranylgeranyl transf 0.508 0.403 0.394 7e-38
UNIPROTKB|H0YLH3424 RABGGTA "Geranylgeranyl transf 0.508 0.540 0.390 8.9e-38
UNIPROTKB|Q92696 567 RABGGTA "Geranylgeranyl transf 0.508 0.403 0.390 8.9e-38
TAIR|locus:2121860 RGTA1 "RAB geranylgeranyl transferase alpha subunit 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1243 (442.6 bits), Expect = 1.4e-126, P = 1.4e-126
 Identities = 243/441 (55%), Positives = 312/441 (70%)

Query:     1 MHGRPRKPLKPEDXXXXXXXXEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYT 60
             MHGRPR   KPE+         +LR LQSQF+ NHH+ IY+ EA+ELSTKLLE NPE YT
Sbjct:     1 MHGRPRNASKPEEEAASAAKAVQLRSLQSQFMTNHHDKIYTNEAIELSTKLLEINPEAYT 60

Query:    61 AWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHS 120
             AWNYRKLAV+ +L   + DP+ + +ILDEELRVVESALRQNFKSYGAWHHRKW+LSKGHS
Sbjct:    61 AWNYRKLAVEDRLARIEPDPNLVSAILDEELRVVESALRQNFKSYGAWHHRKWVLSKGHS 120

Query:   121 SIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHX 180
             S+ NELRLL+KFQK DSRNFHAWNYRRFV    NRSE+DEL+YT+DMI NNFSNYSAWH 
Sbjct:   121 SVGNELRLLEKFQKLDSRNFHAWNYRRFVVELTNRSEQDELQYTDDMINNNFSNYSAWHN 180

Query:   181 XXXXXXXXXXXXVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSP 240
                          +GF+   K+ P+EY+FVH AIFT+PDDQSGWFYHLWLLDQT+ V++P
Sbjct:   181 RSVLLSSLLAQNADGFMPNIKI-PEEYDFVHSAIFTEPDDQSGWFYHLWLLDQTLNVETP 239

Query:   241 QLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVD 300
              L SSWP+ GS +IL G  CL G +SS FT F  +S +FPL+LYF+QAV GV+SST+T+D
Sbjct:   240 LLTSSWPSHGSSIILSGAGCLSG-SSSMFTTFCSESGSFPLILYFDQAVGGVSSSTVTID 298

Query:   301 SELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGF 360
             SEL  N+ LVW+P+ + NS+ + VWV +L     +    KV   ++ +G+S GI+SS G+
Sbjct:   299 SELKGNEGLVWEPIPNKNSQVSCVWVARLKYVSSDPCEYKV---KIRVGNSPGIVSSRGY 355

Query:   361 HYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKN 420
             +++ P+ F F   +   +T  VE   + I+SW D  F  ++A S+D + + +L +L    
Sbjct:   356 NFNAPYEFVFTAHVH--DT--VEDSQEGIVSWTD-GFDIWDAKSKDLNSLVTLDRL---- 406

Query:   421 DNELTDFEWRAATIAKEIDHF 441
              N   DF+WR   I  E++ F
Sbjct:   407 -NAEMDFKWRQEAIDSEVECF 426
GO:0005737 "cytoplasm" evidence=ISM
GO:0008318 "protein prenyltransferase activity" evidence=IEA
GO:0018342 "protein prenylation" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2153015 RGTA2 "RAB geranylgeranyl transferase alpha subunit 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-1042 rabggta "Rab geranylgeranyltransferase, alpha subunit" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIE1 RABGGTA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|621697 Rabggta "Rab geranylgeranyltransferase, alpha subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1860443 Rabggta "Rab geranylgeranyl transferase, a subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGN1 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA80 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H0YLH3 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q92696 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.5.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00061586
hypothetical protein (696 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query450
COG5536328 COG5536, BET4, Protein prenyltransferase, alpha su 2e-45
PLN02789320 PLN02789, PLN02789, farnesyltranstransferase 5e-24
pfam0123930 pfam01239, PPTA, Protein prenyltransferase alpha s 8e-06
pfam0123930 pfam01239, PPTA, Protein prenyltransferase alpha s 4e-05
pfam0123930 pfam01239, PPTA, Protein prenyltransferase alpha s 1e-04
pfam0123930 pfam01239, PPTA, Protein prenyltransferase alpha s 4e-04
COG5536328 COG5536, BET4, Protein prenyltransferase, alpha su 5e-04
COG5536328 COG5536, BET4, Protein prenyltransferase, alpha su 0.004
>gnl|CDD|227823 COG5536, BET4, Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  160 bits (406), Expect = 2e-45
 Identities = 72/200 (36%), Positives = 108/200 (54%), Gaps = 13/200 (6%)

Query: 39  IYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESAL 98
            YS  A++L+ +L++ NPE YT WNYR   ++H    ++        +LD EL  ++ AL
Sbjct: 46  EYSVRALKLTQELIDKNPEFYTIWNYRFSILKHVQMVSEDKEH----LLDNELDFLDEAL 101

Query: 99  RQNFKSYGAWHHRKWILSK-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSE 157
           + N K+Y  WHHR+W+L      S   EL +  K   +DSRN+H W+YRR+V  ++    
Sbjct: 102 KDNPKNYQIWHHRQWMLELFPKPSWGRELFITKKLLDSDSRNYHVWSYRRWVLRTIEDLF 161

Query: 158 -----EDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQ 212
                + EL+YT  +I  +  N SAWH+R + +     R   G V  +K L  E E++  
Sbjct: 162 NFSDLKHELEYTTSLIETDIYNNSAWHHRYIWIERRFNR---GDVISQKYLEKELEYIFD 218

Query: 213 AIFTDPDDQSGWFYHLWLLD 232
            IFTDPD+QS W Y   +  
Sbjct: 219 KIFTDPDNQSVWGYLRGVSS 238

Length = 328
>gnl|CDD|215423 PLN02789, PLN02789, farnesyltranstransferase Back     alignment and domain information
>gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat Back     alignment and domain information
>gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat Back     alignment and domain information
>gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat Back     alignment and domain information
>gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat Back     alignment and domain information
>gnl|CDD|227823 COG5536, BET4, Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227823 COG5536, BET4, Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 450
KOG0529421 consensus Protein geranylgeranyltransferase type I 100.0
KOG0530318 consensus Protein farnesyltransferase, alpha subun 100.0
PLN02789320 farnesyltranstransferase 100.0
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 100.0
PLN02789320 farnesyltranstransferase 99.94
KOG0529421 consensus Protein geranylgeranyltransferase type I 99.9
KOG0530318 consensus Protein farnesyltransferase, alpha subun 99.87
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 99.73
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.43
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.43
PRK15359144 type III secretion system chaperone protein SscB; 99.3
PRK12370553 invasion protein regulator; Provisional 99.27
PRK15359144 type III secretion system chaperone protein SscB; 99.26
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.17
PRK12370553 invasion protein regulator; Provisional 99.16
PRK11189296 lipoprotein NlpI; Provisional 99.15
PRK11189296 lipoprotein NlpI; Provisional 99.14
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.12
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.07
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.06
KOG1126638 consensus DNA-binding cell division cycle control 99.06
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.06
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.04
KOG1126638 consensus DNA-binding cell division cycle control 99.04
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.02
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.02
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.91
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 98.89
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.81
PRK10370198 formate-dependent nitrite reductase complex subuni 98.81
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.81
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.78
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.76
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.76
PRK10370198 formate-dependent nitrite reductase complex subuni 98.76
PRK11788389 tetratricopeptide repeat protein; Provisional 98.76
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.75
KOG1125579 consensus TPR repeat-containing protein [General f 98.75
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.74
PRK11788389 tetratricopeptide repeat protein; Provisional 98.74
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.68
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.64
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.64
KOG0547606 consensus Translocase of outer mitochondrial membr 98.63
KOG0553304 consensus TPR repeat-containing protein [General f 98.62
KOG0547606 consensus Translocase of outer mitochondrial membr 98.6
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.59
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.56
PF0123931 PPTA: Protein prenyltransferase alpha subunit repe 98.56
PRK10049765 pgaA outer membrane protein PgaA; Provisional 98.55
PF0123931 PPTA: Protein prenyltransferase alpha subunit repe 98.55
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.54
KOG0553304 consensus TPR repeat-containing protein [General f 98.54
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.5
KOG2076 895 consensus RNA polymerase III transcription factor 98.48
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.41
PRK14574 822 hmsH outer membrane protein; Provisional 98.41
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.4
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.38
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.31
PF07711102 RabGGT_insert: Rab geranylgeranyl transferase alph 98.23
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.21
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.21
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.12
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.06
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.04
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.03
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.01
KOG2076 895 consensus RNA polymerase III transcription factor 97.96
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.94
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.9
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.9
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.89
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.89
KOG4234271 consensus TPR repeat-containing protein [General f 97.88
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.87
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.86
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.83
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.8
PRK11906458 transcriptional regulator; Provisional 97.78
PRK11906458 transcriptional regulator; Provisional 97.76
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.72
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 97.71
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.67
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.66
KOG1125579 consensus TPR repeat-containing protein [General f 97.62
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.6
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.59
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.59
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.57
PRK14574 822 hmsH outer membrane protein; Provisional 97.53
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.53
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.52
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.5
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.5
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.5
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.48
KOG0495913 consensus HAT repeat protein [RNA processing and m 97.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.4
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.38
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.33
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.3
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.26
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.24
PF1337173 TPR_9: Tetratricopeptide repeat 97.23
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 97.22
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.21
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.21
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.2
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.16
PRK10803263 tol-pal system protein YbgF; Provisional 97.15
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.15
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.11
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.05
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 96.98
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.91
KOG1128777 consensus Uncharacterized conserved protein, conta 96.9
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.85
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.84
PF1337173 TPR_9: Tetratricopeptide repeat 96.82
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.81
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.64
PRK10747398 putative protoheme IX biogenesis protein; Provisio 96.64
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.63
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.6
KOG2003840 consensus TPR repeat-containing protein [General f 96.5
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.5
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.47
KOG4234271 consensus TPR repeat-containing protein [General f 96.47
PRK10803263 tol-pal system protein YbgF; Provisional 96.4
KOG1128777 consensus Uncharacterized conserved protein, conta 96.4
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.33
KOG0495913 consensus HAT repeat protein [RNA processing and m 96.22
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.22
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.22
KOG2003840 consensus TPR repeat-containing protein [General f 96.2
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.13
PRK15331165 chaperone protein SicA; Provisional 96.09
KOG1129478 consensus TPR repeat-containing protein [General f 95.99
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.85
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 95.69
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.64
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 95.64
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 95.42
PF12688120 TPR_5: Tetratrico peptide repeat 95.32
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 95.01
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.78
PF1343134 TPR_17: Tetratricopeptide repeat 94.69
PF1343134 TPR_17: Tetratricopeptide repeat 94.43
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 94.38
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 94.32
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.17
PRK15331165 chaperone protein SicA; Provisional 94.14
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.1
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.09
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 94.04
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.9
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.89
KOG2376 652 consensus Signal recognition particle, subunit Srp 93.85
KOG4648536 consensus Uncharacterized conserved protein, conta 93.79
KOG4555175 consensus TPR repeat-containing protein [Function 93.6
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 92.94
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 92.94
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.75
PF12688120 TPR_5: Tetratrico peptide repeat 92.22
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 92.02
PF1342844 TPR_14: Tetratricopeptide repeat 91.92
KOG1129478 consensus TPR repeat-containing protein [General f 91.86
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 91.75
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 91.17
KOG4648536 consensus Uncharacterized conserved protein, conta 91.13
PF1342844 TPR_14: Tetratricopeptide repeat 90.76
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 90.33
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 89.87
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 89.7
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 89.56
PRK10941269 hypothetical protein; Provisional 89.08
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 89.05
KOG4555175 consensus TPR repeat-containing protein [Function 89.05
PLN032181060 maturation of RBCL 1; Provisional 89.01
PLN03218 1060 maturation of RBCL 1; Provisional 88.86
PLN03077857 Protein ECB2; Provisional 88.63
PF13512142 TPR_18: Tetratricopeptide repeat 88.12
PLN03077857 Protein ECB2; Provisional 87.54
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 86.6
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 86.47
PF13205107 Big_5: Bacterial Ig-like domain 86.47
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 86.37
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 85.78
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 85.69
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 85.63
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 85.5
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 85.22
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 85.03
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 84.37
KOG1310758 consensus WD40 repeat protein [General function pr 83.79
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 82.2
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 82.16
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 82.07
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 81.95
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 81.47
PF13512142 TPR_18: Tetratricopeptide repeat 80.26
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=9e-58  Score=463.19  Aligned_cols=359  Identities=41%  Similarity=0.684  Sum_probs=297.2

Q ss_pred             CCCCcCC-CCChHHHHHHH---HHHHHHHHHHHHHHHHhhcCCCcHHHHHHHHHHHHhCCCcHHHHHHHHHHHHhhhcCC
Q 013048            1 MHGRPRK-PLKPEDAAASA---AKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTEN   76 (450)
Q Consensus         1 mhgr~~~-~~~~e~~~~~~---~~~~k~~~l~~~~~~~~~~geyseeAL~lt~~~L~~NPd~ytAWn~Rr~iL~~l~~~~   76 (450)
                      ||||+|+ ++++|.+++.+   +++..|+.++++|..+++.|+|+.++|.++.++|..||++|++||||+.++.......
T Consensus         1 Mhg~~kv~~~eee~~~k~~~~~~k~~~~~~~~s~i~~~r~~~~yd~e~l~lt~~ll~~npe~~t~wN~Rr~~~~~r~~~~   80 (421)
T KOG0529|consen    1 MHGRLKVKTTEEEKEAKLKERAFKAGQLRSLFSIIQKKREAKEYDEEHLELTSELLEKNPEFYTVWNYRRLIIEERLTRA   80 (421)
T ss_pred             CCcccccCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhccccchHHHHHHHHHHhhCchhhhhhhhHHHHHHHhhhhh
Confidence            9999999 66777777544   4778888999999999999999999999999999999999999999999999887433


Q ss_pred             CCCcchhhhhHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhCCCC-hHHHHHHHHHHHHhCCCChhhhhHHHHHHHHcCc
Q 013048           77 DSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSS-IDNELRLLDKFQKADSRNFHAWNYRRFVAASMNR  155 (450)
Q Consensus        77 ~~dpe~~~~~~~eEL~~~e~aL~~nPKny~AW~hR~wvL~kl~~~-~~eEL~~~~k~L~~dpkNyhAW~yR~~vl~~L~~  155 (450)
                      +.+|....+.+++||.++..||+.|||+|.+||||+|+|.+...+ +..||.+|+++|+.||||||||+||+||+....+
T Consensus        81 ~~~~~ek~~~ld~eL~~~~~~L~~npksY~aW~hR~w~L~~~p~~~~~~EL~lcek~L~~D~RNfh~W~YRRfV~~~~~~  160 (421)
T KOG0529|consen   81 QLEPLEKQALLDEELKYVESALKVNPKSYGAWHHRKWVLQKNPHSDWNTELQLCEKALKQDPRNFHAWHYRRFVVEQAER  160 (421)
T ss_pred             cCCHHHHHHhhHHHHHHHHHHHHhCchhHHHHHHHHHHHHhCCCchHHHHHHHHHHHHhcCcccccchHHHHHHHHHHhc
Confidence            456666678999999999999999999999999999999987644 8999999999999999999999999999999988


Q ss_pred             C---hHHHHHHHHHHHHhccCChhHHHHHHHHHHHhhhhhccCccchhchHHHHHHHHHHHHHhCCCCcchHHHHHHHHc
Q 013048          156 S---EEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLD  232 (450)
Q Consensus       156 ~---~eeELe~~dk~I~~npsNySAW~yR~~LL~~L~~~~~~g~~~~~~ileeELe~v~~AI~~dP~deSaW~Y~r~LL~  232 (450)
                      .   ..+||+||+++|..||+||||||||..+|+.+.+....|..-..+.+..|++.+++|+++||+|+|+|+|++|||+
T Consensus       161 ~~~~~~~El~ftt~~I~~nfSNYsaWhyRs~lL~~l~~~~~~g~~~~~~~l~sEle~v~saiFTdp~DqS~WfY~rWLl~  240 (421)
T KOG0529|consen  161 SRNLEKEELEFTTKLINDNFSNYSAWHYRSLLLSTLHPKEADGNFMPKELLQSELEMVHSAIFTDPEDQSCWFYHRWLLG  240 (421)
T ss_pred             ccccchhHHHHHHHHHhccchhhhHHHHHHHHHHHhccccccCccCCHHHHHHHHHHHHHHHhcCccccceeeehHHhhc
Confidence            7   7899999999999999999999999999999998776663223456799999999999999999999999999999


Q ss_pred             ccccCCCCcccccCCCCCCcceecCCccccCCCCCCcccccCCCCccceEEeeccccccccccceEEecccCcCccceee
Q 013048          233 QTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWK  312 (450)
Q Consensus       233 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~s~~~~~~~~~~~~~~~~~f~~~v~~~~~~~~~~~~~~~~~~~~~w~  312 (450)
                      +.++.+                     |..++. +   .+++.++.+|.+.+|-+.+.||.+   ++.++..       -
T Consensus       241 ~~~~~~---------------------~~~~S~-s---~~ls~~~~~p~~~~l~~e~~~v~~---~i~~E~~-------~  285 (421)
T KOG0529|consen  241 RGMRRE---------------------CYIVSH-S---ALLSESFSEPLIKYLRSEIGLVQS---TIGSEFE-------T  285 (421)
T ss_pred             cccccc---------------------cccccc-c---cccccccCCccHHHHHHHhhhhhh---hhhhhcc-------c
Confidence            987765                     222211 1   446778899999999999999864   3334431       1


Q ss_pred             eCCCCCCccceeEEEeccCCCCCCCCCccccEEEecCcccccccCCCcccCCCcceEEEEEEeecccccccccccceeec
Q 013048          313 PLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISW  392 (450)
Q Consensus       313 ~~~~~~~~~~~~w~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~  392 (450)
                      |++..+      |.|+.+.                             +|..|++   |.+|+.+.+..+.+    .++|
T Consensus       286 ~~d~~g------w~~~~~~-----------------------------n~~s~~~---~~~v~~~~e~~~~~----~~~~  323 (421)
T KOG0529|consen  286 PIDKRG------WLCESLV-----------------------------NLESPYE---TKRVHLTVEDQQFG----IVSW  323 (421)
T ss_pred             cccccC------chhcccc-----------------------------chhhhhh---cccccccccccccc----cccc
Confidence            333222      7777553                             5677777   55666666545555    8999


Q ss_pred             cCCCccccc-cccCCCCCccccccccccCCCCcchhhhhHHHHHHHHHHHHhhhh
Q 013048          393 RDESFHNYN-AHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLS  446 (450)
Q Consensus       393 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  446 (450)
                      ++ +++.|. +...+.+++-         .++.+...|..++|..++++++-+||
T Consensus       324 ~~-~~e~~~~~~~~~l~~~~---------~~e~~~~a~lqe~ie~c~~l~~~~P~  368 (421)
T KOG0529|consen  324 VA-SNEQWLHALLDDLDSLD---------CNEETRRAWLQEQIESCVELQELLPD  368 (421)
T ss_pred             hh-hhhhhHHHHhhhccccc---------hhhhccHHHHHHHHHHHHHHHhhCCc
Confidence            98 788887 5555555533         37889999999999999999999886

>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF01239 PPTA: Protein prenyltransferase alpha subunit repeat; InterPro: IPR002088 Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF01239 PPTA: Protein prenyltransferase alpha subunit repeat; InterPro: IPR002088 Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF07711 RabGGT_insert: Rab geranylgeranyl transferase alpha-subunit, insert domain ; InterPro: IPR009087 Rab geranylgeranyltransferase (RabGGT) catalyses the transfer of geranylgeranyl groups to the C-terminal cysteine residues of Rab proteins, Ras-related small GTPases that function in intracellular vesicular transport [] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13205 Big_5: Bacterial Ig-like domain Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query450
1ltx_A 567 Structure Of Rab Escort Protein-1 In Complex With R 3e-39
1dce_A 567 Crystal Structure Of Rab Geranylgeranyltransferase 1e-38
4ehm_A330 Rabggtase In Complex With Covalently Bound Psoromic 7e-38
3pz1_A332 Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) 8e-38
3dss_A331 Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) 8e-38
3c72_A334 Engineered Rabggtase In Complex With A Peptidomimet 8e-38
1o5m_A377 Structure Of Fpt Bound To The Inhibitor Sch66336 Le 1e-11
1qbq_A333 Structure Of Rat Farnesyl Protein Transferase Compl 1e-11
2bed_A313 Structure Of Fpt Bound To Inhibitor Sch207736 Lengt 1e-11
1o1r_A380 Structure Of Fpt Bound To Ggpp Length = 380 1e-11
2r2l_A315 Structure Of Farnesyl Protein Transferase Bound To 1e-11
1n95_A315 Aryl Tetrahydrophyridine Inhbitors Of Farnesyltranf 1e-11
1nl4_A312 Crystal Structure Of Rat Farnesyl Transferase In Co 1e-11
3pz4_A379 Crystal Structure Of Ftase(Alpha-Subunit; Beta-Subu 2e-11
1ft1_A377 Crystal Structure Of Protein Farnesyltransferase At 2e-11
1ft2_A315 Co-Crystal Structure Of Protein Farnesyltransferase 2e-11
2f0y_A379 Crystal Structure Of Human Protein Farnesyltransfer 1e-10
1jcq_A382 Crystal Structure Of Human Protein Farnesyltransfer 1e-10
3dra_A306 Candida Albicans Protein Geranylgeranyltransferase- 9e-08
3sfx_A349 Cryptococcus Neoformans Protein Farnesyltransferase 2e-06
3sfx_A349 Cryptococcus Neoformans Protein Farnesyltransferase 3e-05
3q73_A349 Cryptococcus Neoformans Protein Farnesyltransferase 2e-06
3q73_A349 Cryptococcus Neoformans Protein Farnesyltransferase 3e-05
>pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Back     alignment and structure 
Iteration: 1

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 106/295 (35%), Positives = 145/295 (49%), Gaps = 21/295 (7%)
Query: 1   MHGRPRKPLKPEDXXXXXXXXE-KLRVLQSQ---FLHNHHNHIYSKEAVELSTKLLETNP 56
           MHGR +     E         E KL++ QS               +  +EL++++L  NP
Sbjct: 1   MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60
Query: 57  ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116
           +  T WN R+  +QH   E +  P+   +++  EL  +ES LR N KSYG WHHR W+LS
Sbjct: 61  DFATLWNCRREVLQH--LETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118
Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175
           +    +   EL L  +F +AD RNFH W+YRRFVAA    +  +EL +T+ +I  NFSNY
Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178
Query: 176 SAWHXXXXXXXXXXXXXVEGFVSK--EKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233
           S+WH               G   +  E VL  E E V  A FTDP+DQS WFYH WLL +
Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238
Query: 234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQA 288
               D    V          +   + CL  C S P T   + SR   L+L  ++A
Sbjct: 239 AEPHDVLCCVH---------VSREEACLSVCFSRPLT---VGSRMGTLLLMVDEA 281
>pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Back     alignment and structure
>pdb|4EHM|A Chain A, Rabggtase In Complex With Covalently Bound Psoromic Acid Length = 330 Back     alignment and structure
>pdb|3PZ1|A Chain A, Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) In Complex With Bms3 Length = 332 Back     alignment and structure
>pdb|3DSS|A Chain A, Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) Length = 331 Back     alignment and structure
>pdb|3C72|A Chain A, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor Length = 334 Back     alignment and structure
>pdb|1O5M|A Chain A, Structure Of Fpt Bound To The Inhibitor Sch66336 Length = 377 Back     alignment and structure
>pdb|1QBQ|A Chain A, Structure Of Rat Farnesyl Protein Transferase Complexed With A Cvim Peptide And Alpha-Hydroxyfarnesylphosphonic Acid Length = 333 Back     alignment and structure
>pdb|2BED|A Chain A, Structure Of Fpt Bound To Inhibitor Sch207736 Length = 313 Back     alignment and structure
>pdb|1O1R|A Chain A, Structure Of Fpt Bound To Ggpp Length = 380 Back     alignment and structure
>pdb|2R2L|A Chain A, Structure Of Farnesyl Protein Transferase Bound To Pb-93 Length = 315 Back     alignment and structure
>pdb|1N95|A Chain A, Aryl Tetrahydrophyridine Inhbitors Of Farnesyltranferase: Glycine, Phenylalanine And Histidine Derivatives Length = 315 Back     alignment and structure
>pdb|1NL4|A Chain A, Crystal Structure Of Rat Farnesyl Transferase In Complex With A Potent Biphenyl Inhibitor Length = 312 Back     alignment and structure
>pdb|3PZ4|A Chain A, Crystal Structure Of Ftase(Alpha-Subunit; Beta-Subunit Delta C10) In Complex With Bms3 And Lipid Substrate Fpp Length = 379 Back     alignment and structure
>pdb|1FT1|A Chain A, Crystal Structure Of Protein Farnesyltransferase At 2.25 Angstroms Resolution Length = 377 Back     alignment and structure
>pdb|1FT2|A Chain A, Co-Crystal Structure Of Protein Farnesyltransferase Complexed With A Farnesyl Diphosphate Substrate Length = 315 Back     alignment and structure
>pdb|2F0Y|A Chain A, Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate And Hydantoin Derivative Length = 379 Back     alignment and structure
>pdb|1JCQ|A Chain A, Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate And The Peptidomimetic Inhibitor L-739,750 Length = 382 Back     alignment and structure
>pdb|3DRA|A Chain A, Candida Albicans Protein Geranylgeranyltransferase-I Complexed With Ggpp Length = 306 Back     alignment and structure
>pdb|3SFX|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase In Complex With Fpt-Ii And Tipifarnib Length = 349 Back     alignment and structure
>pdb|3SFX|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase In Complex With Fpt-Ii And Tipifarnib Length = 349 Back     alignment and structure
>pdb|3Q73|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase, Apo Enzyme Length = 349 Back     alignment and structure
>pdb|3Q73|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase, Apo Enzyme Length = 349 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query450
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 6e-76
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 2e-71
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 3e-09
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 2e-07
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 1e-56
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 5e-11
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 1e-56
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 2e-11
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 3e-07
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-53
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 9e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-04
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
 Score =  246 bits (629), Expect = 6e-76
 Identities = 99/280 (35%), Positives = 134/280 (47%), Gaps = 9/280 (3%)

Query: 1   MHGRPRKPLKPEDAAA----SAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNP 56
           MHGR +     E A A       K +  +                +  +EL++++L  NP
Sbjct: 1   MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60

Query: 57  ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116
           +  T WN R+  +QH   E +  P+   +++  EL  +ES LR N KSYG WHHR W+LS
Sbjct: 61  DFATLWNCRREVLQHL--ETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118

Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175
           +    +   EL L  +F +AD RNFH W+YRRFVAA    +  +EL +T+ +I  NFSNY
Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178

Query: 176 SAWHNRSLLLSNLLKRKVEGFVSK--EKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233
           S+WH RS LL  L  +   G   +  E VL  E E V  A FTDP+DQS WFYH WLL +
Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238

Query: 234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFH 273
               D    V          +        G          
Sbjct: 239 AEPHDVLCCVHVSREEACLSVCFSRPLTVGSRMGTLLLMV 278
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* Length = 331 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* Length = 331 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* Length = 331 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Length = 349 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Length = 349 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query450
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 100.0
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 100.0
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 100.0
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 100.0
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.97
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.97
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.94
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.91
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.84
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.71
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.71
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.61
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.57
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.56
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.55
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.54
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.54
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.53
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.53
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.52
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.52
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.51
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.51
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.49
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.49
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.48
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.48
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.47
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.47
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.47
3u4t_A272 TPR repeat-containing protein; structural genomics 99.45
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.45
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.45
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.44
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.44
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.44
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.44
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.41
3u4t_A272 TPR repeat-containing protein; structural genomics 99.4
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.4
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.39
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.39
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.38
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.38
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.38
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.38
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.37
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.37
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.36
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.35
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.35
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.33
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.32
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.32
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.32
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.32
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.31
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.3
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.29
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.28
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.27
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.27
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.27
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.25
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.25
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.24
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.2
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.2
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.19
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.18
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.16
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.13
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.1
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.1
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.07
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.07
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.05
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.05
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.04
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.03
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.01
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.01
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.0
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.98
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.98
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.97
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.97
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.96
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.96
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.95
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.94
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.94
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.93
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.9
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.9
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.9
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.89
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.88
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.88
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.87
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.87
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.86
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.84
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.83
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.83
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.82
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.82
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.82
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.81
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.81
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.81
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.81
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.8
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.8
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.8
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.8
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.79
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.79
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.79
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.78
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.75
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.75
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.74
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.72
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.72
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.71
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.7
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.68
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.67
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.67
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.66
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.66
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.65
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.64
3k9i_A117 BH0479 protein; putative protein binding protein, 98.64
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.63
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.58
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.58
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.58
3k9i_A117 BH0479 protein; putative protein binding protein, 98.55
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.55
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.49
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.49
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.46
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.42
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.36
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.34
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.32
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.14
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.14
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.13
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.12
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.11
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.11
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.02
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.02
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.0
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.99
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.97
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.97
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.84
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.76
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.71
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.63
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.61
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.59
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 97.57
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.56
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.53
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 97.41
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.38
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.37
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.29
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.28
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.07
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.97
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.95
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 96.72
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.62
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 96.6
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.55
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.27
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.96
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 95.59
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.54
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.42
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.32
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 95.0
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 94.93
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.56
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 94.43
1klx_A138 Cysteine rich protein B; structural genomics, heli 93.97
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.14
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 92.73
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 92.29
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 91.65
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 91.52
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 89.05
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 86.56
3qww_A433 SET and MYND domain-containing protein 2; methyltr 85.04
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 84.48
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 83.53
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 80.32
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
Probab=100.00  E-value=7.1e-55  Score=468.03  Aligned_cols=319  Identities=33%  Similarity=0.572  Sum_probs=267.6

Q ss_pred             CCCCcCC-CCChHHHHHH---HHHHHHHHHHHHHHHHHhhcCCCcHHHHHHHHHHHHhCCCcHHHHHHHHHHHHhhhcCC
Q 013048            1 MHGRPRK-PLKPEDAAAS---AAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTEN   76 (450)
Q Consensus         1 mhgr~~~-~~~~e~~~~~---~~~~~k~~~l~~~~~~~~~~geyseeAL~lt~~~L~~NPd~ytAWn~Rr~iL~~l~~~~   76 (450)
                      ||||+|+ ++++++++|+   .+|.+.|+.++++|++.+..|+|+++||++++++|.+||++|+||++||.++..++.  
T Consensus         1 mhg~~~~~~~~~~~~~~~~~~~~k~~~y~~~~~~~~~~~~~~~~~eeal~~~~~~l~~nP~~~taW~~R~~~l~~l~~--   78 (567)
T 1dce_A            1 MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLET--   78 (567)
T ss_dssp             CCSCBCSSCSTTSSCCSCCCCHHHHHHHHHHHHHHHHHHHTTCCSHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHT--
T ss_pred             CCCCCcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHCchhHHHHHHHHHHHHhccc--
Confidence            9999998 5555554444   568888999999999999999999999999999999999999999999999999974  


Q ss_pred             CCCcchhhhhHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhCC-CChHHHHHHHHHHHHhCCCChhhhhHHHHHHHHcCc
Q 013048           77 DSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGH-SSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNR  155 (450)
Q Consensus        77 ~~dpe~~~~~~~eEL~~~e~aL~~nPKny~AW~hR~wvL~kl~-~~~~eEL~~~~k~L~~dpkNyhAW~yR~~vl~~L~~  155 (450)
                      ..+++.....+++||++++++|+.|||+|+||+||+|++.+++ ..+++|+++|++++++||+|||||+||+|++..++.
T Consensus        79 ~~~~~~~~~~~~~eL~~~~~~l~~~pK~y~aW~hR~w~l~~l~~~~~~~el~~~~k~l~~d~~N~~aW~~R~~~l~~l~~  158 (567)
T 1dce_A           79 EKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAV  158 (567)
T ss_dssp             TSCHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTCSSCCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTCC
T ss_pred             ccchhhhhhhHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcccccHHHHHHHHHHHHhhccccccHHHHHHHHHHHcCC
Confidence            2234455667999999999999999999999999999999984 256999999999999999999999999999999995


Q ss_pred             ChHHHHHHHHHHHHhccCChhHHHHHHHHHHHhhhhhccCc--cchhchHHHHHHHHHHHHHhCCCCcchHHHHHHHHcc
Q 013048          156 SEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGF--VSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ  233 (450)
Q Consensus       156 ~~eeELe~~dk~I~~npsNySAW~yR~~LL~~L~~~~~~g~--~~~~~ileeELe~v~~AI~~dP~deSaW~Y~r~LL~~  233 (450)
                      ..++|++|++++|+.||+|+|||+||+.++..+......+.  ....+.+++|++++++||+++|+|+|+|+|++|++.+
T Consensus       159 ~~~~el~~~~~~I~~~p~n~saW~~r~~ll~~l~~~~~~~~~~~~~~~~~~eel~~~~~ai~~~P~~~saW~y~~~ll~~  238 (567)
T 1dce_A          159 APAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR  238 (567)
T ss_dssp             CHHHHHHHHHTTTTTTCCCHHHHHHHHHHHHHHSCCCCSSSCCSSCHHHHHHHHHHHHHHHHHCSSCSHHHHHHHHHHSC
T ss_pred             ChHHHHHHHHHHHHHCCCCccHHHHHHHHHHhhcccccccccccccHHHHHHHHHHHHHHHhhCCCCccHHHHHHHHHhc
Confidence            55699999999999999999999999999999865432211  1234678999999999999999999999999999999


Q ss_pred             cccCCCCcccccCCCCCCcceecCCccccCCCCCCcccccCCCCccceEEeeccccccccc-cceEEecccCcCccceee
Q 013048          234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNS-STITVDSELNTNKDLVWK  312 (450)
Q Consensus       234 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~s~~~~~~~~~~~~~~~~~f~~~v~~~~~-~~~~~~~~~~~~~~~~w~  312 (450)
                      ..+.+   .+.|               +          |++ ....++|++|++||..-.. +|+.+.+... ...++|+
T Consensus       239 ~~~~~---~~~~---------------~----------~~~-~~~~~~~~~f~~~i~~~~~~~~~~~~~~~~-~~~~~W~  288 (567)
T 1dce_A          239 AEPHD---VLCC---------------V----------HVS-REEACLSVCFSRPLTVGSRMGTLLLMVDEA-PLSVEWR  288 (567)
T ss_dssp             CCCCS---CEEE---------------E----------EEE-TTTTEEEEEEEEEECTTBTTBCEEEEESSS-EECCCCB
T ss_pred             CCCcc---ceee---------------e----------eec-cCCceEEEEeccceeccccccceEEeecCc-ccceeec
Confidence            75422   2211               1          122 3577799999999985433 2488888754 5799999


Q ss_pred             eCCCCCCccceeEEEeccCCCCCCCCCccccEEEecCcccc
Q 013048          313 PLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQG  353 (450)
Q Consensus       313 ~~~~~~~~~~~~w~~~l~~~~~~~~~~~~~~~~~~~~~~~~  353 (450)
                      |+. .++++++||+++++.++...+ ..+|+|+|.+++.++
T Consensus       289 ~~~-~~~~~~~vw~~~~~~~~~~~~-~~~~~~~~~~~~~~~  327 (567)
T 1dce_A          289 TPD-GRNRPSHVWLCDLPAASLNDQ-LPQHTFRVIWTGSDS  327 (567)
T ss_dssp             CTT-SSCCSEEEEEEECCGGGTSTT-SSEEEEEEEETTTTE
T ss_pred             cCC-cccccceeEEeecCccccccc-cccceEEEeeccCCC
Confidence            998 678899999999998765444 568999999987664
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 450
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 3e-37
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-16
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 0.002
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: Protein prenylyltransferase
family: Protein prenylyltransferase
domain: Rab geranylgeranyltransferase alpha-subunit, N-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  136 bits (343), Expect = 3e-37
 Identities = 95/240 (39%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 1   MHGRPRKPLKPEDAAAS----AAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNP 56
           MHGR +     E A A       K +  +                +  +EL++++L  NP
Sbjct: 1   MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60

Query: 57  ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116
           +  T WN R+  +QH   E +  P+   +++  EL  +ES LR N KSYG WHHR W+LS
Sbjct: 61  DFATLWNCRREVLQH--LETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118

Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175
           +    +   EL L  +F +AD RNFH W+YRRFVAA    +  +EL +T+ +I  NFSNY
Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178

Query: 176 SAWHNRSLLLSNLLKRK--VEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233
           S+WH RS LL  L  +          E VL  E E V  A FTDP+DQS WFYH WLL +
Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query450
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.98
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.72
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.59
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.59
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.49
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.48
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.47
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.22
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.19
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.05
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.04
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.01
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.97
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.9
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.89
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.84
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.79
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.79
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.76
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.73
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.73
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.73
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.71
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.68
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.67
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.65
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.65
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.56
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.5
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.46
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.39
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.17
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.14
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1dcea2109 Rab geranylgeranyltransferase alpha-subunit, inser 98.06
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.88
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.56
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.49
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.47
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.43
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.34
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.3
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.25
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.94
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.51
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.34
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.81
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: Protein prenylyltransferase
family: Protein prenylyltransferase
domain: Protein farnesyltransferase alpha-subunit
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.98  E-value=1.9e-32  Score=269.20  Aligned_cols=204  Identities=24%  Similarity=0.467  Sum_probs=188.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhcCCCcHHHHHHHHHHHHhCCCcHHHHHHHHHHHHhhhcCCCCCcchhhhhHHHHH
Q 013048           12 EDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEEL   91 (450)
Q Consensus        12 e~~~~~~~~~~k~~~l~~~~~~~~~~geyseeAL~lt~~~L~~NPd~ytAWn~Rr~iL~~l~~~~~~dpe~~~~~~~eEL   91 (450)
                      +.+++.+++.++|.++++.+...+.+++.+++||++++++|.+||++++||++|+.++..++.           .+++|+
T Consensus        30 ~~~~~~I~~~p~~~~a~~~~~~~~~~~e~~~~Al~~~~~ai~lnP~~~~a~~~r~~~l~~l~~-----------~~~eal   98 (315)
T d2h6fa1          30 PNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQK-----------DLHEEM   98 (315)
T ss_dssp             SSCSSEECCCHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTC-----------CHHHHH
T ss_pred             CCcccccccCHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHCCCChHHHHHHHHHHHHhCc-----------CHHHHH
Confidence            456667888999999999999999999888999999999999999999999999999999863           589999


Q ss_pred             HHHHHHHHhCCCChHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCCChhhhhHHHHHHHHcCcChHHHHHHHHHHHHhc
Q 013048           92 RVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNN  171 (450)
Q Consensus        92 ~~~e~aL~~nPKny~AW~hR~wvL~kl~~~~~eEL~~~~k~L~~dpkNyhAW~yR~~vl~~L~~~~eeELe~~dk~I~~n  171 (450)
                      .+++++|..+||++.+|+||++++.+++ .+++|++++++++++||+|+++|.+|++++..++.++ +++++++++|+.|
T Consensus        99 ~~~~~al~~~p~~~~a~~~~~~~~~~l~-~~~eAl~~~~kal~~dp~n~~a~~~~~~~~~~~~~~~-~Al~~~~~al~~~  176 (315)
T d2h6fa1          99 NYITAIIEEQPKNYQVWHHRRVLVEWLR-DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWD-NELQYVDQLLKED  176 (315)
T ss_dssp             HHHHHHHHHCTTCHHHHHHHHHHHHHHT-CCTTHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCCT-THHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHhhhhHHHHHhHHHHhhc-cHHHHHHHHhhhhhhhhcchHHHHHHHHHHHHHHhhH-HHHHHHHHHHHHC
Confidence            9999999999999999999999999985 8999999999999999999999999999999999997 8999999999999


Q ss_pred             cCChhHHHHHHHHHHHhhhhhccCccchhchHHHHHHHHHHHHHhCCCCcchHHHHHHHHccc
Q 013048          172 FSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQT  234 (450)
Q Consensus       172 psNySAW~yR~~LL~~L~~~~~~g~~~~~~ileeELe~v~~AI~~dP~deSaW~Y~r~LL~~~  234 (450)
                      |+|.+||++|+.++..++..      .....+++|++++.++|.++|+|.++|+|+++++...
T Consensus       177 p~n~~a~~~r~~~l~~~~~~------~~~~~~~~ai~~~~~al~~~P~~~~~~~~l~~ll~~~  233 (315)
T d2h6fa1         177 VRNNSVWNQRYFVISNTTGY------NDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDR  233 (315)
T ss_dssp             TTCHHHHHHHHHHHHHTTCS------CSHHHHHHHHHHHHHHHHHSTTCHHHHHHHHHHHTTT
T ss_pred             CccHHHHHHHHHHHHHcccc------chhhhhHHhHHHHHHHHHhCCCchHHHHHHHHHHHhc
Confidence            99999999999999987652      1234579999999999999999999999999998653
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea2 b.7.4.1 (A:242-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure