Citrus Sinensis ID: 013114

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45

MMSVSVVSSQVPLTSFHHLKGRRKSRSRRPRAMPISASDAGTDENDKSTTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNSNLSAVRIETTKMFLEPLNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKTDLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHKFGCFLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTASPHLDEESAERVRKNFSPLPLSFLPHLPTDSSLDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIHLPPQIQGKVGGARFIERNLIVTMG

cccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHcccccccccEEEccccEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHHHccEEccEEEcccccccHHHHHHHHHHcccccEEEcccccccccccHHHHHccccccHHHHHHHHHccccccccccEEEccccEEEEEEcccccccccEEEccccccEEEEEEcccccccccccccccccccEEEEccEEEEEcc

cccEEEEEcccccccccEEccccccccccccccHHHHHHHcccccccccEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccccccHHHHccccccccccEccHcccHHEHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHcHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHHHHcccccccHHcccccccEEEEEcccEEEEEEEEcccccccEEEEEEEcccEEEEEEcccEEEEEccHHHcccccccEEcccEEEEEEc

MMSVSVVssqvpltsfhhlkgrrksrsrrprampisasdagtdendkstTLITFlgkggsgkttSAVFAAQHYAMAGLSTCLvlhsqdptaeyilnckignspvvcnsnLSAVRIETTKMFLEPLNWLKQADARLNMTQGVlggvvgeelgvlpgmdSIFSAFALERLVGFFGnfaqrnhqkeKFDVIvydgispeetLRMIGVSSKARLYLKYLRNVaektdlgrltapSLLKLVDEALsisgrrpllngntsAEIWDAMDRMLERgssalaephkfgcflvmnpnnrtsVNSALRYWGCTIQAGAQVAGAIctasphldeESAERVrknfsplplsflphlptdssldwntimlnpagKEARDLLSLQAKRSSSLMSSVKFDAAKKSVtllmpgfdkseIKLYQyrggsellveagdqrrvihlppqiqgkvggarfIERNLIVTMG

mmsvsvvssqvpltsfhhlkgrrksrsrrprampisasdagtdendksTTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNSNLSAVRIETTKMFLEPLNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERLVGFFGNFAqrnhqkekFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNvaektdlgrltapslLKLVDEAlsisgrrpllngnTSAEIWDAMDRMLERGSSALAEPHKFGCFLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTASPHLDEESAERVRKNFSPLPLSFLPHLPTDSSLDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIHlppqiqgkvggarfIERNLIVTMG

MMsvsvvssqvPLTSFHHLKGrrksrsrrprAMPISASDAGTDENDKSTTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNSNLSAVRIETTKMFLEPLNWLKQADARLNMTQgvlggvvgeelgvlPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKTDLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHKFGCFLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTASPHLDEESAERVRKNfsplplsflphlpTDSSLDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIHLPPQIQGKVGGARFIERNLIVTMG

**************************************************LITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNSNLSAVRIETTKMFLEPLNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKTDLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLER**SALAEPHKFGCFLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTAS******************PLSFLPHLPTDSSLDWNTIMLN******************************KSVTLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIHLPPQIQGKVGGARFIERNLIV***

***********************************************STTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNSNLSAVRIETTKMFLEPLNWLKQADAR***********VGEELGVLPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVA*******************************GNTSAEIWDAMDRMLERGSSALAEPHKFGCFLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTASPHLDEESAERVRKNFSPLPLSFLPHLPTDSSLDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIHLPPQIQGKVGGARFIERNLIVTMG

**********VPLTSFH*****************ISASDAGTDENDKSTTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNSNLSAVRIETTKMFLEPLNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKTDLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHKFGCFLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTASP**********RKNFSPLPLSFLPHLPTDSSLDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIHLPPQIQGKVGGARFIERNLIVTMG

**SVSVVSSQVPLTSFHHLKGR************************KSTTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNSNLSAVRIETTKMFLEPLNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKTDLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHKFGCFLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTASPHLDEESAERVRKNFSPLPLSFLPHLPTDSSLDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIHLPPQIQGKVGGARFIERNLIVTMG

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		449	2.2.26 [Sep-21-2011]
Q6DYE4		455	Uncharacterized protein A	yes	no	0.991	0.978	0.590	1e-155
Q46465		405	Putative arsenical pump-d	N/A	no	0.808	0.896	0.237	2e-10
Q46366		405	Putative arsenical pump-d	no	no	0.797	0.883	0.234	2e-10
Q55794		396	Putative arsenical pump-d	N/A	no	0.750	0.851	0.231	9e-07
O52027		644	Putative arsenical pump-d	yes	no	0.347	0.242	0.273	2e-05
O66908		396	Putative arsenical pump-d	yes	no	0.331	0.376	0.251	0.0002
Q58542		349	Putative arsenical pump-d	yes	no	0.563	0.724	0.226	0.0002

>sp\|Q6DYE4\|Y1609_ARATH Uncharacterized protein At1g26090, chloroplastic OS=Arabidopsis thaliana GN=At1g26090 PE=1 SV=1	Back alignment and function desciption

 Score =  547 bits (1409), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 268/454 (59%), Positives = 339/454 (74%), Gaps = 9/454 (1%)

Query: 1   MMSVSVVSSQVPLTSFHHLKGRRKSRSRRPRAMPISAS------DAGTDENDKSTTLITF 54
           +++ S+  S + L     L+    S SR+ RA  ++A+      D   D + K T  +TF
Sbjct: 4   LVNSSLTCSSLTLNLLPILRTETPSLSRKRRAAYVAATSSRDVNDTAADSSQKLTKFVTF 63

Query: 55  LGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNSNLSAVR 114
           LGKGGSGKTT+AVFAAQHYA+AGLSTCLV+H+QDP+AE++L  KIG SP + N NLS +R
Sbjct: 64  LGKGGSGKTTAAVFAAQHYALAGLSTCLVIHNQDPSAEFLLGSKIGTSPTLINDNLSVIR 123

Query: 115 IETTKMFLEPLNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERLVGFFGN 174
           +ETTKM LEPL  LKQADARLNMTQGVL GVVGEELGVLPGMDSIFS   LERLVGFF  
Sbjct: 124 LETTKMLLEPLKQLKQADARLNMTQGVLEGVVGEELGVLPGMDSIFSMLELERLVGFFRQ 183

Query: 175 FAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKTDLGRLTAPSLLK 234
             ++NH+ + FDVI+YDGIS EETLRMIG+SSK RLY KYLR++AEKTDLGRLT+PS+++
Sbjct: 184 ATRKNHKGKPFDVIIYDGISTEETLRMIGLSSKTRLYAKYLRSLAEKTDLGRLTSPSIMR 243

Query: 235 LVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHKFGCFLVMNPNNRTSVNS 294
            VDE+++I+  +   +G TS  +WD ++R LE G+SA  +P +F  FLVM+PNN  SV +
Sbjct: 244 FVDESMNINSNKSPFDGMTSPAMWDTLERFLETGASAWRDPERFRSFLVMDPNNPMSVKA 303

Query: 295 ALRYWGCTIQAGAQVAGAICTASPHLDEESAERVRKNFSPLPLSFLPHLPTDSSLDWNTI 354
           ALRYWGCT+QAG+ V+GA   +S HL   +++  + +F PLP +      T + LDW+ I
Sbjct: 304 ALRYWGCTVQAGSHVSGAFAISSSHL---TSQIPKADFVPLPFASASVPFTITGLDWDKI 360

Query: 355 MLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGFDKSEIKLYQYRGGSELL 414
           +L+ A    R+LLS      +SL  +V FD AKK VTL MPGF+KSEIKLYQYRGGSELL
Sbjct: 361 LLDQANSSIRELLSETVSHGTSLTQTVMFDTAKKLVTLFMPGFEKSEIKLYQYRGGSELL 420

Query: 415 VEAGDQRRVIHLPPQIQGKVGGARFIERNLIVTM 448
           +EAGDQRRVIHLP QIQGKVGGA+F++R+LIVTM
Sbjct: 421 IEAGDQRRVIHLPSQIQGKVGGAKFVDRSLIVTM 454

Arabidopsis thaliana (taxid: 3702)

>sp\|Q46465\|ARSA_PROVB Putative arsenical pump-driving ATPase OS=Prosthecochloris vibrioformis PE=3 SV=1	Back alignment and function description

>sp\|Q46366\|ARSA_CHLTE Putative arsenical pump-driving ATPase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=CT1945 PE=3 SV=2	Back alignment and function description

>sp\|Q55794\|ARSA_SYNY3 Putative arsenical pump-driving ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0086 PE=3 SV=1	Back alignment and function description

>sp\|O52027\|ARSA_HALSA Putative arsenical pump-driving ATPase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsA PE=3 SV=1	Back alignment and function description

>sp\|O66908\|ARSA1_AQUAE Putative arsenical pump-driving ATPase 1 OS=Aquifex aeolicus (strain VF5) GN=arsA1 PE=3 SV=1	Back alignment and function description

>sp\|Q58542\|ARSA_METJA Putative arsenical pump-driving ATPase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1142 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		449
297737875		441	unnamed protein product [Vitis vinifera]	0.930	0.947	0.697	1e-170
225423857		441	PREDICTED: uncharacterized protein At1g2	0.930	0.947	0.695	1e-169
224108555		424	predicted protein [Populus trichocarpa]	0.930	0.985	0.667	1e-162
388501194		440	unknown [Medicago truncatula]	0.946	0.965	0.640	1e-160
356499729		442	PREDICTED: uncharacterized protein At1g2	0.964	0.979	0.641	1e-158
359483702		410	PREDICTED: LOW QUALITY PROTEIN: uncharac	0.902	0.987	0.669	1e-158
357488245		440	hypothetical protein MTR_5g053280 [Medic	0.946	0.965	0.640	1e-157
449493472		448	PREDICTED: uncharacterized protein At1g2	0.939	0.941	0.640	1e-155
42562319		455	P-loop containing nucleoside triphosphat	0.991	0.978	0.590	1e-153
297851072		453	ATP binding protein [Arabidopsis lyrata	0.951	0.942	0.603	1e-152

>gi\|297737875\|emb\|CBI27076.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 295/423 (69%), Positives = 351/423 (82%), Gaps = 5/423 (1%)

Query: 26  RSRRPRAMPISASDAGTDENDKSTTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLH 85
           R RR  A+  +AS     E D ST L+TFLGKGGSGKTTSA+FAAQHYAM G +TCLV+H
Sbjct: 23  RRRRHGALATTASS----EEDHSTKLVTFLGKGGSGKTTSAIFAAQHYAMTGFNTCLVIH 78

Query: 86  SQDPTAEYILNCKIGNSPVVCNSNLSAVRIETTKMFLEPLNWLKQADARLNMTQGVLGGV 145
           SQDPTAEY+LNCKIG SP++CN+NLSAVR+ETTKM LEPL+ LK+ADA LN+TQGVL GV
Sbjct: 79  SQDPTAEYLLNCKIGTSPIICNNNLSAVRLETTKMLLEPLHLLKKADAELNITQGVLEGV 138

Query: 146 VGEELGVLPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVS 205
           VGEELGVLPGMDS+F+  ALERLVGF GN  +RN +K+K+D+I+YDGI+ EETLRMIGV+
Sbjct: 139 VGEELGVLPGMDSVFTLLALERLVGFLGNLGRRNLRKDKYDIIIYDGINTEETLRMIGVT 198

Query: 206 SKARLYLKYLRNVAEKTDLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRML 265
           S+ARLYLKYLRN+AE+TD+GRL  PSLL+LVDEA+S+S R   LNG  S+EIWD ++R L
Sbjct: 199 SRARLYLKYLRNMAERTDIGRLAGPSLLRLVDEAMSLSTRGSNLNGKMSSEIWDILERAL 258

Query: 266 ERGSSALAEPHKFGCFLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTASPHLDEESA 325
           ERGSSA  EP +FGC+LV++PNN  SV+SALRYWGC IQAGAQV+GA  TASPH D ES 
Sbjct: 259 ERGSSAFGEPREFGCYLVVDPNNPASVSSALRYWGCAIQAGAQVSGAFGTASPHSDVESE 318

Query: 326 ERVRKNFSPLPLSFLPHLPTDSSLDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDA 385
           E V KNFSPLP +  PH+P  S  DWN I+ +   ++AR+LLS  A  SS++M  VKFD 
Sbjct: 319 EIV-KNFSPLPFALCPHVPMGSLPDWNAIISSNPSEDARNLLSAPASSSSNVMEPVKFDP 377

Query: 386 AKKSVTLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIHLPPQIQGKVGGARFIERNLI 445
           +KKSV+LLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVI LPP+IQGKVGGA+F +R L+
Sbjct: 378 SKKSVSLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIRLPPEIQGKVGGAKFADRKLV 437

Query: 446 VTM 448
           +TM
Sbjct: 438 ITM 440

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225423857\|ref\|XP_002278585.1\| PREDICTED: uncharacterized protein At1g26090, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224108555\|ref\|XP_002314889.1\| predicted protein [Populus trichocarpa] gi\|222863929\|gb\|EEF01060.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|388501194\|gb\|AFK38663.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356499729\|ref\|XP_003518689.1\| PREDICTED: uncharacterized protein At1g26090, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|359483702\|ref\|XP_003633004.1\| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g26090, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357488245\|ref\|XP_003614410.1\| hypothetical protein MTR_5g053280 [Medicago truncatula] gi\|355515745\|gb\|AES97368.1\| hypothetical protein MTR_5g053280 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449493472\|ref\|XP_004159305.1\| PREDICTED: uncharacterized protein At1g26090, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|42562319|ref|NP_173934.2| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|75323193|sp|Q6DYE4.1|Y1609_ARATH RecName: Full=Uncharacterized protein At1g26090, chloroplastic; Flags: Precursor gi|49617729|gb|AAT67560.1| hypothetical protein At1G26090 [Arabidopsis thaliana] gi|67633392|gb|AAY78621.1| hypothetical protein At1g26090 [Arabidopsis thaliana] gi|332192526|gb|AEE30647.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297851072\|ref\|XP_002893417.1\| ATP binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297339259\|gb\|EFH69676.1\| ATP binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		449
TAIR\|locus:2028820		455	AT1G26090 [Arabidopsis thalian	0.908	0.896	0.586	3.7e-126

TAIR\|locus:2028820 AT1G26090 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1239 (441.2 bits), Expect = 3.7e-126, P = 3.7e-126
 Identities = 241/411 (58%), Positives = 302/411 (73%)

Query:    38 SDAGTDENDKSTTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNC 97
             +D   D + K T  +TFLGKGGSGKTT+AVFAAQHYA+AGLSTCLV+H+QDP+AE++L  
Sbjct:    47 NDTAADSSQKLTKFVTFLGKGGSGKTTAAVFAAQHYALAGLSTCLVIHNQDPSAEFLLGS 106

Query:    98 KIGNSPVVCNSNLSAVRIETTKMFLEPLNWLKQADARLNMTQXXXXXXXXXXXXXXPGMD 157
             KIG SP + N NLS +R+ETTKM LEPL  LKQADARLNMTQ              PGMD
Sbjct:   107 KIGTSPTLINDNLSVIRLETTKMLLEPLKQLKQADARLNMTQGVLEGVVGEELGVLPGMD 166

Query:   158 SIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRN 217
             SIFS   LERLVGFF    ++NH+ + FDVI+YDGIS EETLRMIG+SSK RLY KYLR+
Sbjct:   167 SIFSMLELERLVGFFRQATRKNHKGKPFDVIIYDGISTEETLRMIGLSSKTRLYAKYLRS 226

Query:   218 VAEKTDLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHK 277
             +AEKTDLGRLT+PS+++ VDE+++I+  +   +G TS  +WD ++R LE G+SA  +P +
Sbjct:   227 LAEKTDLGRLTSPSIMRFVDESMNINSNKSPFDGMTSPAMWDTLERFLETGASAWRDPER 286

Query:   278 FGCFLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTASPHLDEESAERVRKNXXXXXX 337
             F  FLVM+PNN  SV +ALRYWGCT+QAG+ V+GA   +S HL   +++  + +      
Sbjct:   287 FRSFLVMDPNNPMSVKAALRYWGCTVQAGSHVSGAFAISSSHL---TSQIPKADFVPLPF 343

Query:   338 XXXXXXXTDSSLDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGF 397
                    T + LDW+ I+L+ A    R+LLS      +SL  +V FD AKK VTL MPGF
Sbjct:   344 ASASVPFTITGLDWDKILLDQANSSIRELLSETVSHGTSLTQTVMFDTAKKLVTLFMPGF 403

Query:   398 DKSEIKLYQYRGGSELLVEAGDQRRVIHLPPQIQGKVGGARFIERNLIVTM 448
             +KSEIKLYQYRGGSELL+EAGDQRRVIHLP QIQGKVGGA+F++R+LIVTM
Sbjct:   404 EKSEIKLYQYRGGSELLIEAGDQRRVIHLPSQIQGKVGGAKFVDRSLIVTM 454


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.132   0.381    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      449       403   0.00099  117 3  11 22  0.40    34
                                                     34  0.45    37


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  616 (65 KB)
  Total size of DFA:  237 KB (2130 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  28.85u 0.16s 29.01t   Elapsed:  00:00:01
  Total cpu time:  28.85u 0.16s 29.01t   Elapsed:  00:00:01
  Start:  Thu May  9 19:27:51 2013   End:  Thu May  9 19:27:52 2013

GO:0010287 "plastoglobule" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6DYE4	Y1609_ARATH	No assigned EC number	0.5903	0.9910	0.9780	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00030274001	SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (441 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00038863001	SubName- Full=Chromosome chr8 scaffold_99, whole genome shotgun sequence; (370 aa)	•		0.418
	GSVIVG00019306001	SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (234 aa)		•	0.414
	GSVIVG00017440001	SubName- Full=Chromosome chr6 scaffold_15, whole genome shotgun sequence; (113 aa)		•	0.401

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		449
COG0003		322	COG0003, ArsA, Predicted ATPase involved in chromo	7e-16
pfam02374		304	pfam02374, ArsA_ATPase, Anion-transporting ATPase	3e-10
cd02035		217	cd02035, ArsA, ArsA ATPase functionas as an efflux	7e-08
cd02042		104	cd02042, ParA, ParA and ParB of Caulobacter cresce	9e-06
cd01983		99	cd01983, Fer4_NifH, The Fer4_NifH superfamily cont	4e-04
TIGR00345		284	TIGR00345, GET3_arsA_TRC40, transport-energizing A	0.001

>gnl\|CDD\|223082 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

 Score = 77.8 bits (192), Expect = 7e-16
 Identities = 66/246 (26%), Positives = 106/246 (43%), Gaps = 37/246 (15%)

Query: 48  STTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAE--YILNCKIGNSPVV 105
            T ++ F GKGG GKTT A  AA    +A     ++L S DP      + + ++G+ P  
Sbjct: 1   MTRIVFFTGKGGVGKTTIA--AATAVKLAESGKKVLLVSTDPAHSLGDVFDLELGHDPRK 58

Query: 106 CNSNLSAVRIETTKMFLEPLNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFAL 165
              NL A+ ++  K   E  + +K   ARL  T+G LGG+  +EL  LPG+D   +   L
Sbjct: 59  VGPNLDALELDPEKALEEYWDEVKDYLARLLRTRG-LGGIYADELATLPGIDEALA---L 114

Query: 166 ERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKTDLG 225
            +++ ++           ++DVIV D      TLR++ +      YL+            
Sbjct: 115 LKILEYY--------VSGEYDVIVVDTAPTGHTLRLLSLPEVLGWYLE------------ 154

Query: 226 RLTAPSLLKLVDEALSISG--RRPLLNGNTSAEIWDAMDRMLERG---SSALAEPHKFGC 280
           +L  P   ++V    S+S     PL        + +A++ + ER       L  P     
Sbjct: 155 KLFKPRRKRMVKALKSLSTAAGSPLP----DDAVLEALEELKERIADVREVLTNPDGTSF 210

Query: 281 FLVMNP 286
            LV  P
Sbjct: 211 RLVSIP 216

Length = 322

>gnl\|CDD\|217004 pfam02374, ArsA_ATPase, Anion-transporting ATPase	Back alignment and domain information

>gnl\|CDD\|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell	Back alignment and domain information

>gnl\|CDD\|238997 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation	Back alignment and domain information

>gnl\|CDD\|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>gnl\|CDD\|232932 TIGR00345, GET3_arsA_TRC40, transport-energizing ATPase, TRC40/GET3/ArsA family	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		449
PF02374		305	ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_	100.0
COG0003		322	ArsA Predicted ATPase involved in chromosome parti	100.0
KOG2825		323	consensus Putative arsenite-translocating ATPase [	100.0
TIGR00345		284	arsA arsenite-activated ATPase (arsA). The N-termi	100.0
cd00550		254	ArsA_ATPase Oxyanion-translocating ATPase (ArsA).	100.0
cd02035		217	ArsA ArsA ATPase functionas as an efflux pump loca	99.92
cd02037		169	MRP-like MRP (Multiple Resistance and pH adaptatio	99.79
KOG3022		300	consensus Predicted ATPase, nucleotide-binding [Ce	99.78
PRK11670		369	antiporter inner membrane protein; Provisional	99.75
COG0489		265	Mrp ATPases involved in chromosome partitioning [C	99.73
cd02117		212	NifH_like This family contains the NifH (iron prot	99.71
PRK13232		273	nifH nitrogenase reductase; Reviewed	99.7
PRK13233		275	nifH nitrogenase reductase; Reviewed	99.69
TIGR01969		251	minD_arch cell division ATPase MinD, archaeal. Thi	99.69
PRK13236		296	nitrogenase reductase; Reviewed	99.68
PRK13235		274	nifH nitrogenase reductase; Reviewed	99.67
PRK13230		279	nitrogenase reductase-like protein; Reviewed	99.67
cd02040		270	NifH NifH gene encodes component II (iron protein)	99.67
CHL00175		281	minD septum-site determining protein; Validated	99.67
PRK13185		270	chlL protochlorophyllide reductase iron-sulfur ATP	99.67
PRK13869		405	plasmid-partitioning protein RepA; Provisional	99.66
COG2894		272	MinD Septum formation inhibitor-activating ATPase	99.66
COG0455		262	flhG Antiactivator of flagellar biosynthesis FleN,	99.66
TIGR01281		268	DPOR_bchL light-independent protochlorophyllide re	99.65
TIGR03029		274	EpsG chain length determinant protein tyrosine kin	99.65
CHL00072		290	chlL photochlorophyllide reductase subunit L	99.64
TIGR01287		275	nifH nitrogenase iron protein. This model describe	99.64
cd02032		267	Bchl_like This family of proteins contains bchL an	99.64
TIGR01007		204	eps_fam capsular exopolysaccharide family. This mo	99.63
PRK13234		295	nifH nitrogenase reductase; Reviewed	99.63
TIGR03018		207	pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t	99.61
cd03110		179	Fer4_NifH_child This protein family's function is	99.61
TIGR03371		246	cellulose_yhjQ cellulose synthase operon protein Y	99.61
PRK10818		270	cell division inhibitor MinD; Provisional	99.61
cd02036		179	MinD Bacterial cell division requires the formatio	99.6
TIGR01968		261	minD_bact septum site-determining protein MinD. Th	99.6
TIGR03815		322	CpaE_hom_Actino helicase/secretion neighborhood Cp	99.6
TIGR03453		387	partition_RepA plasmid partitioning protein RepA.	99.59
PRK13705		388	plasmid-partitioning protein SopA; Provisional	99.58
PRK13849		231	putative crown gall tumor protein VirC1; Provision	99.57
PHA02518		211	ParA-like protein; Provisional	99.56
PF01656		195	CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai	99.55
cd02033		329	BchX Chlorophyllide reductase converts chlorophyll	99.55
TIGR02016		296	BchX chlorophyllide reductase iron protein subunit	99.54
PRK11519		719	tyrosine kinase; Provisional	99.54
PRK10037		250	cell division protein; Provisional	99.53
PHA02519		387	plasmid partition protein SopA; Reviewed	99.53
COG1192		259	Soj ATPases involved in chromosome partitioning [C	99.53
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	99.52
PRK13231		264	nitrogenase reductase-like protein; Reviewed	99.49
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	99.49
PF09140		261	MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi	99.42
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	99.41
COG1149		284	MinD superfamily P-loop ATPase containing an inser	99.37
cd03111		106	CpaE_like This protein family consists of proteins	99.36
PF06564		243	YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p	99.35
cd02042		104	ParA ParA and ParB of Caulobacter crescentus belon	99.35
PF07015		231	VirC1: VirC1 protein; InterPro: IPR009744 This fam	99.29
cd06470		90	ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun	99.28
cd02038		139	FleN-like FleN is a member of the Fer4_NifH superf	99.24
PRK10743		137	heat shock protein IbpA; Provisional	99.21
PF00142		273	Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot	99.2
PRK11597		142	heat shock chaperone IbpB; Provisional	99.19
COG0071		146	IbpA Molecular chaperone (small heat shock protein	99.17
TIGR00064		272	ftsY signal recognition particle-docking protein F	99.16
cd06471		93	ACD_LpsHSP_like Group of bacterial proteins contai	99.16
cd06472		92	ACD_ScHsp26_like Alpha crystallin domain (ACD) fou	99.08
COG1348		278	NifH Nitrogenase subunit NifH (ATPase) [Inorganic	99.07
PF13614		157	AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ	99.04
cd02034		116	CooC The accessory protein CooC, which contains a	99.03
cd06475		86	ACD_HspB1_like Alpha crystallin domain (ACD) found	99.03
PRK10867		433	signal recognition particle protein; Provisional	99.03
cd06481		87	ACD_HspB9_like Alpha crystallin domain (ACD) found	99.03
cd06498		84	ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai	99.03
cd06476		83	ACD_HspB2_like Alpha crystallin domain (ACD) found	99.0
cd06479		81	ACD_HspB7_like Alpha crystallin domain (ACD) found	98.98
PRK10416		318	signal recognition particle-docking protein FtsY;	98.98
cd06497		86	ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai	98.97
cd06478		83	ACD_HspB4-5-6 Alpha-crystallin domain found in alp	98.96
TIGR00959		428	ffh signal recognition particle protein. This mode	98.94
cd06482		87	ACD_HspB10 Alpha crystallin domain (ACD) found in	98.92
cd06477		83	ACD_HspB3_Like Alpha crystallin domain (ACD) found	98.9
cd06464		88	ACD_sHsps-like Alpha-crystallin domain (ACD) of al	98.89
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	98.86
cd06526		83	metazoan_ACD Alpha-crystallin domain (ACD) of meta	98.85
cd03115		173	SRP The signal recognition particle (SRP) mediates	98.85
PRK13768		253	GTPase; Provisional	98.81
PRK13886		241	conjugal transfer protein TraL; Provisional	98.81
TIGR00347		166	bioD dethiobiotin synthase. Dethiobiotin synthase	98.8
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	98.79
PRK00771		437	signal recognition particle protein Srp54; Provisi	98.79
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	98.78
PF00011		102	HSP20: Hsp20/alpha crystallin family This prints e	98.76
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	98.75
cd03114		148	ArgK-like The function of this protein family is u	98.74
PRK00090		222	bioD dithiobiotin synthetase; Reviewed	98.64
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	98.58
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	98.54
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	98.53
PRK14974		336	cell division protein FtsY; Provisional	98.48
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	98.48
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	98.47
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	98.47
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	98.4
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	98.33
COG4963		366	CpaE Flp pilus assembly protein, ATPase CpaE [Intr	98.29
cd06480		91	ACD_HspB8_like Alpha-crystallin domain (ACD) found	98.27
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	98.26
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	98.21
PRK12374		231	putative dithiobiotin synthetase; Provisional	98.18
cd03109		134	DTBS Dethiobiotin synthetase (DTBS) is the penulti	98.13
cd00298		80	ACD_sHsps_p23-like This domain family includes the	98.11
KOG0780		483	consensus Signal recognition particle, subunit Srp	97.99
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	97.99
PF10609		81	ParA: ParA/MinD ATPase like; InterPro: IPR019591 T	97.94
COG0132		223	BioD Dethiobiotin synthetase [Coenzyme metabolism]	97.93
PRK01077		451	cobyrinic acid a,c-diamide synthase; Validated	97.92
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	97.85
cd06469		78	p23_DYX1C1_like p23_like domain found in proteins	97.79
PRK09435		332	membrane ATPase/protein kinase; Provisional	97.66
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	97.62
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.59
PF13500		199	AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R	97.57
PLN02974		817	adenosylmethionine-8-amino-7-oxononanoate transami	97.55
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	97.55
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	97.49
TIGR00313		475	cobQ cobyric acid synthase CobQ.	97.43
PRK05632		684	phosphate acetyltransferase; Reviewed	97.4
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	97.34
PF05455		177	GvpH: GvpH; InterPro: IPR008633 This family consis	97.3
PRK14493		274	putative bifunctional molybdopterin-guanine dinucl	97.26
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	97.26
KOG0710		196	consensus Molecular chaperone (small heat-shock pr	97.26
cd01394		218	radB RadB. The archaeal protein radB shares simila	97.23
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	97.18
PRK06067		234	flagellar accessory protein FlaH; Validated	97.17
PHA02542		473	41 41 helicase; Provisional	97.15
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	97.1
KOG1533		290	consensus Predicted GTPase [General function predi	97.08
cd03113		255	CTGs CTP synthetase (CTPs) is a two-domain protein	97.06
PRK00889		175	adenylylsulfate kinase; Provisional	97.02
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	97.0
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	96.99
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	96.97
PRK07952		244	DNA replication protein DnaC; Validated	96.95
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	96.95
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	96.93
KOG0781		587	consensus Signal recognition particle receptor, al	96.93
COG1341		398	Predicted GTPase or GTP-binding protein [General f	96.92
cd00983		325	recA RecA is a bacterial enzyme which has roles in	96.91
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	96.85
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	96.83
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	96.83
PRK03846		198	adenylylsulfate kinase; Provisional	96.81
TIGR01618		220	phage_P_loop phage nucleotide-binding protein. Thi	96.8
cd00477		524	FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca	96.75
PRK05973		237	replicative DNA helicase; Provisional	96.74
PRK13505		557	formate--tetrahydrofolate ligase; Provisional	96.73
PRK06696		223	uridine kinase; Validated	96.72
COG1484		254	DnaC DNA replication protein [DNA replication, rec	96.72
cd06463		84	p23_like Proteins containing this p23_like domain	96.7
PRK07667		193	uridine kinase; Provisional	96.67
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	96.66
PRK05595		444	replicative DNA helicase; Provisional	96.65
PRK06762		166	hypothetical protein; Provisional	96.65
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	96.62
PF13245		76	AAA_19: Part of AAA domain	96.6
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	96.59
PRK08006		471	replicative DNA helicase; Provisional	96.58
PRK08760		476	replicative DNA helicase; Provisional	96.54
TIGR02237		209	recomb_radB DNA repair and recombination protein R	96.54
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	96.47
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	96.43
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	96.43
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	96.43
PRK06526		254	transposase; Provisional	96.43
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	96.42
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	96.4
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	96.38
PRK14494		229	putative molybdopterin-guanine dinucleotide biosyn	96.38
PRK09165		497	replicative DNA helicase; Provisional	96.31
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	96.31
PRK07004		460	replicative DNA helicase; Provisional	96.28
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	96.28
TIGR00665		434	DnaB replicative DNA helicase. This model describe	96.25
PRK08840		464	replicative DNA helicase; Provisional	96.24
KOG3591		173	consensus Alpha crystallins [Posttranslational mod	96.21
KOG1534		273	consensus Putative transcription factor FET5 [Tran	96.2
PRK08506		472	replicative DNA helicase; Provisional	96.2
smart00382		148	AAA ATPases associated with a variety of cellular	96.19
PRK04296		190	thymidine kinase; Provisional	96.19
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	96.15
PHA00729		226	NTP-binding motif containing protein	96.15
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	96.12
PF06418		276	CTP_synth_N: CTP synthase N-terminus; InterPro: IP	96.07
PRK05748		448	replicative DNA helicase; Provisional	96.04
PRK06321		472	replicative DNA helicase; Provisional	96.03
PRK05636		505	replicative DNA helicase; Provisional	96.02
PRK06904		472	replicative DNA helicase; Validated	96.02
PRK12377		248	putative replication protein; Provisional	96.01
TIGR00455		184	apsK adenylylsulfate kinase (apsK). Important resi	96.01
cd03116		159	MobB Molybdenum is an essential trace element in t	96.0
PRK05541		176	adenylylsulfate kinase; Provisional	95.98
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	95.97
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	95.95
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	95.9
PRK09183		259	transposase/IS protein; Provisional	95.83
PRK08533		230	flagellar accessory protein FlaH; Reviewed	95.78
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	95.78
PRK08939		306	primosomal protein DnaI; Reviewed	95.75
PRK13506		578	formate--tetrahydrofolate ligase; Provisional	95.73
COG1763		161	MobB Molybdopterin-guanine dinucleotide biosynthes	95.73
PRK05480		209	uridine/cytidine kinase; Provisional	95.71
KOG0635		207	consensus Adenosine 5'-phosphosulfate kinase [Inor	95.7
PRK09354		349	recA recombinase A; Provisional	95.63
PF05729		166	NACHT: NACHT domain	95.57
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	95.54
COG4240		300	Predicted kinase [General function prediction only	95.53
PRK05439		311	pantothenate kinase; Provisional	95.48
PRK06835		329	DNA replication protein DnaC; Validated	95.46
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	95.45
PF13479		213	AAA_24: AAA domain	95.45
PRK08903		227	DnaA regulatory inactivator Hda; Validated	95.45
TIGR03575		340	selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti	95.43
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	95.42
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	95.42
PRK08233		182	hypothetical protein; Provisional	95.41
PRK14495		452	putative molybdopterin-guanine dinucleotide biosyn	95.41
PRK08727		233	hypothetical protein; Validated	95.4
PRK08181		269	transposase; Validated	95.4
PRK09519		790	recA DNA recombination protein RecA; Reviewed	95.36
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	95.35
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	95.33
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	95.31
cd02029		277	PRK_like Phosphoribulokinase-like (PRK-like) is a	95.3
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	95.3
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	95.27
PRK15453		290	phosphoribulokinase; Provisional	95.27
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	95.24
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	95.22
PF08190		328	PIH1: pre-RNA processing PIH1/Nop17	95.22
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	95.2
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	95.13
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	95.12
PRK07773		886	replicative DNA helicase; Validated	95.09
PRK06893		229	DNA replication initiation factor; Validated	95.09
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	95.08
COG3598		402	RepA RecA-family ATPase [DNA replication, recombin	95.05
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	94.98
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	94.93
PRK00131		175	aroK shikimate kinase; Reviewed	94.92
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	94.91
PRK05642		234	DNA replication initiation factor; Validated	94.89
PRK00784		488	cobyric acid synthase; Provisional	94.83
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	94.79
PRK08084		235	DNA replication initiation factor; Provisional	94.78
KOG1805		1100	consensus DNA replication helicase [Replication, r	94.77
PRK11823		446	DNA repair protein RadA; Provisional	94.75
PRK06921		266	hypothetical protein; Provisional	94.74
PRK08116		268	hypothetical protein; Validated	94.73
PRK06851		367	hypothetical protein; Provisional	94.72
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	94.72
PRK12339		197	2-phosphoglycerate kinase; Provisional	94.6
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	94.59
PRK04328		249	hypothetical protein; Provisional	94.56
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	94.52
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	94.52
PRK06761		282	hypothetical protein; Provisional	94.49
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	94.47
PRK06217		183	hypothetical protein; Validated	94.46
PF01268		557	FTHFS: Formate--tetrahydrofolate ligase; InterPro:	94.34
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	94.33
PF00154		322	RecA: recA bacterial DNA recombination protein; In	94.33
TIGR00235		207	udk uridine kinase. Model contains a number of lon	94.31
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	94.31
PHA02530		300	pseT polynucleotide kinase; Provisional	94.3
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	94.23
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	94.19
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	94.19
PRK08118		167	topology modulation protein; Reviewed	94.17
PRK10536		262	hypothetical protein; Provisional	94.13
PF12846		304	AAA_10: AAA-like domain	94.1
PRK06547		172	hypothetical protein; Provisional	94.07
PRK07414		178	cob(I)yrinic acid a,c-diamide adenosyltransferase;	94.05
PTZ00035		337	Rad51 protein; Provisional	93.99
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	93.99
PRK04301		317	radA DNA repair and recombination protein RadA; Va	93.98
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	93.95
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	93.93
PRK00652		325	lpxK tetraacyldisaccharide 4'-kinase; Reviewed	93.92
PLN02348		395	phosphoribulokinase	93.89
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	93.89
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	93.87
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	93.86
PLN02796		347	D-glycerate 3-kinase	93.79
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	93.78
cd06466		84	p23_CS_SGT1_like p23_like domain similar to the C-	93.77
PRK04040		188	adenylate kinase; Provisional	93.73
PLN02924		220	thymidylate kinase	93.72
PRK12338		319	hypothetical protein; Provisional	93.71
PRK00698		205	tmk thymidylate kinase; Validated	93.64
COG2109		198	BtuR ATP:corrinoid adenosyltransferase [Coenzyme m	93.63
PF02572		172	CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase	93.61
PRK13946		184	shikimate kinase; Provisional	93.6
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	93.6
PRK04220		301	2-phosphoglycerate kinase; Provisional	93.59
PRK13947		171	shikimate kinase; Provisional	93.57
PRK13507		587	formate--tetrahydrofolate ligase; Provisional	93.56
TIGR00376		637	DNA helicase, putative. The gene product may repre	93.53
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	93.44
PRK06749		428	replicative DNA helicase; Provisional	93.43
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	93.39
PF13173		128	AAA_14: AAA domain	93.37
PRK07933		213	thymidylate kinase; Validated	93.32
COG2874		235	FlaH Predicted ATPases involved in biogenesis of a	93.3
PF00004		132	AAA: ATPase family associated with various cellula	93.3
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	93.27
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	93.26
TIGR00379		449	cobB cobyrinic acid a,c-diamide synthase. This mod	93.21
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	93.21
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	93.2
COG2403		449	Predicted GTPase [General function prediction only	93.2
COG1797		451	CobB Cobyrinic acid a,c-diamide synthase [Coenzyme	93.17
PLN03046		460	D-glycerate 3-kinase; Provisional	93.17
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	93.13
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	93.13
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	93.08
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	93.06
PLN02759		637	Formate--tetrahydrofolate ligase	93.05
PTZ00301		210	uridine kinase; Provisional	93.01
PRK09302		509	circadian clock protein KaiC; Reviewed	93.0
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	92.89
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	92.84
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	92.76
COG0305		435	DnaB Replicative DNA helicase [DNA replication, re	92.7
TIGR00337		525	PyrG CTP synthase. CTP synthase is involved in pyr	92.68
PRK14491		597	putative bifunctional molybdopterin-guanine dinucl	92.63
PRK09302		509	circadian clock protein KaiC; Reviewed	92.58
PRK05380		533	pyrG CTP synthetase; Validated	92.57
PRK02496		184	adk adenylate kinase; Provisional	92.51
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	92.5
PRK06851		367	hypothetical protein; Provisional	92.34
PRK13975		196	thymidylate kinase; Provisional	92.34
PRK01184		184	hypothetical protein; Provisional	92.33
CHL00181		287	cbbX CbbX; Provisional	92.33
PRK03731		171	aroL shikimate kinase II; Reviewed	92.3
PRK13948		182	shikimate kinase; Provisional	92.26
cd02022		179	DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2	92.25
PRK14531		183	adenylate kinase; Provisional	92.24
PRK14527		191	adenylate kinase; Provisional	92.24
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	92.23
PRK07261		171	topology modulation protein; Provisional	92.21
PRK03839		180	putative kinase; Provisional	92.13
COG0237		201	CoaE Dephospho-CoA kinase [Coenzyme metabolism]	92.11
PF06414		199	Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e	92.09
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	92.05
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	92.01
PLN02200		234	adenylate kinase family protein	92.0
TIGR02236		310	recomb_radA DNA repair and recombination protein R	91.97
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	91.92
PRK13973		213	thymidylate kinase; Provisional	91.91
PTZ00386		625	formyl tetrahydrofolate synthetase; Provisional	91.89
PRK00081		194	coaE dephospho-CoA kinase; Reviewed	91.88
COG2074		299	2-phosphoglycerate kinase [Carbohydrate transport	91.78
PRK10490		895	sensor protein KdpD; Provisional	91.66
PRK13695		174	putative NTPase; Provisional	91.65
PRK14528		186	adenylate kinase; Provisional	91.54
TIGR00682		311	lpxK tetraacyldisaccharide 4'-kinase. Also called	91.52
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	91.51
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	91.51
PRK00091		307	miaA tRNA delta(2)-isopentenylpyrophosphate transf	91.51
PRK13896		433	cobyrinic acid a,c-diamide synthase; Provisional	91.48
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	91.43
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	91.37
COG2759		554	MIS1 Formyltetrahydrofolate synthetase [Nucleotide	91.35
cd03112		158	CobW_like The function of this protein family is u	91.34
PRK14730		195	coaE dephospho-CoA kinase; Provisional	91.28
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	91.28
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	91.24
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	91.11
PF01935		229	DUF87: Domain of unknown function DUF87; InterPro:	91.1
PLN02327		557	CTP synthase	91.07
PRK01906		338	tetraacyldisaccharide 4'-kinase; Provisional	91.06
COG0125		208	Tmk Thymidylate kinase [Nucleotide transport and m	91.0
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	90.98
PRK12422		445	chromosomal replication initiation protein; Provis	90.96
TIGR02239		316	recomb_RAD51 DNA repair protein RAD51. This eukary	90.87
PLN02748		468	tRNA dimethylallyltransferase	90.81
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	90.77
COG0504		533	PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide	90.77
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	90.68
PRK12337		475	2-phosphoglycerate kinase; Provisional	90.66
COG1855		604	ATPase (PilT family) [General function prediction	90.61
CHL00060		494	atpB ATP synthase CF1 beta subunit	90.6
PRK13764		602	ATPase; Provisional	90.54
COG1072		283	CoaA Panthothenate kinase [Coenzyme metabolism]	90.54
PF13555		62	AAA_29: P-loop containing region of AAA domain	90.51
PF02606		326	LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr	90.46
PRK00625		173	shikimate kinase; Provisional	90.45
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	90.44
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	90.41
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	90.39
PRK14530		215	adenylate kinase; Provisional	90.37
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	90.21
PRK14532		188	adenylate kinase; Provisional	90.03
PTZ00088		229	adenylate kinase 1; Provisional	89.97
PRK08356		195	hypothetical protein; Provisional	89.86
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	89.81
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	89.74
PLN03186		342	DNA repair protein RAD51 homolog; Provisional	89.74
PRK14738		206	gmk guanylate kinase; Provisional	89.72
PLN03210		1153	Resistant to P. syringae 6; Provisional	89.71
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	89.69
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	89.64
PF05707		193	Zot: Zonular occludens toxin (Zot); InterPro: IPR0	89.63
PRK00149		450	dnaA chromosomal replication initiation protein; R	89.59
PRK05057		172	aroK shikimate kinase I; Reviewed	89.56
PLN02422		232	dephospho-CoA kinase	89.55
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	89.52
PRK14734		200	coaE dephospho-CoA kinase; Provisional	89.49
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	89.49
KOG1969		877	consensus DNA replication checkpoint protein CHL12	89.49
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	89.46
PRK04182		180	cytidylate kinase; Provisional	89.44
PLN03025		319	replication factor C subunit; Provisional	89.41
PRK14490		369	putative bifunctional molybdopterin-guanine dinucl	89.35
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	89.32
PRK14737		186	gmk guanylate kinase; Provisional	89.02
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	88.99
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	88.91
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	88.82
PRK00300		205	gmk guanylate kinase; Provisional	88.77
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	88.74
smart00487		201	DEXDc DEAD-like helicases superfamily.	88.7
PRK14088		440	dnaA chromosomal replication initiation protein; P	88.59
PRK12608		380	transcription termination factor Rho; Provisional	88.43
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	88.32
cd01918		149	HprK_C HprK/P, the bifunctional histidine-containi	88.22
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	88.12
PRK00279		215	adk adenylate kinase; Reviewed	88.09
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	88.09
PRK06278		476	cobyrinic acid a,c-diamide synthase; Validated	88.03
cd01133		274	F1-ATPase_beta F1 ATP synthase beta subunit, nucle	87.98
TIGR00017		217	cmk cytidylate kinase. This family consists of cyt	87.91
KOG2878		282	consensus Predicted kinase [General function predi	87.88
TIGR01041		458	ATP_syn_B_arch ATP synthase archaeal, B subunit. A	87.85
PRK04196		460	V-type ATP synthase subunit B; Provisional	87.75
PRK05416		288	glmZ(sRNA)-inactivating NTPase; Provisional	87.71
PF07726		131	AAA_3: ATPase family associated with various cellu	87.66
PRK07413		382	hypothetical protein; Validated	87.65
TIGR00152		188	dephospho-CoA kinase. This model produces scores i	87.62
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	87.57
PRK13949		169	shikimate kinase; Provisional	87.5
PLN02840		421	tRNA dimethylallyltransferase	87.37
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	87.34
TIGR03172		232	probable selenium-dependent hydroxylase accessory	87.32
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	87.2
PRK13976		209	thymidylate kinase; Provisional	87.06
COG2256		436	MGS1 ATPase related to the helicase subunit of the	87.05
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	87.05
PRK12402		337	replication factor C small subunit 2; Reviewed	87.02
TIGR03783		829	Bac_Flav_CT_G Bacteroides conjugation system ATPas	87.02
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	87.0
PHA02544		316	44 clamp loader, small subunit; Provisional	86.88
PLN02165		334	adenylate isopentenyltransferase	86.86
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	86.58
PF01745		233	IPT: Isopentenyl transferase; InterPro: IPR002648	86.55
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	86.35
PF13476		202	AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V	86.31
smart00072		184	GuKc Guanylate kinase homologues. Active enzymes c	86.24
PRK04195		482	replication factor C large subunit; Provisional	86.22
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	86.0
PRK07413		382	hypothetical protein; Validated	85.99
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	85.84
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	85.81
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	85.56
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	85.54
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	85.49
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	85.47
PRK00411		394	cdc6 cell division control protein 6; Reviewed	85.45
PRK14733		204	coaE dephospho-CoA kinase; Provisional	85.28
PRK10865		857	protein disaggregation chaperone; Provisional	85.22
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	85.22
PF01580		205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	85.2
PF02492		178	cobW: CobW/HypB/UreG, nucleotide-binding domain; I	85.04
PRK14526		211	adenylate kinase; Provisional	85.03
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	85.02
PRK13342		413	recombination factor protein RarA; Reviewed	85.02
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	84.99
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	84.8
PF00625		183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	84.73
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	84.7
PRK14529		223	adenylate kinase; Provisional	84.64
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	84.63
cd02026		273	PRK Phosphoribulokinase (PRK) is an enzyme involve	84.61
PRK14086		617	dnaA chromosomal replication initiation protein; P	84.55
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	84.52
PRK14731		208	coaE dephospho-CoA kinase; Provisional	84.52
COG1663		336	LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env	84.51
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	84.44

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B	Back alignment and domain information

Probab=100.00  E-value=1.3e-56  Score=447.56  Aligned_cols=283  Identities=28%  Similarity=0.385  Sum_probs=228.2

Q ss_pred             cEEEEEeCCCCCcHHHHHHHHHHHHHHcCCceEEEecCCCc--chhhhhhhccCCCCeeec--CCcceeecCchhhhhhh
Q 013114           49 TTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDP--TAEYILNCKIGNSPVVCN--SNLSAVRIETTKMFLEP  124 (449)
Q Consensus        49 ~rii~~~GKGGVGKTTvAaalA~~lA~~G~rvLLv~~d~Dp--sl~d~~g~~~~~~p~~i~--~~L~~~eid~~~~~~~~  124 (449)
                      ||+++|+|||||||||+|+|+|+++|++|+||||+  |+||  +++|+||.+++++|++|.  +||+++|+|+...++++
T Consensus         1 ~r~~~~~GKGGVGKTT~aaA~A~~~A~~G~rtLlv--S~Dpa~~L~d~l~~~~~~~~~~v~~~~~L~a~eid~~~~~~~~   78 (305)
T PF02374_consen    1 MRILFFGGKGGVGKTTVAAALALALARRGKRTLLV--STDPAHSLSDVLGQKLGGEPTKVEGVPNLSAMEIDPEAELEEY   78 (305)
T ss_dssp             -SEEEEEESTTSSHHHHHHHHHHHHHHTTS-EEEE--ESSTTTHHHHHHTS--BSS-EEETTCSSEEEEE--HHHHHHHH
T ss_pred             CeEEEEecCCCCCcHHHHHHHHHHHhhCCCCeeEe--ecCCCccHHHHhCCcCCCCCeEecCCCCceeeecCHHHHHHHH
Confidence            69999999999999999999999999999999999  7777  499999999999999999  99999999999999999


Q ss_pred             HHHHHHHHHhhhhcccccCCccccccCCCCChHHHHHHHHHHHHHHHhcccccccCcCCCccEEEEcCCCchHHHHHhhh
Q 013114          125 LNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGV  204 (449)
Q Consensus       125 ~~~~~~~~~~~~~~~~~~~~i~~~el~~~Pg~~e~~~l~~l~~l~~~l~~~~~~~~~~~~yD~IVvD~pPtg~tlrlL~l  204 (449)
                      |.++.+.....+.. ...+.++..++..+||++|++++.++.++++           +++||+|||||||||||||||++
T Consensus        79 ~~~~~~~~~~~~~~-~~~~~~~~~~~~~~PG~~E~~~l~~l~~~~~-----------~~~~D~IVvDt~ptg~tLrlL~l  146 (305)
T PF02374_consen   79 WEEVQKDLSSLLPL-IGLERILDEELSSLPGLDELAALLRLADLLE-----------SGEYDLIVVDTPPTGHTLRLLSL  146 (305)
T ss_dssp             HHHHHHGCSTCHHC-HHHHHHHHHHTTSSTTHHHHHHHHHHHHHHH-----------HCSTSEEEEESSSSHHHHHHHHH
T ss_pred             HHHHHhhhccchhh-hhhHHHHHHHHhcCCcHHHHHHHHHHHHHHH-----------hCCCCEEEECCCCcHHHHHHHhH
Confidence            99998876544421 1224566677888899999999988887765           47899999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhhhccccccchhhHHHHHHhhhccCCCCCCCCCChHHHHHHHH---HHHHHHHHhhcCCCceEEE
Q 013114          205 SSKARLYLKYLRNVAEKTDLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMD---RMLERGSSALAEPHKFGCF  281 (449)
Q Consensus       205 P~~l~~~l~~l~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~l~---~~~~~~~~~L~dp~~t~v~  281 (449)
                      |+.+.||+++++++++++  .++.+++..      +.. +      +.+.+++++.+.   +.+++++++|+||+.|+|+
T Consensus       147 P~~l~~~l~~l~~~~~~~--~~~~~~~~~------~~~-~------~~~~~~~~~~l~~~~~~~~~~~~~L~dp~~T~~~  211 (305)
T PF02374_consen  147 PERLRWWLDRLLKLRRKI--RSLARPLSG------LGL-G------AVPLDEILEELEEMRERLERLRELLRDPERTSFR  211 (305)
T ss_dssp             HHHHHHHHHHHHHHHHCH--HHHHHHHCH------SHC-C------HHHHHHHHHHHHHHHHHHHHHHHHHTSTTTEEEE
T ss_pred             HHHHHHHHHHHHHHHHhh--cchhhhhhc------ccc-c------ccchHHHHHHHHHHHHHHHHHHHHhcCCCCcEEE
Confidence            999999999999999865  333333211      000 0      011234555554   4578899999999999999


Q ss_pred             EEecCCCcchHHHHHHHHHHHHHcCCcccEEEEec--------Cccc------cHHHHHHHHHhcCCCCeeeccCCCCCC
Q 013114          282 LVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTA--------SPHL------DEESAERVRKNFSPLPLSFLPHLPTDS  347 (449)
Q Consensus       282 LVt~PE~~~~i~Ea~r~~~~L~~~Gi~V~~vvvN~--------~~~~------q~~~l~~i~~~F~~lpi~~vP~~~~e~  347 (449)
                      +|+||| ++++.||+|++++|+++|++|++||||+        ++++      |+.|++++++.|+++||+++|+++.||
T Consensus       212 lV~~pE-~l~i~Et~r~~~~L~~~gi~v~~vVvNrvlp~~~~~c~~~~~r~~~Q~~~l~~i~~~f~~~~v~~vp~~~~ev  290 (305)
T PF02374_consen  212 LVTNPE-PLAIAETERLLTELKLYGIPVDAVVVNRVLPEEEDDCPFCAARRKEQQKYLAEIEESFPDLPVVKVPLLPEEV  290 (305)
T ss_dssp             EEEESS-HHHHHHHHHHHHHHHHTT-EEEEEEEEEE-TTCSTTSHHHHHHHHHHHHHHHHHHHHTTTSEEEEEE--SS-S
T ss_pred             EEecCC-cchHHHHHHHHHHHHhcCCccCeEEEEccccccccchHHHHHHHHHHHHHHHHHHHHhcCCCEEEecCCCCCC
Confidence            999999 7999999999999999999999999993        1232      556999999999999999999999999


Q ss_pred             ccchhhhhccccHHHHHHHh
Q 013114          348 SLDWNTIMLNPAGKEARDLL  367 (449)
Q Consensus       348 ~~~~~~~g~~~L~~la~~lf  367 (449)
                            +|++.|+.+++.+|
T Consensus       291 ------~G~~~L~~~~~~L~  304 (305)
T PF02374_consen  291 ------RGLDALEALADHLY  304 (305)
T ss_dssp             -------SHHHHHHHHHHHH
T ss_pred             ------CCHHHHHHHHHHhc
Confidence                  99999999999887

...

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00345 arsA arsenite-activated ATPase (arsA)	Back alignment and domain information

>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA)	Back alignment and domain information

>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell	Back alignment and domain information

>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily	Back alignment and domain information

>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK11670 antiporter inner membrane protein; Provisional	Back alignment and domain information

>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase	Back alignment and domain information

>PRK13232 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>PRK13233 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR01969 minD_arch cell division ATPase MinD, archaeal	Back alignment and domain information

>PRK13236 nitrogenase reductase; Reviewed	Back alignment and domain information

>PRK13235 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>PRK13230 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase	Back alignment and domain information

>CHL00175 minD septum-site determining protein; Validated	Back alignment and domain information

>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional	Back alignment and domain information

>PRK13869 plasmid-partitioning protein RepA; Provisional	Back alignment and domain information

>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]	Back alignment and domain information

>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility]	Back alignment and domain information

>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein	Back alignment and domain information

>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG	Back alignment and domain information

>CHL00072 chlL photochlorophyllide reductase subunit L	Back alignment and domain information

>TIGR01287 nifH nitrogenase iron protein	Back alignment and domain information

>cd02032 Bchl_like This family of proteins contains bchL and chlL	Back alignment and domain information

>TIGR01007 eps_fam capsular exopolysaccharide family	Back alignment and domain information

>PRK13234 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase	Back alignment and domain information

>cd03110 Fer4_NifH_child This protein family's function is unkown	Back alignment and domain information

>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ	Back alignment and domain information

>PRK10818 cell division inhibitor MinD; Provisional	Back alignment and domain information

>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell	Back alignment and domain information

>TIGR01968 minD_bact septum site-determining protein MinD	Back alignment and domain information

>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein	Back alignment and domain information

>TIGR03453 partition_RepA plasmid partitioning protein RepA	Back alignment and domain information

>PRK13705 plasmid-partitioning protein SopA; Provisional	Back alignment and domain information

>PRK13849 putative crown gall tumor protein VirC1; Provisional	Back alignment and domain information

>PHA02518 ParA-like protein; Provisional	Back alignment and domain information

>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases	Back alignment and domain information

>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring	Back alignment and domain information

>TIGR02016 BchX chlorophyllide reductase iron protein subunit X	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>PRK10037 cell division protein; Provisional	Back alignment and domain information

>PHA02519 plasmid partition protein SopA; Reviewed	Back alignment and domain information

>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>PRK13231 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster	Back alignment and domain information

>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon	Back alignment and domain information

>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation	Back alignment and domain information

>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins	Back alignment and domain information

>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins	Back alignment and domain information

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily	Back alignment and domain information

>PRK10743 heat shock protein IbpA; Provisional	Back alignment and domain information

>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family	Back alignment and domain information

>PRK11597 heat shock chaperone IbpB; Provisional	Back alignment and domain information

>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18	Back alignment and domain information

>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins	Back alignment and domain information

>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins	Back alignment and domain information

>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa)	Back alignment and domain information

>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins	Back alignment and domain information

>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa)	Back alignment and domain information

>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins	Back alignment and domain information

>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins	Back alignment and domain information

>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps)	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps)	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>PRK13886 conjugal transfer protein TraL; Provisional	Back alignment and domain information

>TIGR00347 bioD dethiobiotin synthase	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>PRK00090 bioD dithiobiotin synthetase; Reviewed	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion]	Back alignment and domain information

>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK12374 putative dithiobiotin synthetase; Provisional	Back alignment and domain information

>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms	Back alignment and domain information

>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning []	Back alignment and domain information

>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism]	Back alignment and domain information

>PRK01077 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A	Back alignment and domain information

>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR00313 cobQ cobyric acid synthase CobQ	Back alignment and domain information

>PRK05632 phosphate acetyltransferase; Reviewed	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis []	Back alignment and domain information

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PHA02542 41 41 helicase; Provisional	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>KOG1533 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>TIGR01618 phage_P_loop phage nucleotide-binding protein	Back alignment and domain information

>cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK13505 formate--tetrahydrofolate ligase; Provisional	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>PRK05595 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>PRK08006 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional	Back alignment and domain information

>PRK09165 replicative DNA helicase; Provisional	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>PRK08840 replicative DNA helicase; Provisional	Back alignment and domain information

>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1534 consensus Putative transcription factor FET5 [Transcription]	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PF06418 CTP_synth_N: CTP synthase N-terminus; InterPro: IPR017456 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism, catalysing the synthesis of CTP from UTP by amination of the pyrimidine ring at the 4-position []	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK06321 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK05636 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>TIGR00455 apsK adenylylsulfate kinase (apsK)	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK13506 formate--tetrahydrofolate ligase; Provisional	Back alignment and domain information

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>COG4240 Predicted kinase [General function prediction only]	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PF13479 AAA_24: AAA domain	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PF08190 PIH1: pre-RNA processing PIH1/Nop17	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>PRK07773 replicative DNA helicase; Validated	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK00784 cobyric acid synthase; Provisional	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PRK06761 hypothetical protein; Provisional	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>PF01268 FTHFS: Formate--tetrahydrofolate ligase; InterPro: IPR000559 Formate--tetrahydrofolate ligase (6	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response []	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed	Back alignment and domain information

>PLN02348 phosphoribulokinase	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1)	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>PLN02924 thymidylate kinase	Back alignment and domain information

>PRK12338 hypothetical protein; Provisional	Back alignment and domain information

>PRK00698 tmk thymidylate kinase; Validated	Back alignment and domain information

>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism]	Back alignment and domain information

>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>PRK13507 formate--tetrahydrofolate ligase; Provisional	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PRK06749 replicative DNA helicase; Provisional	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK07933 thymidylate kinase; Validated	Back alignment and domain information

>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>TIGR00379 cobB cobyrinic acid a,c-diamide synthase	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>COG2403 Predicted GTPase [General function prediction only]	Back alignment and domain information

>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]	Back alignment and domain information

>PLN03046 D-glycerate 3-kinase; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PLN02759 Formate--tetrahydrofolate ligase	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00337 PyrG CTP synthase	Back alignment and domain information

>PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>PRK05380 pyrG CTP synthetase; Validated	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>PRK13975 thymidylate kinase; Provisional	Back alignment and domain information

>PRK01184 hypothetical protein; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK03731 aroL shikimate kinase II; Reviewed	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism]	Back alignment and domain information

>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13973 thymidylate kinase; Provisional	Back alignment and domain information

>PTZ00386 formyl tetrahydrofolate synthetase; Provisional	Back alignment and domain information

>PRK00081 coaE dephospho-CoA kinase; Reviewed	Back alignment and domain information

>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10490 sensor protein KdpD; Provisional	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>TIGR00682 lpxK tetraacyldisaccharide 4'-kinase	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed	Back alignment and domain information

>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>COG2759 MIS1 Formyltetrahydrofolate synthetase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>PRK14730 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown	Back alignment and domain information

>PLN02327 CTP synthase	Back alignment and domain information

>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional	Back alignment and domain information

>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR02239 recomb_RAD51 DNA repair protein RAD51	Back alignment and domain information

>PLN02748 tRNA dimethylallyltransferase	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK12337 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>COG1855 ATPase (PilT family) [General function prediction only]	Back alignment and domain information

>CHL00060 atpB ATP synthase CF1 beta subunit	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism]	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability []	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>PRK08356 hypothetical protein; Provisional	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PLN03186 DNA repair protein RAD51 homolog; Provisional	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot)	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>PLN02422 dephospho-CoA kinase	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>PRK14734 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PRK04182 cytidylate kinase; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06278 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain	Back alignment and domain information

>TIGR00017 cmk cytidylate kinase	Back alignment and domain information

>KOG2878 consensus Predicted kinase [General function prediction only]	Back alignment and domain information

>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit	Back alignment and domain information

>PRK04196 V-type ATP synthase subunit B; Provisional	Back alignment and domain information

>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PRK07413 hypothetical protein; Validated	Back alignment and domain information

>TIGR00152 dephospho-CoA kinase	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>PLN02840 tRNA dimethylallyltransferase	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK13976 thymidylate kinase; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid []	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A	Back alignment and domain information

>smart00072 GuKc Guanylate kinase homologues	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07413 hypothetical protein; Validated	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK14733 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies	Back alignment and domain information

>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt	Back alignment and domain information

>PRK14526 adenylate kinase; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PRK14529 adenylate kinase; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14731 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		449
3igf_A		374	Crystal Structure Of The All4481 Protein From Nosto		3e-26

>pdb|3IGF|A Chain A, Crystal Structure Of The All4481 Protein From Nostoc Sp. Pcc 7120, Northeast Structural Genomics Consortium Target Nsr300 Length = 374

Back alignment and structure

Iteration: 1

Score = 116 bits (291), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 112/404 (27%), Positives = 177/404 (43%), Gaps = 47/404 (11%) Query: 51 LITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNSNL 110 ++TFLGK G +T A+ AA+ A G L+ +P +L + P NL Sbjct: 4 ILTFLGKSGVARTKIAIAAAKLLASQG-KRVLLAGLAEPVLPLLLEQTLTPDPQQIAPNL 62 Query: 111 SAVRIETTKMFLEPLNW--LKQADARLNMTQXXXXXXXXXXXXXXPGMDSIFSAFALERL 168 V+ +++ + LE NW +K+ +A+ T PG DS A AL Sbjct: 63 EVVQFQSS-VLLE-RNWEEVKKLEAQYLRT-PIIKEVYGQELVVLPGXDS---ALAL--- 113 Query: 169 VGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKTDLGRLT 228 N + K+D IVYDG TLR +G+ Y++ R + +DLG+ Sbjct: 114 -----NAIREYDASGKYDTIVYDGTGDAFTLRXLGLPESLSWYVRRFRQLFVNSDLGKTI 168 Query: 229 A--PSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHKFGCFLVMNP 286 A P + L+ +++ + A+ + ++ L++G ALA+P + FLV Sbjct: 169 AESPLIQPLISSFFNVN-----WTADNFAQPTNQVNNFLDKGKEALADPKRVAAFLVTTA 223 Query: 287 NNRTSVNSALRY-WGCTIQAGAQVAGAICTASPHLDEESAERVRKNXXXXXXXXXXXXXT 345 + V ++RY WG Q G + G I +S + SAE + Sbjct: 224 DPLEVV--SVRYLWGSAQQIGLTIGGVIQVSSQTEGDLSAEFTPLSVTVVPDVTKG---- 277 Query: 346 DSSLDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGFDKSEIKLY 405 DW ++ D L +++ + D + V L +PGFDK ++KL Sbjct: 278 ----DWQPLI---------DALPNFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLT 324 Query: 406 QYRGGSELLVEAGDQRRVIHLPPQIQGK-VGGARFIERNLIVTM 448 QY G E+ VEAGDQRR I LPP + G+ + GA+F LI++ Sbjct: 325 QY--GPEVTVEAGDQRRNIFLPPALSGRPITGAKFQNNYLIISF 366

PyMOL of 3igf

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		449
3igf_A		374	ALL4481 protein; two-domained protein consisting o	2e-77
3ug7_A		349	Arsenical pump-driving ATPase; tail-anchored, memb	2e-43
3zq6_A		324	Putative arsenical pump-driving ATPase; tail-ancho	1e-32
3io3_A		348	DEHA2D07832P; chaperone, membrane traffic, ATPase;	1e-28
2woo_A		329	ATPase GET3; tail-anchored, membrane protein, targ	9e-28
2woj_A		354	ATPase GET3; tail-anchored, membrane protein, targ	2e-25
3iqw_A		334	Tail-anchored protein targeting factor GET3; ATPas	8e-25
1ihu_A		589	Arsenical pump-driving ATPase; aluminum fluoride,	2e-19
1ihu_A		589	Arsenical pump-driving ATPase; aluminum fluoride,	1e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-05
4dzz_A		206	Plasmid partitioning protein PARF; deviant walker	9e-04

>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Length = 374	Back alignment and structure

 Score =  244 bits (625), Expect = 2e-77
 Identities = 115/400 (28%), Positives = 182/400 (45%), Gaps = 37/400 (9%)

Query: 49  TTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDPTAEYILNCKIGNSPVVCNS 108
             ++TFLGK G  +T  A+ AA+  A  G    L+    +P    +L   +   P     
Sbjct: 2   ALILTFLGKSGVARTKIAIAAAKLLASQGKRV-LLAGLAEPVLPLLLEQTLTPDPQQIAP 60

Query: 109 NLSAVRIETTKMFLEPLNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERL 168
           NL  V+ +++ +       +K+ +A+   T   +  V G+EL VLPGMDS  +  A+   
Sbjct: 61  NLEVVQFQSSVLLERNWEEVKKLEAQYLRTPI-IKEVYGQELVVLPGMDSALALNAIREY 119

Query: 169 VGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKTDLGRLT 228
                          K+D IVYDG     TLRM+G+      Y++  R +   +DLG+  
Sbjct: 120 D-----------ASGKYDTIVYDGTGDAFTLRMLGLPESLSWYVRRFRQLFVNSDLGKTI 168

Query: 229 APSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHKFGCFLVMNPNN 288
           A S L    + L  S        +  A+  + ++  L++G  ALA+P +   FLV    +
Sbjct: 169 AESPLI---QPLISSFFNVNWTADNFAQPTNQVNNFLDKGKEALADPKRVAAFLVTTA-D 224

Query: 289 RTSVNSALRYWGCTIQAGAQVAGAICTASPHLDEESAERVRKNFSPLPLSFLPHLPTDSS 348
              V S    WG   Q G  + G I  +S    +     +   F+PL ++ +P +     
Sbjct: 225 PLEVVSVRYLWGSAQQIGLTIGGVIQVSSQTEGD-----LSAEFTPLSVTVVPDVTKG-- 277

Query: 349 LDWNTIMLNPAGKEARDLLSLQAKRSSSLMSSVKFDAAKKSVTLLMPGFDKSEIKLYQYR 408
            DW  ++         D L    +++      +  D   + V L +PGFDK ++KL QY 
Sbjct: 278 -DWQPLI---------DALPNFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLTQY- 326

Query: 409 GGSELLVEAGDQRRVIHLPPQIQGK-VGGARFIERNLIVT 447
            G E+ VEAGDQRR I LPP + G+ + GA+F    LI++
Sbjct: 327 -GPEVTVEAGDQRRNIFLPPALSGRPITGAKFQNNYLIIS 365

PyMOL of 3igf

>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Length = 349	Back alignment and structure

>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 324	Back alignment and structure

>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Length = 348	Back alignment and structure

>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Length = 329	Back alignment and structure

>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Length = 354	Back alignment and structure

>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Length = 334	Back alignment and structure

>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589	Back alignment and structure

>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		449
3igf_A		374	ALL4481 protein; two-domained protein consisting o	100.0
3iqw_A		334	Tail-anchored protein targeting factor GET3; ATPas	100.0
3zq6_A		324	Putative arsenical pump-driving ATPase; tail-ancho	100.0
3ug7_A		349	Arsenical pump-driving ATPase; tail-anchored, memb	100.0
3io3_A		348	DEHA2D07832P; chaperone, membrane traffic, ATPase;	100.0
2woo_A		329	ATPase GET3; tail-anchored, membrane protein, targ	100.0
2woj_A		354	ATPase GET3; tail-anchored, membrane protein, targ	100.0
1ihu_A		589	Arsenical pump-driving ATPase; aluminum fluoride,	100.0
1ihu_A		589	Arsenical pump-driving ATPase; aluminum fluoride,	99.96
3la6_A		286	Tyrosine-protein kinase WZC; P-loop protein, nucle	99.73
3fwy_A		314	Light-independent protochlorophyllide reductase I	99.72
3kjh_A		254	CO dehydrogenase/acetyl-COA synthase complex, acce	99.71
2ph1_A		262	Nucleotide-binding protein; alpha-beta protein, st	99.71
1g3q_A		237	MIND ATPase, cell division inhibitor; alpha-beta-a	99.7
3ea0_A		245	ATPase, para family; alpha-beta-alpha sandwich, st	99.7
3end_A		307	Light-independent protochlorophyllide reductase ir	99.69
3bfv_A		271	CAPA1, CAPB2, membrane protein CAPA1, protein tyro	99.69
1wcv_1		257	SOJ, segregation protein; ATPase, bacterial, chrom	99.67
1hyq_A		263	MIND, cell division inhibitor (MIND-1); MINC, FTSZ	99.67
4dzz_A		206	Plasmid partitioning protein PARF; deviant walker	99.66
3cio_A		299	ETK, tyrosine-protein kinase ETK; WZC, escherichia	99.65
1cp2_A		269	CP2, nitrogenase iron protein; oxidoreductase; 1.9	99.64
2afh_E		289	Nitrogenase iron protein 1; nitrogen fixation, iro	99.64
3k9g_A		267	PF-32 protein; ssgcid, SBRI, decode biostructures,	99.63
3pg5_A		361	Uncharacterized protein; structural genomics, PSI-	99.62
2oze_A		298	ORF delta'; para, walker type atpases, DNA segrega	99.61
3ez2_A		398	Plasmid partition protein A; type IA, DNA binding,	99.61
3q9l_A		260	Septum site-determining protein MIND; ATPase, bact	99.61
3ez9_A		403	Para; DNA binding, winged-HTH, partition, biosynth	99.58
3cwq_A		209	Para family chromosome partitioning protein; alpha	99.54
3fkq_A		373	NTRC-like two-domain protein; RER070207001320, str	99.49
1byi_A		224	Dethiobiotin synthase; biotin synthesis, cyclo-lig	99.48
2xj4_A		286	MIPZ; replication, cell division, ATPase, WACA; 1.	99.48
4fei_A		102	Heat shock protein-related protein; stress respons	99.34
3gla_A		100	Low molecular weight heat shock protein; HSPA, SHP	99.31
3aab_A		123	Putative uncharacterized protein ST1653; alpha-cry	99.25
1gme_A		151	Heat shock protein 16.9B; small heat shock protein	99.13
2xxa_A		433	Signal recognition particle protein; protein trans	99.13
4eld_A		161	MJ16.5-P1, small heat shock protein HSP16.5; chape	99.11
3q9p_A		85	Heat shock protein beta-1; alpha-crystallin domain	99.07
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	99.03
2y1y_A		90	Alpha-crystallin B chain,; small heat shock protei	99.02
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	99.02
3l1e_A		106	Alpha-crystallin A chain; lens transparency, polyd	98.95
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	98.93
2wj5_A		101	Heat shock protein beta-6; chaperone, disulfide bo	98.9
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	98.85
2ffh_A		425	Protein (FFH); SRP54, signal recognition particle,	98.82
3fgn_A		251	Dethiobiotin synthetase; biotin biosynthesis, BIOD	98.76
3of5_A		228	Dethiobiotin synthetase; structural genomics, cent	98.75
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	98.73
2bol_A		314	TSP36, small heat shock protein; A-crystallin, mol	98.68
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	98.63
2klr_A		175	Alpha-crystallin B chain; protein, dimer, oligomer	98.63
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	98.61
2j37_W		504	Signal recognition particle 54 kDa protein (SRP54)	98.59
2bol_A		314	TSP36, small heat shock protein; A-crystallin, mol	98.59
2r8r_A		228	Sensor protein; KDPD, PFAM02702, MCSG, structural	98.46
3qxc_A		242	Dethiobiotin synthetase; DTBS, structural genomics	98.45
1yrb_A		262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	98.39
3p32_A		355	Probable GTPase RV1496/MT1543; structural genomics	98.34
2v3c_C		432	SRP54, signal recognition 54 kDa protein; nucleoti	97.81
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	97.73
2yhs_A		503	FTSY, cell division protein FTSY; cell cycle, prot	97.68
1u94_A		356	RECA protein, recombinase A; homologous recombinat	97.49
1xp8_A		366	RECA protein, recombinase A; recombination, radior	97.29
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	97.16
3pzx_A		557	Formate--tetrahydrofolate ligase; HET: TOE; 2.20A	97.12
4a0g_A		831	Adenosylmethionine-8-amino-7-oxononanoate aminotra	97.07
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	96.91
3bgw_A		444	DNAB-like replicative helicase; ATPase, replicatio	96.73
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	96.72
2p67_A		341	LAO/AO transport system kinase; ARGK, structural G	96.71
3a4m_A		260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	96.71
2yvu_A		186	Probable adenylyl-sulfate kinase; transferase, str	96.69
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	96.67
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	96.67
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	96.45
2r6a_A		454	DNAB helicase, replicative helicase; replication,	96.36
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	96.32
1np6_A		174	Molybdopterin-guanine dinucleotide biosynthesis pr	96.31
2obn_A		349	Hypothetical protein; structural genomics, joint c	96.31
1vco_A		550	CTP synthetase; tetramer, riken structural genomic	96.21
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	96.14
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	96.09
2wsm_A		221	Hydrogenase expression/formation protein (HYPB); m	96.06
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	96.04
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	95.86
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	95.8
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	95.75
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	95.75
2cvh_A		220	DNA repair and recombination protein RADB; filamen	95.74
2xcm_C		92	SGT1-like protein, cytosolic heat shock protein 90	95.71
1kht_A		192	Adenylate kinase; phosphotransferase, signaling pr	95.66
2og2_A		359	Putative signal recognition particle receptor; nuc	95.62
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	95.55
1xx6_A		191	Thymidine kinase; NESG, northeast structural genom	95.5
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	95.49
1rl1_A		114	Suppressor of G2 allele of SKP1 homolog; beta sand	95.45
3bos_A		242	Putative DNA replication factor; P-loop containing	95.44
2pez_A		179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	95.41
1m7g_A		211	Adenylylsulfate kinase; APS kinase, transferase, s	95.34
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	95.26
2qgz_A		308	Helicase loader, putative primosome component; str	95.25
1s1m_A		545	CTP synthase; CTP synthetase, UTP:ammonia ligase (	95.2
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	95.19
2z0h_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	95.19
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	95.17
1nn5_A		215	Similar to deoxythymidylate kinase (thymidylate K;	95.15
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	95.13
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	95.03
2r2a_A		199	Uncharacterized protein; zonular occludens toxin,	95.02
1qf9_A		194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	94.99
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	94.96
2gks_A		546	Bifunctional SAT/APS kinase; transferase, sulfuryl	94.93
2axn_A		520	6-phosphofructo-2-kinase/fructose-2,6- biphosphata	94.92
2pbr_A		195	DTMP kinase, thymidylate kinase; transferase, nucl	94.92
1a7j_A		290	Phosphoribulokinase; transferase, calvin cycle; 2.	94.91
1ly1_A		181	Polynucleotide kinase; PNK, phosphatase, transfera	94.91
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	94.85
2wwf_A		212	Thymidilate kinase, putative; transferase, malaria	94.85
2zts_A		251	Putative uncharacterized protein PH0186; KAIC like	94.85
2hf9_A		226	Probable hydrogenase nickel incorporation protein	94.84
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	94.84
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	94.82
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	94.75
1via_A		175	Shikimate kinase; structural genomics, transferase	94.66
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	94.62
2plr_A		213	DTMP kinase, probable thymidylate kinase; TMP-bind	94.52
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	94.5
3t61_A		202	Gluconokinase; PSI-biology, structural genomics, p	94.45
1x6v_B		630	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	94.41
2k8q_A		134	Protein SHQ1; beta-sandwich, CS domain, nucleus, s	94.37
1q57_A		503	DNA primase/helicase; dntpase, DNA replication, tr	94.34
3io5_A		333	Recombination and repair protein; storage dimer, i	94.33
1ukz_A		203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	94.32
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	94.31
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	94.3
3do6_A		543	Formate--tetrahydrofolate ligase; TM1766, putative	94.29
2z43_A		324	DNA repair and recombination protein RADA; archaea	94.24
2j9r_A		214	Thymidine kinase; TK1, DNK, lasso, transferase, AT	94.17
2iyv_A		184	Shikimate kinase, SK; transferase, aromatic amino	94.15
2ze6_A		253	Isopentenyl transferase; crown GALL tumor, cytokin	94.15
1v5w_A		343	DMC1, meiotic recombination protein DMC1/LIM15 hom	94.12
3cmw_A		1706	Protein RECA, recombinase A; homologous recombinat	94.12
1m8p_A		573	Sulfate adenylyltransferase; rossmann fold, phosph	94.08
2f1r_A		171	Molybdopterin-guanine dinucleotide biosynthesis pr	94.04
1gtv_A		214	TMK, thymidylate kinase; transferase, transferase	94.03
3umf_A		217	Adenylate kinase; rossmann fold, transferase; 2.05	93.99
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	93.99
1gvn_B		287	Zeta; postsegregational killing system, plasmid; 1	93.97
4edh_A		213	DTMP kinase, thymidylate kinase; structural genomi	93.94
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	93.89
1tev_A		196	UMP-CMP kinase; ploop, NMP binding region, LID reg	93.76
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	93.7
3ld9_A		223	DTMP kinase, thymidylate kinase; ssgcid, NIH, niai	93.66
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	93.63
2c95_A		196	Adenylate kinase 1; transferase, AP4A, nucleotide	93.52
3d3q_A		340	TRNA delta(2)-isopentenylpyrophosphate transferase	93.52
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	93.49
2f6r_A		281	COA synthase, bifunctional coenzyme A synthase; 18	93.47
2cdn_A		201	Adenylate kinase; phosphoryl transfer, associative	93.46
3nva_A		535	CTP synthase; rossman fold, nucleotide binding, LI	93.45
2p5t_B		253	PEZT; postsegregational killing system, phosphoryl	93.44
2v54_A		204	DTMP kinase, thymidylate kinase; nucleotide biosyn	93.41
2orv_A		234	Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2	93.4
3cmw_A		1706	Protein RECA, recombinase A; homologous recombinat	93.39
2bwj_A		199	Adenylate kinase 5; phosphoryl transfer reaction,	93.37
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	93.36
3eud_A		115	Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A	93.29
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	93.26
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	93.14
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	93.12
1aky_A		220	Adenylate kinase; ATP:AMP phosphotransferase, myok	93.08
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	93.07
1jjv_A		206	Dephospho-COA kinase; P-loop nucleotide-binding fo	93.05
2vli_A		183	Antibiotic resistance protein; transferase, tunica	93.03
2c5m_A		294	CTP synthase; cytidine 5-prime triphosphate synthe	93.03
3cm0_A		186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	93.0
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	92.98
2www_A		349	Methylmalonic aciduria type A protein, mitochondri	92.97
1knq_A		175	Gluconate kinase; ALFA/beta structure, transferase	92.96
4b3f_X		646	DNA-binding protein smubp-2; hydrolase, helicase;	92.94
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	92.91
3lv8_A		236	DTMP kinase, thymidylate kinase; structural genomi	92.88
1g8f_A		511	Sulfate adenylyltransferase; alpha-beta protein, b	92.87
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	92.87
1zak_A		222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	92.85
3v9p_A		227	DTMP kinase, thymidylate kinase; ssgcid, STRU geno	92.85
1uf9_A		203	TT1252 protein; P-loop, nucleotide binding domain,	92.81
2if2_A		204	Dephospho-COA kinase; alpha-beta protein, structur	92.79
2chg_A		226	Replication factor C small subunit; DNA-binding pr	92.75
3crm_A		323	TRNA delta(2)-isopentenylpyrophosphate transferase	92.73
1nlf_A		279	Regulatory protein REPA; replicative DNA helicase	92.73
3foz_A		316	TRNA delta(2)-isopentenylpyrophosphate transferas;	92.72
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	92.68
4eaq_A		229	DTMP kinase, thymidylate kinase; structural genomi	92.65
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	92.61
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	92.52
3tqc_A		321	Pantothenate kinase; biosynthesis of cofactors, pr	92.49
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	92.4
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	92.38
4tmk_A		213	Protein (thymidylate kinase); ATP:DTMP phosphotran	92.36
3be4_A		217	Adenylate kinase; malaria, cryptosporidium parvum	92.33
1y63_A		184	LMAJ004144AAA protein; structural genomics, protei	92.33
1zd8_A		227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	92.27
3hjn_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	92.2
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	92.16
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	92.12
1ak2_A		233	Adenylate kinase isoenzyme-2; nucleoside monophosp	92.12
4eun_A		200	Thermoresistant glucokinase; putative sugar kinase	92.09
2ehv_A		251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	92.07
2vhj_A		331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	92.04
2qt1_A		207	Nicotinamide riboside kinase 1; non-protein kinase	91.99
4hlc_A		205	DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri	91.97
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	91.96
2qor_A		204	Guanylate kinase; phosphotransferase, purine metab	91.94
3ake_A		208	Cytidylate kinase; CMP kinase, CMP complex, open c	91.75
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	91.58
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	91.56
3tlx_A		243	Adenylate kinase 2; structural genomics, structura	91.44
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	91.42
3tau_A		208	Guanylate kinase, GMP kinase; structural genomics,	91.38
1w36_D		608	RECD, exodeoxyribonuclease V alpha chain; recombin	91.37
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	91.33
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	91.22
3exa_A		322	TRNA delta(2)-isopentenylpyrophosphate transferase	91.22
1sq5_A		308	Pantothenate kinase; P-loop, transferase; HET: PAU	91.14
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	91.14
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	91.13
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	91.12
3fb4_A		216	Adenylate kinase; psychrophIle, phosphotransferase	91.02
2grj_A		192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	91.02
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	91.01
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	90.97
2xb4_A		223	Adenylate kinase; ATP-binding, nucleotide-binding,	90.92
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	90.77
1e4v_A		214	Adenylate kinase; transferase(phosphotransferase);	90.76
3a8t_A		339	Adenylate isopentenyltransferase; rossmann fold pr	90.73
2qm8_A		337	GTPase/ATPase; G protein, G3E, metallochaperone, c	90.62
1tue_A		212	Replication protein E1; helicase, replication, E1E	90.56
1cke_A		227	CK, MSSA, protein (cytidine monophosphate kinase);	90.55
1bif_A		469	6-phosphofructo-2-kinase/ fructose-2,6-bisphospha;	90.54
3ch4_B		202	Pmkase, phosphomevalonate kinase; parallel beta-sh	90.52
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	90.48
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	90.45
1kgd_A		180	CASK, peripheral plasma membrane CASK; maguk, guan	90.39
1vht_A		218	Dephospho-COA kinase; structural genomics, transfe	90.29
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	90.26
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	90.12
1w4r_A		195	Thymidine kinase; type II, human, cytosolic, phosp	90.04
3dl0_A		216	Adenylate kinase; phosphotransferase, zinc coordin	90.03
2bbw_A		246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	89.77
2j41_A		207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	89.7
1ex7_A		186	Guanylate kinase; substrate-induced FIT, domain mo	89.57
3sr0_A		206	Adenylate kinase; phosphoryl transfer analogue, AL	89.45
2jeo_A		245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	89.41
2gk6_A		624	Regulator of nonsense transcripts 1; UPF1, helicas	89.33
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	89.13
3tr0_A		205	Guanylate kinase, GMP kinase; purines, pyrimidines	89.07
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	89.04
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	88.75
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	88.75
2qmh_A		205	HPR kinase/phosphorylase; V267F mutation, ATP-bind	88.34
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	88.28
3a00_A		186	Guanylate kinase, GMP kinase; domain movement, dim	88.24
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	88.12
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	87.88
1um8_A		376	ATP-dependent CLP protease ATP-binding subunit CL;	87.88
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	87.83
4a74_A		231	DNA repair and recombination protein RADA; hydrola	87.65
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	87.52
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	87.51
1q3t_A		236	Cytidylate kinase; nucleotide monophosphate kinase	87.4
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	87.36
2wjy_A		800	Regulator of nonsense transcripts 1; nonsense medi	87.34
3tqf_A		181	HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co	87.33
3ney_A		197	55 kDa erythrocyte membrane protein; structural ge	87.31
3e2i_A		219	Thymidine kinase; Zn-binding, ATP-binding, DNA syn	87.3
4ag6_A		392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	87.26
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	87.14
2g3y_A		211	GTP-binding protein GEM; small GTPase, GDP, inacti	86.99
3r20_A		233	Cytidylate kinase; structural genomics, seattle st	86.99
3eph_A		409	TRNA isopentenyltransferase; transferase, alternat	86.98
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	86.93
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	86.86
1nij_A		318	Hypothetical protein YJIA; structural genomics, P-	86.67
3cr8_A		552	Sulfate adenylyltranferase, adenylylsulfate kinase	86.64
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	86.64
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	86.62
3bs4_A		260	Uncharacterized protein PH0321; structural genomic	86.47
2eyu_A		261	Twitching motility protein PILT; pilus retraction	86.46
1ojl_A		304	Transcriptional regulatory protein ZRAR; response	86.43
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	86.32
3hws_A		363	ATP-dependent CLP protease ATP-binding subunit CL;	86.27
3lda_A		400	DNA repair protein RAD51; DNA binding protein, ATP	86.21
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	86.15
2i3b_A		189	HCR-ntpase, human cancer-related ntpase; AAA, ross	86.11
3nwj_A		250	ATSK2; P loop, shikimate, nucleoside monophosphate	86.05
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	85.87
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	85.78
4e22_A		252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	85.78
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	85.68
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	85.58
3jvv_A		356	Twitching mobility protein; hexameric P-loop ATPas	85.56
2xzl_A		802	ATP-dependent helicase NAM7; hydrolase-RNA complex	85.56
2ewv_A		372	Twitching motility protein PILT; pilus retraction	85.44
2r44_A		331	Uncharacterized protein; putative ATPase, structur	85.14
2ocp_A		241	DGK, deoxyguanosine kinase; protein-nucleotide com	85.1
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	85.05
1of1_A		376	Thymidine kinase; transferase, antiviral drug, enz	85.04
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	84.92
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	84.77
4b4t_K		428	26S protease regulatory subunit 6B homolog; hydrol	84.74
1lvg_A		198	Guanylate kinase, GMP kinase; transferase; HET: AD	84.72
1s96_A		219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	84.71
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	84.66
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	84.47
3rsc_A		415	CALG2; TDP, enediyne, structural genomics, PSI-2,	84.46
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	84.36
3co5_A		143	Putative two-component system transcriptional RES	84.24
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	84.13
2chq_A		319	Replication factor C small subunit; DNA-binding pr	84.0
2vo1_A		295	CTP synthase 1; pyrimidine biosynthesis, glutamine	83.92
2vp4_A		230	Deoxynucleoside kinase; ATP-binding, DNA synthesis	83.89
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	83.87
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	83.84
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	83.55
3lnc_A		231	Guanylate kinase, GMP kinase; ALS collaborative cr	83.42
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	83.37
3kta_A		182	Chromosome segregation protein SMC; structural mai	83.36
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	83.28
3con_A		190	GTPase NRAS; structural genomics consortium, SGC,	83.16
2fna_A		357	Conserved hypothetical protein; structural genomic	83.07
1c9k_A		180	COBU, adenosylcobinamide kinase; alpha/beta struct	83.04
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	82.98
1dek_A		241	Deoxynucleoside monophosphate kinase; transferase,	82.93
4b4t_M		434	26S protease regulatory subunit 6A; hydrolase, AAA	82.92
1iy2_A		278	ATP-dependent metalloprotease FTSH; AAA domain fol	82.84
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	82.46
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	82.41
4b4t_L		437	26S protease subunit RPT4; hydrolase, AAA-atpases,	82.37
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	82.21
2h92_A		219	Cytidylate kinase; rossmann fold, transferase; HET	81.96
3hdt_A		223	Putative kinase; structura genomics, PSI-2, protei	81.96
2dyk_A		161	GTP-binding protein; GTPase, ribosome-binding prot	81.77
1p9r_A		418	General secretion pathway protein E; bacterial typ	81.62
2ce2_X		166	GTPase HRAS; signaling protein, guanine nucleotide	81.37
3tmk_A		216	Thymidylate kinase; phosphotransferase; HET: T5A;	81.34
1znw_A		207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	81.13
3pvs_A		447	Replication-associated recombination protein A; ma	81.01
4gp7_A		171	Metallophosphoesterase; polynucleotide kinase phos	80.92
3fdi_A		201	Uncharacterized protein; cytidylate kinase like pr	80.91
1p5z_B		263	DCK, deoxycytidine kinase; nucleoside kinase, P-lo	80.75
1z6g_A		218	Guanylate kinase; structural genomics, SGC, struct	80.61
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	80.48
3c5c_A		187	RAS-like protein 12; GDP, GTPase, structural genom	80.41
4b4t_H		467	26S protease regulatory subunit 7 homolog; hydrola	80.34

>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP}	Back alignment and structure

Probab=100.00  E-value=5.4e-68  Score=541.88  Aligned_cols=355  Identities=30%  Similarity=0.525  Sum_probs=291.5

Q ss_pred             CcEEEEEeCCCCCcHHHHHHHHHHHHHHcCCceEEEecCCCc--chhhhhhhccCCCCeeecCCcceeecCchhhhhhhH
Q 013114           48 STTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDP--TAEYILNCKIGNSPVVCNSNLSAVRIETTKMFLEPL  125 (449)
Q Consensus        48 ~~rii~~~GKGGVGKTTvAaalA~~lA~~G~rvLLv~~d~Dp--sl~d~~g~~~~~~p~~i~~~L~~~eid~~~~~~~~~  125 (449)
                      |++|++++|||||||||+|+++|.++|++|+|||+|  |+ |  ++++.||.+.+.+|+.+.+||+++++|+...++++|
T Consensus         1 M~~i~~~~gkGG~GKTt~a~~la~~la~~g~~vllv--d~-~~~~l~~~~~~~~~~~~~~v~~~L~~~eid~~~~~~~~~   77 (374)
T 3igf_A            1 MALILTFLGKSGVARTKIAIAAAKLLASQGKRVLLA--GL-AEPVLPLLLEQTLTPDPQQIAPNLEVVQFQSSVLLERNW   77 (374)
T ss_dssp             -CEEEEEECSBHHHHHHHHHHHHHHHHHTTCCEEEE--EC-SCSHHHHHHTSCCCSSCEEEETTEEEEECCHHHHHHHHH
T ss_pred             CcEEEEEeCCCCCcHHHHHHHHHHHHHHCCCCeEEE--eC-CCCChHHhhCCCCCCCcccccccccccccCHHHHHHHHH
Confidence            689999999999999999999999999999999999  77 6  499999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhhcccccCCccccccCCCCChHHHHHHHHHHHHHHHhcccccccCcCCCccEEEEcCCCchHHHHHhhhH
Q 013114          126 NWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVS  205 (449)
Q Consensus       126 ~~~~~~~~~~~~~~~~~~~i~~~el~~~Pg~~e~~~l~~l~~l~~~l~~~~~~~~~~~~yD~IVvD~pPtg~tlrlL~lP  205 (449)
                      ..+........... .+..+..+++...||++|++++.++.++++           +++||+|||||||||||||||++|
T Consensus        78 ~~~~~~~~~~l~~~-~~~~~~~~el~~~Pg~~E~~~l~~~~~~~~-----------~~~yD~VIvDtpPtg~tLrlL~lP  145 (374)
T 3igf_A           78 EEVKKLEAQYLRTP-IIKEVYGQELVVLPGMDSALALNAIREYDA-----------SGKYDTIVYDGTGDAFTLRMLGLP  145 (374)
T ss_dssp             HHHHHHHHHHCSSC-SSSSSCGGGCCCCTTHHHHHHHHHHHHHHH-----------TTCCSEEEEECCCSHHHHHHHTHH
T ss_pred             HHHHHHHHhhcccc-cccccchhhhccCCCHHHHHHHHHHHHHHh-----------ccCCCEEEEeCCCChHHhhhhhhh
Confidence            99988776655333 346777888999999999998888777653           467999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhhhcccccc--chhhHHHHHHhhhccCCCCCCCCCChHHHH---HHHHHHHHHHHHhhcCCCceEE
Q 013114          206 SKARLYLKYLRNVAEKTDLGRLT--APSLLKLVDEALSISGRRPLLNGNTSAEIW---DAMDRMLERGSSALAEPHKFGC  280 (449)
Q Consensus       206 ~~l~~~l~~l~~~~~~~~~~~~~--~p~~~~~~~~~~~~~~~~~~~~~~~~d~~~---~~l~~~~~~~~~~L~dp~~t~v  280 (449)
                      +.+.||++++++++++.++++.+  .+++.++.+..++.+        .+.|+++   +++.+.+++++++|+||++|++
T Consensus       146 ~~l~~~l~~l~~~~~~~~~g~~~~~~~~~~p~~~~~~~~~--------~~~d~~~~~l~~~~~~~~~~~~~L~dp~~t~~  217 (374)
T 3igf_A          146 ESLSWYVRRFRQLFVNSDLGKTIAESPLIQPLISSFFNVN--------WTADNFAQPTNQVNNFLDKGKEALADPKRVAA  217 (374)
T ss_dssp             HHHHHHHHHTTSCC-------------------------------------------CHHHHHHHHHHHHHHHCTTTEEE
T ss_pred             HHHHHHHHHHHHHHhhhccccccccchhhhhhhhhhccCC--------CchHHHHHHHHHHHHHHHHHHHHHhccCCeEE
Confidence            99999999999998886444433  333333322222210        2234444   4556678899999999999999


Q ss_pred             EEEecCCCcchHHHHHHHHHHHHHcCCcccEEEEecCccccHHHHHHHHHhcCCCCeeeccCCCCCCccchhhhhccccH
Q 013114          281 FLVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTASPHLDEESAERVRKNFSPLPLSFLPHLPTDSSLDWNTIMLNPAG  360 (449)
Q Consensus       281 ~LVt~PE~~~~i~Ea~r~~~~L~~~Gi~V~~vvvN~~~~~q~~~l~~i~~~F~~lpi~~vP~~~~e~~~~~~~~g~~~L~  360 (449)
                      ++||+|| ++++.|++|++++|+.+|+++.++|+|+ +    .|+++|++.|.++||..+|++++|           .|+
T Consensus       218 vlVt~pe-~~sl~ea~r~~~~L~~~gi~v~gvVvN~-~----~~l~~i~~~F~~~~v~~vpl~~~e-----------~l~  280 (374)
T 3igf_A          218 FLVTTAD-PLEVVSVRYLWGSAQQIGLTIGGVIQVS-S----QTEGDLSAEFTPLSVTVVPDVTKG-----------DWQ  280 (374)
T ss_dssp             EEEECSC-HHHHHHHHHHHHHHHHHTCCEEEEEECC-C----SCCCCCGGGSTTSCEEECCCCBTT-----------BCH
T ss_pred             EEEECCC-ccHHHHHHHHHHHHHHcCCCccEEEEcC-H----HHHHHHHHhcCCCceEECCCCChh-----------HHH
Confidence            9999999 7999999999999999999999999998 2    178899999999999999999886           555


Q ss_pred             HHHHHHhccccccc-ccC--CcceEEecCceEEEEEcCCCCCCceEEEeecCCCeEEEEECCeeeeecCCccccc-Cccc
Q 013114          361 KEARDLLSLQAKRS-SSL--MSSVKFDAAKKSVTLLMPGFDKSEIKLYQYRGGSELLVEAGDQRRVIHLPPQIQG-KVGG  436 (449)
Q Consensus       361 ~la~~lf~~~~dp~-~~~--~~~~~i~~~~y~l~l~LP~~~~~~l~l~~~~~gdeL~I~~g~~rR~i~LP~~L~~-~~~~  436 (449)
                      ++++.+ +   +|. ..+  .+|+.|++.+|.++++|||++|++|+|+|+  ||||+|++|+|||+|.||+.|++ ++.|
T Consensus       281 ~l~~~l-~---~p~~~~~~~~~~~~i~~~~~~~~l~lP~~~~~~~~l~~~--gdeL~v~~g~~rR~i~LP~~L~~~~v~~  354 (374)
T 3igf_A          281 PLIDAL-P---NFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLTQY--GPEVTVEAGDQRRNIFLPPALSGRPITG  354 (374)
T ss_dssp             HHHHHC-C---CHHHHHHHSCCSEEEETTTTEEEEECTTCCGGGCEEEEE--TTEEEEEETTEEEEEECCTTTTTCCEEE
T ss_pred             HHHHHh-c---CccccccCCCCCEEEEeccEEEEEECCCCCHHHeEEEEE--CCeEEEEECCEeecccCCHHHcCCCccc
Confidence            666655 3   254 332  489999999999999999999999999986  99999999999999999999999 6999


Q ss_pred             eEEeCCEEEEEc
Q 013114          437 ARFIERNLIVTM  448 (449)
Q Consensus       437 A~~~~g~L~I~f  448 (449)
                      |+|+||+|+|+|
T Consensus       355 A~~~~~~L~i~~  366 (374)
T 3igf_A          355 AKFQNNYLIISF  366 (374)
T ss_dssp             EEEETTEEEEEE
T ss_pred             cEEECCEEEEEE
Confidence            999999999998

PyMOL of 3igf

>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A*	Back alignment and structure

>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid}	Back alignment and structure

>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A*	Back alignment and structure

>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii}	Back alignment and structure

>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe}	Back alignment and structure

>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A*	Back alignment and structure

>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A*	Back alignment and structure

>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A*	Back alignment and structure

>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli}	Back alignment and structure

>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2}	Back alignment and structure

>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A*	Back alignment and structure

>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A*	Back alignment and structure

>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A*	Back alignment and structure

>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum}	Back alignment and structure

>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A*	Back alignment and structure

>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A*	Back alignment and structure

>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10	Back alignment and structure

>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A*	Back alignment and structure

>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli}	Back alignment and structure

>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10	Back alignment and structure

>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A	Back alignment and structure

>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A	Back alignment and structure

>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae}	Back alignment and structure

>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes}	Back alignment and structure

>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A	Back alignment and structure

>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A*	Back alignment and structure

>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A	Back alignment and structure

>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP}	Back alignment and structure

>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale}	Back alignment and structure

>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A	Back alignment and structure

>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A	Back alignment and structure

>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans}	Back alignment and structure

>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A	Back alignment and structure

>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A	Back alignment and structure

>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A	Back alignment and structure

>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A	Back alignment and structure

>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus}	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A	Back alignment and structure

>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A*	Back alignment and structure

>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp}	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata}	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A	Back alignment and structure

>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata}	Back alignment and structure

>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV}	Back alignment and structure

>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A	Back alignment and structure

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*	Back alignment and structure

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*	Back alignment and structure

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A*	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1}	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10	Back alignment and structure

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*	Back alignment and structure

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A	Back alignment and structure

>2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis}	Back alignment and structure

>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}	Back alignment and structure

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S*	Back alignment and structure

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*	Back alignment and structure

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A*	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58}	Back alignment and structure

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus}	Back alignment and structure

>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A*	Back alignment and structure

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}	Back alignment and structure

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6	Back alignment and structure

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*	Back alignment and structure

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}	Back alignment and structure

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A*	Back alignment and structure

>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2	Back alignment and structure

>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}	Back alignment and structure

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>3do6_A Formate--tetrahydrofolate ligase; TM1766, putative formyltetrahydrofolate synthetase, structural genomics; HET: MSE; 1.85A {Thermotoga maritima} SCOP: c.37.1.0	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A*	Back alignment and structure

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*	Back alignment and structure

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A	Back alignment and structure

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A	Back alignment and structure

>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A*	Back alignment and structure

>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A*	Back alignment and structure

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}	Back alignment and structure

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*	Back alignment and structure

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*	Back alignment and structure

>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A*	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis}	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A	Back alignment and structure

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}	Back alignment and structure

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A	Back alignment and structure

>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}	Back alignment and structure

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*	Back alignment and structure

>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A*	Back alignment and structure

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1	Back alignment and structure

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}	Back alignment and structure

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}	Back alignment and structure

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*	Back alignment and structure

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A*	Back alignment and structure

>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A*	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1	Back alignment and structure

>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1	Back alignment and structure

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A	Back alignment and structure

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A	Back alignment and structure

>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25	Back alignment and structure

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A*	Back alignment and structure

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}	Back alignment and structure

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1	Back alignment and structure

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*	Back alignment and structure

>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25	Back alignment and structure

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*	Back alignment and structure

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}	Back alignment and structure

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*	Back alignment and structure

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*	Back alignment and structure

>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A*	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}	Back alignment and structure

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}	Back alignment and structure

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}	Back alignment and structure

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*	Back alignment and structure

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A	Back alignment and structure

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}	Back alignment and structure

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*	Back alignment and structure

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}	Back alignment and structure

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*	Back alignment and structure

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20	Back alignment and structure

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*	Back alignment and structure

>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A	Back alignment and structure

>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens}	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A*	Back alignment and structure

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*	Back alignment and structure

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A	Back alignment and structure

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}	Back alignment and structure

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A	Back alignment and structure

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*	Back alignment and structure

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*	Back alignment and structure

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A*	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A	Back alignment and structure

>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii}	Back alignment and structure

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus}	Back alignment and structure

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*	Back alignment and structure

>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1	Back alignment and structure

>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii}	Back alignment and structure

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}	Back alignment and structure

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A	Back alignment and structure

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*	Back alignment and structure

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*	Back alignment and structure

>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*	Back alignment and structure

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1	Back alignment and structure

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A*	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A*	Back alignment and structure

>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A*	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A*	Back alignment and structure

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus}	Back alignment and structure

>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940}	Back alignment and structure

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}	Back alignment and structure

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*	Back alignment and structure

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...	Back alignment and structure

>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A*	Back alignment and structure

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*	Back alignment and structure

>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum}	Back alignment and structure

>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ...	Back alignment and structure

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens}	Back alignment and structure

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		449
d1ihua1		296	c.37.1.10 (A:1-296) Arsenite-translocating ATPase	9e-13
d1ihua2		279	c.37.1.10 (A:308-586) Arsenite-translocating ATPas	3e-07
d1hyqa_		232	c.37.1.10 (A:) Cell division regulator MinD {Archa	7e-04
d1g3qa_		237	c.37.1.10 (A:) Cell division regulator MinD {Archa	0.002
d1ukza_		196	c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac	0.002
d1cp2a_		269	c.37.1.10 (A:) Nitrogenase iron protein {Clostridi	0.002
d3adka_		194	c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [	0.003

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]

 Score = 66.2 bits (160), Expect = 9e-13
 Identities = 46/319 (14%), Positives = 85/319 (26%), Gaps = 60/319 (18%)

Query: 46  DKSTTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDP--TAEYILNCKIGNSP 103
                 + F GKGG GKT+ +   A   A  G    LV  S DP      + +  IGN+ 
Sbjct: 5   QNIPPYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLV--STDPASNVGQVFSQTIGNTI 62

Query: 104 VVCNSNLSAVRIETTKMFLEPLNWLKQAD-ARLNMTQGVLGGVVGEELGVLPGMDSIFSA 162
               S      +E            +  D  +  +   V+  +  +  G      + F  
Sbjct: 63  QAIASVPGLSALEIDPQAAAQQYRARIVDPIKGVLPDDVVSSINEQLSGACTTEIAAFDE 122

Query: 163 FALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRMIGVSSKARLYLKYLRNVAEKT 222
           F                    +FD I++D      T+R++ +      ++      A   
Sbjct: 123 FTGLLTD---------ASLLTRFDHIIFDTAPTGHTIRLLQLPGAWSSFIDSNPEGASCL 173

Query: 223 DLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHKFGCFL 282
                                               +           AL++P +    L
Sbjct: 174 G------------------------------PMAGLEKQREQYAYAVEALSDPKRTRLVL 203

Query: 283 VMNPNNRTSVNSALRYWGCTIQAGAQVAGAI---------------CTASPHLDEESAER 327
           V      +++    R        G +    +                 A    ++E+   
Sbjct: 204 VARLQK-STLQEVARTHLELAAIGLKNQYLVINGVLPKTEAANDTLAAAIWEREQEALAN 262

Query: 328 VRKNFSPLPLSFLPHLPTD 346
           +  + + LP   L   P +
Sbjct: 263 LPADLAGLPTDTLFLQPVN 281

PyMOL of d1ihua1

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279	Back information, alignment and structure

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232	Back information, alignment and structure

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Length = 269	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		449
d1ihua1		296	Arsenite-translocating ATPase ArsA {Escherichia co	100.0
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	99.96
d1hyqa_		232	Cell division regulator MinD {Archaeon Archaeoglob	99.74
d2afhe1		289	Nitrogenase iron protein {Azotobacter vinelandii [	99.73
d1cp2a_		269	Nitrogenase iron protein {Clostridium pasteurianum	99.71
d1g3qa_		237	Cell division regulator MinD {Archaeon Pyrococcus	99.69
d1byia_		224	Dethiobiotin synthetase {Escherichia coli [TaxId:	99.48
d1shsa_		115	Small heat shock protein {Archaeon Methanococcus j	99.08
d1gmea_		150	Small heat shock protein {Wheat (Triticum aestivum	98.96
d2qy9a2		211	GTPase domain of the signal recognition particle r	98.89
d1okkd2		207	GTPase domain of the signal recognition particle r	98.8
d1vmaa2		213	GTPase domain of the signal recognition particle r	98.74
d1ls1a2		207	GTPase domain of the signal sequence recognition p	98.61
d1j8yf2		211	GTPase domain of the signal sequence recognition p	98.37
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	97.62
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	97.5
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	97.43
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	97.25
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	97.2
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	97.16
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	96.85
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	96.68
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	96.5
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	96.41
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	96.35
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	96.35
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	96.29
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	96.2
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	96.19
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	96.18
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	95.9
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	95.86
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	95.63
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	95.62
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	95.49
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	95.49
d1vcoa2		272	CTP synthase PyrG, N-terminal domain {Thermus ther	95.35
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	95.34
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	95.25
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	95.23
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	95.22
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	95.21
d1eg7a_		549	Formyltetrahydrofolate synthetase {Moorella thermo	95.05
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	94.98
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	94.96
d1g5ta_		157	ATP:corrinoid adenosyltransferase CobA {Salmonella	94.92
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	94.85
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	94.84
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	94.82
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	94.71
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	94.67
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	94.61
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	94.38
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	94.34
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	94.33
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	94.22
d1tf7a1		242	Circadian clock protein KaiC {Synechococcus sp. st	94.13
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	94.08
d1a7ja_		288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	94.04
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	93.8
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	93.79
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	93.74
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	93.65
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	93.64
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	93.64
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	93.61
d1s1ma2		266	CTP synthase PyrG, N-terminal domain {Escherichia	93.58
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	93.53
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	93.51
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	93.51
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	93.43
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	93.4
d2vo1a1		273	CTP synthase PyrG, N-terminal domain {Human (Homo	93.19
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	93.14
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	93.04
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	93.02
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	92.87
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	92.79
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	92.64
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	92.58
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	92.51
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	92.47
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	92.41
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	92.35
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	92.33
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	91.88
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	91.85
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	91.85
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	91.62
d1jjva_		205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	91.51
d1vhta_		208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	91.48
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	91.28
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	91.18
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	91.05
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	90.9
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	90.72
d1deka_		241	Deoxynucleoside monophosphate kinase {Bacteriophag	90.67
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	90.66
d1g8fa3		122	ATP sulfurylase C-terminal domain {Baker's yeast (	90.49
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	90.42
d1kkma_		176	HPr kinase HprK C-terminal domain {Lactobacillus c	90.19
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	90.13
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	90.04
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	89.89
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	89.69
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	89.65
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	89.64
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	89.58
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	89.05
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	89.01
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	88.47
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	88.27
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	88.01
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	87.51
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	87.37
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	87.06
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	86.88
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	86.53
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	86.53
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	86.48
d1s96a_		205	Guanylate kinase {Escherichia coli [TaxId: 562]}	86.0
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	85.79
d1ko7a2		169	HPr kinase HprK C-terminal domain {Staphylococcus	85.58
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	85.42
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	85.1
d1knxa2		177	HPr kinase HprK C-terminal domain {Mycoplasma pneu	85.0
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	84.67
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	84.57
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	84.39
d1jaya_		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae	84.09
d1w44a_		321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	84.05
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	83.78
d2jdid3		276	Central domain of beta subunit of F1 ATP synthase	83.32
d1tmka_		214	Thymidylate kinase {Baker's yeast (Saccharomyces c	83.21
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	83.08
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	82.62
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	82.44
d1e8ca3		234	UDP-N-acetylmuramyl tripeptide synthetase MurE {Es	82.36
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	82.15

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=5.8e-41  Score=326.39  Aligned_cols=268  Identities=18%  Similarity=0.190  Sum_probs=194.6

Q ss_pred             CCCcEEEEEeCCCCCcHHHHHHHHHHHHHHcCCceEEEecCCCc--chhhhhhhccCCCCeee--cCCcceeecCchhhh
Q 013114           46 DKSTTLITFLGKGGSGKTTSAVFAAQHYAMAGLSTCLVLHSQDP--TAEYILNCKIGNSPVVC--NSNLSAVRIETTKMF  121 (449)
Q Consensus        46 ~~~~rii~~~GKGGVGKTTvAaalA~~lA~~G~rvLLv~~d~Dp--sl~d~~g~~~~~~p~~i--~~~L~~~eid~~~~~  121 (449)
                      .+|+||+||+|||||||||+|+|+|.++|++|+|||||  |+||  ++++.||.+.+..+..+  .+|+++.++|+...+
T Consensus         5 ~~~p~~i~~sGKGGVGKTTvaa~lA~~lA~~G~rVLlv--D~Dp~~~l~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (296)
T d1ihua1           5 QNIPPYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLV--STDPASNVGQVFSQTIGNTIQAIASVPGLSALEIDPQAAA   82 (296)
T ss_dssp             SSCCSEEEEECSTTSSHHHHHHHHHHHHHHTTCCEEEE--ECCTTCCHHHHTTSCCCSSCEECTTSTTEEEEECCHHHHH
T ss_pred             CCCCeEEEEECCCcChHHHHHHHHHHHHHHCCCCEEEE--eCCCCCCHHHHhCCCCcccccccccccccchhccChhhHH
Confidence            35689999999999999999999999999999999999  8887  49999999988888765  479999999999988


Q ss_pred             hhhHHHHHHHHHhhhhcccccCCccccccCCCCChHHHHHHHHHHHHHHHhcccccccCcCCCccEEEEcCCCchHHHHH
Q 013114          122 LEPLNWLKQADARLNMTQGVLGGVVGEELGVLPGMDSIFSAFALERLVGFFGNFAQRNHQKEKFDVIVYDGISPEETLRM  201 (449)
Q Consensus       122 ~~~~~~~~~~~~~~~~~~~~~~~i~~~el~~~Pg~~e~~~l~~l~~l~~~l~~~~~~~~~~~~yD~IVvD~pPtg~tlrl  201 (449)
                      ++++....+........ ..+..+  ......++......+..+...+...       ...++||+||+||||+++++++
T Consensus        83 ~~~~~~~~~~~~~~~~~-~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~yD~iviD~pp~~~~l~~  152 (296)
T d1ihua1          83 QQYRARIVDPIKGVLPD-DVVSSI--NEQLSGACTTEIAAFDEFTGLLTDA-------SLLTRFDHIIFDTAPTGHTIRL  152 (296)
T ss_dssp             HHHHHHHHGGGTTTSCH-HHHHHH--HHHTSSHHHHHHHHHHHHHHHHHCT-------THHHHCSEEEESSCCCHHHHHH
T ss_pred             HHHHhhccchhhhcccc-cchhhh--HHhhhhhhhhhHHHHHHHHHHHHHh-------hhcccceEEEeccCCCchHHHH
Confidence            88877665533221100 000000  0111122222222222222222211       1235799999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhhhhccccccchhhHHHHHHhhhccCCCCCCCCCChHHHHHHHHHHHHHHHHhhcCCCceEEE
Q 013114          202 IGVSSKARLYLKYLRNVAEKTDLGRLTAPSLLKLVDEALSISGRRPLLNGNTSAEIWDAMDRMLERGSSALAEPHKFGCF  281 (449)
Q Consensus       202 L~lP~~l~~~l~~l~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~l~~~~~~~~~~L~dp~~t~v~  281 (449)
                      +++|+.+.+|+........      ..++..                        .++.+.+.+.++.+.+.|++.|+++
T Consensus       153 ~~l~~~~~~~~~~~~~~~~------~~~~~~------------------------~~~~~~~~~~~~~~~~~~~~~t~~~  202 (296)
T d1ihua1         153 LQLPGAWSSFIDSNPEGAS------CLGPMA------------------------GLEKQREQYAYAVEALSDPKRTRLV  202 (296)
T ss_dssp             HHCGGGGTCCC------CC------CCGGGG------------------------GCCSCHHHHHHHHHHHHCTTTEEEE
T ss_pred             HhHHHHHHHHHhhccchhh------hccccc------------------------chhHHHHHHHHHHhhccCcccceee
Confidence            9999999999876543322      112110                        0012234566777888999999999


Q ss_pred             EEecCCCcchHHHHHHHHHHHHHcCCcccEEEEecC---------cc------ccHHHHHHHHHhcCCCCeeeccCCCCC
Q 013114          282 LVMNPNNRTSVNSALRYWGCTIQAGAQVAGAICTAS---------PH------LDEESAERVRKNFSPLPLSFLPHLPTD  346 (449)
Q Consensus       282 LVt~PE~~~~i~Ea~r~~~~L~~~Gi~V~~vvvN~~---------~~------~q~~~l~~i~~~F~~lpi~~vP~~~~e  346 (449)
                      +||+|| ++++.|++|+++.++.+|+++.++|+|+-         .+      .|..++++|.+.|.++|+.++|+++.|
T Consensus       203 lVt~pe-~~~~~~~~r~~~~l~~~gi~~~~vVvN~v~p~~~~~~~~~~~~~~~~q~~~l~~i~~~~~~~~~~~vp~~~~e  281 (296)
T d1ihua1         203 LVARLQ-KSTLQEVARTHLELAAIGLKNQYLVINGVLPKTEAANDTLAAAIWEREQEALANLPADLAGLPTDTLFLQPVN  281 (296)
T ss_dssp             EEEESC-HHHHHHHHHHHHHHHHHTCCCEEEEEEEECCGGGGSSCHHHHHHHHHHHHHHHTCCHHHHTSCEEEEECCSSC
T ss_pred             EecCcc-hhHHHHHHHHHHHHHhcCCCceEEEEcCCcCccCCCCCHHHHHHHHHHHHHHHHHHHHccCCceEEecCCCCC
Confidence            999999 79999999999999999999999999941         11      134588999999999999999999999


Q ss_pred             CccchhhhhccccHHH
Q 013114          347 SSLDWNTIMLNPAGKE  362 (449)
Q Consensus       347 ~~~~~~~~g~~~L~~l  362 (449)
                      +      +|+++|+++
T Consensus       282 ~------~G~~aL~~l  291 (296)
T d1ihua1         282 M------VGVSALSRL  291 (296)
T ss_dssp             C------CSHHHHHHT
T ss_pred             C------cCHHHHHHH
Confidence            8      787777764

PyMOL of d1ihua1

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure