Citrus Sinensis ID: 013204


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------
MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPEEVDELISKYGKALKATEERVKELKSQQ
cccccccccccccccccEEEEEcccEEEEccccEEEEcccHHHHcccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHHHcccEEEEcccccccccccccccccccccccHHHHHHHcccccccccHHHHccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccEEEEccccEEEEEEEEccccccccccccccHHHHHHHHHHHcccEEEEcccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccHHHHHHcccEEEEEccEEEEEEccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEcccHHHHHHHcccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHccHEEEEEEcccEEcccccEEEccHHHHHHHHHHHHHccEEEEEcccccccccccccHHHHHcccccEEEEcHHHHccccccEEEEEEHHHHHHHHHHHcccccEEccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccHHccHHEEEEEHEHccccccccccHHHHHHHHHHHHHHHccEEEEEcccEEEEccccEccHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mlapftagwqstdvhplvieksegsyvydvngkkYLDSLAGLWCtalggsepRLVAAATAQLntlpfyhsfwnrttkpsLDLAKELLEMFTASKMAKVFFtnsgseandTQVKLVWYYnnalgrpnkkkFIARQKSYHGSTLIAAslsglpalhqkfdlpapfvlhtdcphywryahpgeteeEYSTRLANNLEDLILKEGPETIAAFIaepvigaggvipppatYFEKVQAVVKKYDILFIADEVICAFGrlgtmfgcdkysikpDLVSFAKALssaympigailvsPEVSEVIHsqsntlgsfshgftysghpVSCAVAIEALKIYKERNIVEQVNKIApkfqdgvkafsdspiigeirgtglilgtefadnkspnepfppewgigayfgaqceKHGMLvrvsgdnimmsppfimspEEVDELISKYGKALKATEERVKELKSQQ
mlapftagwqstdvhpLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPEEVDELISKYGKALKATEERVKELKSQQ
MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEpvigaggvipppaTYFEKVQAVVKKYDILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPEEVDELISKYGKALKATEERVKELKSQQ
*****TAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFAD*******FPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFI*******************************
MLAPFT*GWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPEEVDELISKYGKALKATEERVKEL****
MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPEEVDELISKYGKALK*************
MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPEEVDELISKYGKALKATEERVKELK***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPEEVDELxxxxxxxxxxxxxxxxxxxxxQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query447 2.2.26 [Sep-21-2011]
Q84P52520 Gamma aminobutyrate trans N/A no 1.0 0.859 0.863 0.0
Q84P54515 Gamma aminobutyrate trans N/A no 1.0 0.867 0.856 0.0
Q7XN11516 Gamma-aminobutyrate trans yes no 1.0 0.866 0.850 0.0
Q01K11516 Gamma-aminobutyrate trans N/A no 1.0 0.866 0.847 0.0
Q94CE5504 Gamma-aminobutyrate trans yes no 1.0 0.886 0.857 0.0
B8BBZ7510 Probable gamma-aminobutyr N/A no 1.0 0.876 0.827 0.0
Q6ZCF0510 Probable gamma-aminobutyr no no 1.0 0.876 0.825 0.0
Q84P53458 Gamma aminobutyrate trans N/A no 0.997 0.973 0.780 0.0
Q7XN12497 Probable gamma-aminobutyr no no 1.0 0.899 0.771 0.0
Q01K12497 Probable gamma-aminobutyr N/A no 1.0 0.899 0.771 0.0
>sp|Q84P52|GATP3_SOLLC Gamma aminobutyrate transaminase 3, chloroplastic OS=Solanum lycopersicum GN=GABA-TP3 PE=1 SV=1 Back     alignment and function desciption
 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/447 (86%), Positives = 427/447 (95%)

Query: 1   MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATA 60
           MLAPFTAGW STD+ PLVI+KSEGSYVYDVNGKKYLD+LAGLWCT+LGG+EPRLVAAAT 
Sbjct: 69  MLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEPRLVAAATK 128

Query: 61  QLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNN 120
           QLN L FYHSFWNR+TKPSLDLAKELL++FTA+KMAK FFTNSGSEANDTQVKLVWYYNN
Sbjct: 129 QLNELAFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQVKLVWYYNN 188

Query: 121 ALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGE 180
           ALGRP+KKKFIAR KSYHGSTLI+ASLSGLPALHQ+FDLPAPFVLHTDCPH+WR+  PGE
Sbjct: 189 ALGRPDKKKFIARTKSYHGSTLISASLSGLPALHQQFDLPAPFVLHTDCPHFWRFHQPGE 248

Query: 181 TEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDIL 240
           TEEE+STRLANNLE+LILKEGPETIAAFIAEPV+GAGGVIPPPATYFEKVQA++KKYDIL
Sbjct: 249 TEEEFSTRLANNLENLILKEGPETIAAFIAEPVMGAGGVIPPPATYFEKVQAILKKYDIL 308

Query: 241 FIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSN 300
           FIADEVIC FGRLGTMFGC+KY+IKPDLVS AKALSS YMPIGA+LVSPEVS+VI+SQSN
Sbjct: 309 FIADEVICGFGRLGTMFGCEKYNIKPDLVSVAKALSSGYMPIGAVLVSPEVSDVIYSQSN 368

Query: 301 TLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEI 360
            LG+FSHGFTYSGHPVSCAVA+E LKIYKERNI+EQVN+I+PKFQ+G+KAFSDSPIIGEI
Sbjct: 369 KLGTFSHGFTYSGHPVSCAVALETLKIYKERNIIEQVNRISPKFQEGLKAFSDSPIIGEI 428

Query: 361 RGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPE 420
           RGTGL+ GTEF DNKSPN+PFPPEWGIGAYFGA+CEKHG+LVRV+GDNIMMSPP+I+S E
Sbjct: 429 RGTGLLHGTEFTDNKSPNDPFPPEWGIGAYFGARCEKHGVLVRVAGDNIMMSPPYILSLE 488

Query: 421 EVDELISKYGKALKATEERVKELKSQQ 447
           E+DELI KYGKALK TE RV+ELKSQ+
Sbjct: 489 EIDELIIKYGKALKDTENRVEELKSQK 515




Transaminase that degrades gamma-amino butyric acid (GABA) and uses pyruvate or glyoxylate as amino-group acceptor. Cannot use beta-alanine, ornithine, acetylornithine, serine, glycine, asparagine, glutamine, glutamate, valine, leucine, isoleucine, methionine, phenylalanine, histidine, lysine, arginine, aspartate, threonine, tyrosine, tryptophan, proline, or cysteine as amino donors.
Solanum lycopersicum (taxid: 4081)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: -
>sp|Q84P54|GATP1_SOLLC Gamma aminobutyrate transaminase 1, mitochondrial OS=Solanum lycopersicum GN=GABA-TP1 PE=1 SV=1 Back     alignment and function description
>sp|Q7XN11|GATP1_ORYSJ Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=OSL2 PE=1 SV=2 Back     alignment and function description
>sp|Q01K11|GATP1_ORYSI Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17385 PE=3 SV=1 Back     alignment and function description
>sp|Q94CE5|GATP_ARATH Gamma-aminobutyrate transaminase POP2, mitochondrial OS=Arabidopsis thaliana GN=POP2 PE=1 SV=1 Back     alignment and function description
>sp|B8BBZ7|GATP3_ORYSI Probable gamma-aminobutyrate transaminase 3, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_28220 PE=3 SV=1 Back     alignment and function description
>sp|Q6ZCF0|GATP3_ORYSJ Probable gamma-aminobutyrate transaminase 3, mitochondrial OS=Oryza sativa subsp. japonica GN=Os08g0205900 PE=3 SV=1 Back     alignment and function description
>sp|Q84P53|GATP2_SOLLC Gamma aminobutyrate transaminase 2 OS=Solanum lycopersicum GN=GABA-TP2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XN12|GATP2_ORYSJ Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os04g0614500 PE=2 SV=2 Back     alignment and function description
>sp|Q01K12|GATP2_ORYSI Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17384 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query447
224086589514 predicted protein [Populus trichocarpa] 1.0 0.869 0.910 0.0
414883543447 TPA: putative aminotransferase class III 1.0 1.0 0.906 0.0
255560072528 aminobutyrate aminotransferase, putative 1.0 0.846 0.901 0.0
224137404450 predicted protein [Populus trichocarpa] 1.0 0.993 0.903 0.0
405780098514 gamma-aminobutyrate transaminase 1 [Malu 1.0 0.869 0.906 0.0
356538512513 PREDICTED: uncharacterized aminotransfer 1.0 0.871 0.890 0.0
405780100514 gamma-aminobutyrate transaminase 2 [Malu 1.0 0.869 0.897 0.0
449460004507 PREDICTED: gamma aminobutyrate transamin 1.0 0.881 0.868 0.0
356544361517 PREDICTED: uncharacterized aminotransfer 1.0 0.864 0.883 0.0
225464809516 PREDICTED: uncharacterized aminotransfer 1.0 0.866 0.879 0.0
>gi|224086589|ref|XP_002307913.1| predicted protein [Populus trichocarpa] gi|222853889|gb|EEE91436.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/447 (91%), Positives = 434/447 (97%)

Query: 1   MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATA 60
           MLAPFTAGWQS+D++PLVIEKSEGSYVYD+NGKKYLD+LAGLWCTALGG+EPRLVAAAT 
Sbjct: 65  MLAPFTAGWQSSDLNPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRLVAAATE 124

Query: 61  QLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNN 120
           QLN LPFYHSFWNRTTKPSLDLAKELLE FTASKMAK FFTNSGSEANDTQVKLVWYYNN
Sbjct: 125 QLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNSGSEANDTQVKLVWYYNN 184

Query: 121 ALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGE 180
           ALGRPNKKKFIAR KSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRY  PGE
Sbjct: 185 ALGRPNKKKFIARAKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYHLPGE 244

Query: 181 TEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDIL 240
           TEEE+STRLANNLE+LILKEGPETIAAFIAEPV+GAGGVIPPPATYF+K+QAVVKKY+IL
Sbjct: 245 TEEEFSTRLANNLENLILKEGPETIAAFIAEPVMGAGGVIPPPATYFDKIQAVVKKYEIL 304

Query: 241 FIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSN 300
           FIADEVICAFGRLGTM+GCDKY+IKPDLVS AKALSSAYMPIGA++VSPEVS+VIHSQS+
Sbjct: 305 FIADEVICAFGRLGTMYGCDKYNIKPDLVSVAKALSSAYMPIGAVMVSPEVSDVIHSQSS 364

Query: 301 TLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEI 360
            LGSFSHGFTYSGHPV+CAVAIEALKIYKERNI++QVN+IAPKFQDGVKAF+DSPIIGEI
Sbjct: 365 KLGSFSHGFTYSGHPVACAVAIEALKIYKERNILDQVNRIAPKFQDGVKAFADSPIIGEI 424

Query: 361 RGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPE 420
           RGTGLILGTEF DNKSPN+PFPPEWG+GAYFGAQCEK GMLVRV+GDNIMMSPPFIMSPE
Sbjct: 425 RGTGLILGTEFVDNKSPNDPFPPEWGVGAYFGAQCEKDGMLVRVAGDNIMMSPPFIMSPE 484

Query: 421 EVDELISKYGKALKATEERVKELKSQQ 447
           EVD LISKYGKAL+ATEERVKELKSQ 
Sbjct: 485 EVDVLISKYGKALRATEERVKELKSQH 511




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|414883543|tpg|DAA59557.1| TPA: putative aminotransferase class III superfamily protein, partial [Zea mays] Back     alignment and taxonomy information
>gi|255560072|ref|XP_002521054.1| aminobutyrate aminotransferase, putative [Ricinus communis] gi|223539757|gb|EEF41338.1| aminobutyrate aminotransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224137404|ref|XP_002322549.1| predicted protein [Populus trichocarpa] gi|222867179|gb|EEF04310.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|405780098|gb|AFS28620.1| gamma-aminobutyrate transaminase 1 [Malus x domestica] Back     alignment and taxonomy information
>gi|356538512|ref|XP_003537747.1| PREDICTED: uncharacterized aminotransferase y4uB-like [Glycine max] Back     alignment and taxonomy information
>gi|405780100|gb|AFS28621.1| gamma-aminobutyrate transaminase 2 [Malus x domestica] Back     alignment and taxonomy information
>gi|449460004|ref|XP_004147736.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356544361|ref|XP_003540621.1| PREDICTED: uncharacterized aminotransferase y4uB-like [Glycine max] Back     alignment and taxonomy information
>gi|225464809|ref|XP_002268803.1| PREDICTED: uncharacterized aminotransferase y4uB-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query447
TIGR_CMR|CPS_2025450 CPS_2025 "aminotransferase, cl 0.935 0.928 0.464 8.2e-99
TIGR_CMR|SPO_1166450 SPO_1166 "aminotransferase, cl 0.959 0.953 0.418 3.1e-90
UNIPROTKB|Q47V65451 CPS_4663 "Aminotransferase, cl 0.955 0.946 0.4 1.8e-87
TIGR_CMR|CPS_4663451 CPS_4663 "aminotransferase, cl 0.955 0.946 0.4 1.8e-87
UNIPROTKB|Q4K448454 PFL_5927 "Aminotransferase" [P 0.955 0.940 0.400 2.9e-87
UNIPROTKB|Q48CA6455 PSPPH_4896 "Aminotransferase, 0.955 0.938 0.402 1.1e-85
TIGR_CMR|SPO_1136457 SPO_1136 "aminotransferase, cl 0.930 0.910 0.391 6.6e-81
UNIPROTKB|Q483I5467 CPS_2054 "Aminotransferase, cl 0.975 0.933 0.370 1.6e-77
TIGR_CMR|CPS_2054467 CPS_2054 "aminotransferase, cl 0.975 0.933 0.370 1.6e-77
TIGR_CMR|SPO_3471464 SPO_3471 "aminotransferase, cl 0.966 0.931 0.362 8.1e-76
TIGR_CMR|CPS_2025 CPS_2025 "aminotransferase, class III" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
 Score = 981 (350.4 bits), Expect = 8.2e-99, P = 8.2e-99
 Identities = 197/424 (46%), Positives = 275/424 (64%)

Query:    17 LVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTT 76
             L+IE+ +G+YVYD NGK+YL++LAGLWCT+LG +   L+  A+ Q++ L F H F  +T 
Sbjct:    17 LIIERGDGAYVYDSNGKQYLEALAGLWCTSLGYNNHELIETASEQMSKLSFSHMFGGKTH 76

Query:    77 KPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKS 136
             +  +DLA++L  M      AK+FF NSGS+ANDT +K++ YY NA+G+P K K IAR++S
Sbjct:    77 QVGIDLAEKLSAMVPVEN-AKIFFGNSGSDANDTHIKMLRYYFNAIGKPQKYKIIARERS 135

Query:   137 YHGSTLIAASLSGLPALHQKFDLP--APFVLHTDCPHYWRYAHPGETEEEYSTRLANNLE 194
             YHG T+ +ASL+GL   H  F+LP  A  VL TD PHY+R A P E+E ++  R+ NNLE
Sbjct:   136 YHGVTVASASLTGLKPNHTHFNLPFDALGVLRTDAPHYYRNALPNESEAQFIDRIVNNLE 195

Query:   195 DLILKEGPETIAAFIAEXXXXXXXXXXXXXTYFEKVQAVVKKYDILFIADEVICAFGRLG 254
              LIL EG +TIAAFI E              Y++KVQAV++KYDIL  ADEVI AFGR G
Sbjct:   196 QLILLEGADTIAAFIVEPITGASGVIVPPEGYYQKVQAVLQKYDILLWADEVITAFGRTG 255

Query:   255 TMFGCDKYSI-KPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSG 313
               FGC    I KP +++ AK LSSAYMPI A ++  ++ + +  QS  +G F HG+TYSG
Sbjct:   256 NDFGCKTVGIEKPAMMTLAKQLSSAYMPISASVIRGDMYDAMVEQSAQVGVFGHGYTYSG 315

Query:   314 HPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFAD 373
             HPVSCAVA++ L+IY+  NI +   KI    Q  +  F   P++GE+RG G+I   E   
Sbjct:   316 HPVSCAVALKTLEIYQRENIFDHAAKIGAYMQKRLHEFIHHPLVGEVRGKGMIGAIELVA 375

Query:   374 NKSPNEPFPPEWGIGAYFGAQCEKHGMLVR-VSGDNIMMSPPFIMSPEEVDELISKYGKA 432
             NK   + FP +  +G +    C+ +GM+ R V+G ++   PP I++  ++DE+I K  K+
Sbjct:   376 NKKTGQAFP-DGTVGNFAMQACQNNGMICRAVAGSSLAFCPPLIVNKSQIDEMIEKTAKS 434

Query:   433 LKAT 436
             L  T
Sbjct:   435 LDQT 438




GO:0003824 "catalytic activity" evidence=ISS
GO:0008152 "metabolic process" evidence=ISS
TIGR_CMR|SPO_1166 SPO_1166 "aminotransferase, class III family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q47V65 CPS_4663 "Aminotransferase, class III" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4663 CPS_4663 "aminotransferase, class III" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K448 PFL_5927 "Aminotransferase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q48CA6 PSPPH_4896 "Aminotransferase, class III" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1136 SPO_1136 "aminotransferase, class III" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q483I5 CPS_2054 "Aminotransferase, class III" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2054 CPS_2054 "aminotransferase, class III" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3471 SPO_3471 "aminotransferase, class III" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7GHM5BIOA_ANOFW2, ., 6, ., 1, ., 6, 20.30890.96190.9471yesno
Q7XN12GATP2_ORYSJ2, ., 6, ., 1, ., -0.77181.00.8993nono
Q7XN11GATP1_ORYSJ2, ., 6, ., 1, ., -0.85011.00.8662yesno
Q7MH19ARGD_VIBVY2, ., 6, ., 1, ., 1, 10.31000.82320.9131yesno
P33189YHXA_BACSU2, ., 6, ., -, ., -0.32850.89030.8844yesno
Q84P54GATP1_SOLLC2, ., 6, ., 1, ., -0.85681.00.8679N/Ano
Q84P52GATP3_SOLLC2, ., 6, ., 1, ., -0.86351.00.8596N/Ano
Q84P53GATP2_SOLLC2, ., 6, ., 1, ., -0.78070.99770.9737N/Ano
Q94CE5GATP_ARATH2, ., 6, ., 1, ., -0.85711.00.8869yesno
O94562YGD3_SCHPO2, ., 6, ., -, ., -0.32570.94630.9215yesno
B8BBZ7GATP3_ORYSI2, ., 6, ., 1, ., -0.82771.00.8764N/Ano
Q2FVJ6BIOA_STAA82, ., 6, ., 1, ., 6, 20.31130.95970.9491yesno
P59323ARGD_VIBVU2, ., 6, ., 1, ., 1, 10.31000.82320.9131yesno
Q6ZCF0GATP3_ORYSJ2, ., 6, ., 1, ., -0.82551.00.8764nono
Q6ZH29GATP4_ORYSJ2, ., 6, ., 1, ., -0.74771.00.9254nono
Q01K12GATP2_ORYSI2, ., 6, ., 1, ., -0.77181.00.8993N/Ano
Q01K11GATP1_ORYSI2, ., 6, ., 1, ., -0.84781.00.8662N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.6.10.766
4th Layer2.6.1.44LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
PLN02760504 PLN02760, PLN02760, 4-aminobutyrate:pyruvate trans 0.0
PRK06105460 PRK06105, PRK06105, aminotransferase; Provisional 0.0
COG0161449 COG0161, BioA, Adenosylmethionine-8-amino-7-oxonon 0.0
PRK07480456 PRK07480, PRK07480, putative aminotransferase; Val 1e-178
PRK07482461 PRK07482, PRK07482, hypothetical protein; Provisio 1e-171
cd00610413 cd00610, OAT_like, Acetyl ornithine aminotransfera 1e-145
PRK07036466 PRK07036, PRK07036, hypothetical protein; Provisio 1e-143
PRK07481449 PRK07481, PRK07481, hypothetical protein; Provisio 1e-127
PRK06541460 PRK06541, PRK06541, hypothetical protein; Provisio 1e-117
PRK09221445 PRK09221, PRK09221, beta alanine--pyruvate transam 1e-116
PRK12403460 PRK12403, PRK12403, putative aminotransferase; Pro 1e-113
PRK07483443 PRK07483, PRK07483, hypothetical protein; Provisio 1e-111
COG0160447 COG0160, GabT, 4-aminobutyrate aminotransferase an 1e-107
PRK05965459 PRK05965, PRK05965, hypothetical protein; Provisio 1e-107
TIGR00508417 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxon 1e-107
pfam00202338 pfam00202, Aminotran_3, Aminotransferase class-III 1e-103
PRK07678451 PRK07678, PRK07678, aminotransferase; Validated 1e-103
PRK13360442 PRK13360, PRK13360, omega amino acid--pyruvate tra 1e-100
PRK06917447 PRK06917, PRK06917, hypothetical protein; Provisio 1e-100
COG4992404 COG4992, ArgD, Ornithine/acetylornithine aminotran 1e-96
PRK06916460 PRK06916, PRK06916, adenosylmethionine--8-amino-7- 1e-94
PRK02627396 PRK02627, PRK02627, acetylornithine aminotransfera 1e-93
PRK06062451 PRK06062, PRK06062, hypothetical protein; Provisio 2e-93
PRK05769441 PRK05769, PRK05769, 4-aminobutyrate aminotransfera 9e-82
TIGR00707379 TIGR00707, argD, transaminase, acetylornithine/suc 1e-80
PTZ00125400 PTZ00125, PTZ00125, ornithine aminotransferase-lik 6e-78
PRK07030466 PRK07030, PRK07030, adenosylmethionine--8-amino-7- 3e-77
PRK05964423 PRK05964, PRK05964, adenosylmethionine--8-amino-7- 1e-74
PRK08117433 PRK08117, PRK08117, 4-aminobutyrate aminotransfera 1e-72
TIGR01885401 TIGR01885, Orn_aminotrans, ornithine aminotransfer 1e-68
PRK03244398 PRK03244, argD, acetylornithine aminotransferase; 2e-67
PRK01278389 PRK01278, argD, acetylornithine transaminase prote 1e-64
PRK08742472 PRK08742, PRK08742, adenosylmethionine--8-amino-7- 2e-62
PRK08360443 PRK08360, PRK08360, 4-aminobutyrate aminotransfera 4e-61
PRK11522459 PRK11522, PRK11522, putrescine--2-oxoglutarate ami 2e-60
PRK02936377 PRK02936, argD, acetylornithine aminotransferase; 9e-60
PRK05093403 PRK05093, argD, bifunctional N-succinyldiaminopime 9e-59
TIGR03246397 TIGR03246, arg_catab_astC, succinylornithine trans 3e-57
PRK08593445 PRK08593, PRK08593, 4-aminobutyrate aminotransfera 2e-56
PRK06943453 PRK06943, PRK06943, adenosylmethionine--8-amino-7- 4e-55
PLN02624474 PLN02624, PLN02624, ornithine-delta-aminotransfera 1e-54
PRK04612408 PRK04612, argD, acetylornithine transaminase prote 2e-54
PRK05630422 PRK05630, PRK05630, adenosylmethionine--8-amino-7- 3e-54
PRK04073396 PRK04073, rocD, ornithine--oxo-acid transaminase; 2e-52
PRK12381406 PRK12381, PRK12381, bifunctional succinylornithine 2e-51
PLN00144382 PLN00144, PLN00144, acetylornithine transaminase 8e-51
TIGR00700420 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransf 2e-50
PRK06082459 PRK06082, PRK06082, 4-aminobutyrate aminotransfera 5e-50
PRK06173429 PRK06173, PRK06173, adenosylmethionine--8-amino-7- 1e-49
PRK00854401 PRK00854, rocD, ornithine--oxo-acid transaminase; 3e-49
COG0001432 COG0001, HemL, Glutamate-1-semialdehyde aminotrans 4e-49
PRK07986428 PRK07986, PRK07986, adenosylmethionine--8-amino-7- 4e-47
TIGR03372442 TIGR03372, putres_am_tran, putrescine aminotransfe 1e-46
PRK06918451 PRK06918, PRK06918, 4-aminobutyrate aminotransfera 1e-46
TIGR00709442 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminase 6e-46
PRK06931459 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarat 1e-42
PRK06149972 PRK06149, PRK06149, hypothetical protein; Provisio 2e-42
PRK08088425 PRK08088, PRK08088, 4-aminobutyrate aminotransfera 3e-42
PRK04260375 PRK04260, PRK04260, acetylornithine aminotransfera 4e-42
PRK03715395 PRK03715, argD, acetylornithine transaminase prote 1e-41
PRK06938464 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarat 9e-41
PRK06058443 PRK06058, PRK06058, 4-aminobutyrate aminotransfera 4e-40
PRK05639457 PRK05639, PRK05639, 4-aminobutyrate aminotransfera 9e-40
PRK07495425 PRK07495, PRK07495, 4-aminobutyrate aminotransfera 1e-37
TIGR00713423 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-amin 4e-37
PRK061481013 PRK06148, PRK06148, hypothetical protein; Provisio 9e-37
PRK06777421 PRK06777, PRK06777, 4-aminobutyrate aminotransfera 4e-36
PRK00062426 PRK00062, PRK00062, glutamate-1-semialdehyde amino 1e-31
TIGR02407412 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglu 2e-30
PRK04013364 PRK04013, argD, acetylornithine/acetyl-lysine amin 7e-30
PRK09792421 PRK09792, PRK09792, 4-aminobutyrate transaminase; 7e-30
PRK12389428 PRK12389, PRK12389, glutamate-1-semialdehyde amino 4e-25
PRK09264425 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarat 1e-23
PRK06209431 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-a 3e-23
PRK08297443 PRK08297, PRK08297, L-lysine aminotransferase; Pro 3e-23
TIGR03251431 TIGR03251, LAT_fam, L-lysine 6-transaminase 3e-20
PLN02482474 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-a 4e-20
PLN02974817 PLN02974, PLN02974, adenosylmethionine-8-amino-7-o 1e-19
TIGR00699464 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotran 9e-19
PRK00615433 PRK00615, PRK00615, glutamate-1-semialdehyde amino 1e-15
PRK07046453 PRK07046, PRK07046, aminotransferase; Validated 3e-06
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 3e-04
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 0.001
>gnl|CDD|215405 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
 Score =  978 bits (2530), Expect = 0.0
 Identities = 401/447 (89%), Positives = 428/447 (95%)

Query: 1   MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATA 60
           MLAPFTAGWQSTD+ PLVIEKSEGSYVYD+NGKKYLD+LAGLWCTALGGSEPRLVAAAT 
Sbjct: 57  MLAPFTAGWQSTDLEPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGSEPRLVAAATE 116

Query: 61  QLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNN 120
           QLN LPFYHSFWNRTTKPSLDLAKELLEMFTA KM KVFFTNSGSEANDTQVKLVWYYNN
Sbjct: 117 QLNKLPFYHSFWNRTTKPSLDLAKELLEMFTARKMGKVFFTNSGSEANDTQVKLVWYYNN 176

Query: 121 ALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGE 180
           ALGRPNKKKFIAR KSYHGSTLI+ASLSGLPALHQKFDLPAPFVLHTDCPHYWR+  PGE
Sbjct: 177 ALGRPNKKKFIARSKSYHGSTLISASLSGLPALHQKFDLPAPFVLHTDCPHYWRFHLPGE 236

Query: 181 TEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDIL 240
           TEEE+STRLA+NLE+LILKEGPETIAAFIAEPV+GAGGVIPPPATYFEK+QAV+KKYDIL
Sbjct: 237 TEEEFSTRLADNLENLILKEGPETIAAFIAEPVMGAGGVIPPPATYFEKIQAVLKKYDIL 296

Query: 241 FIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSN 300
           FIADEVICAFGRLGTMFGCDKY+IKPDLVS AKALSSAYMPIGA+LVSPE+S+VIHSQSN
Sbjct: 297 FIADEVICAFGRLGTMFGCDKYNIKPDLVSLAKALSSAYMPIGAVLVSPEISDVIHSQSN 356

Query: 301 TLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEI 360
            LGSF+HGFTYSGHPVSCAVA+EALKIYKERNI E VNKIAP+FQDG+KAFS SPIIGEI
Sbjct: 357 KLGSFAHGFTYSGHPVSCAVALEALKIYKERNIPEHVNKIAPRFQDGIKAFSGSPIIGEI 416

Query: 361 RGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPE 420
           RGTGLILGTEF DNKSPN+PFP EWG+GAYFGA+C+K GMLVRV+GDNIMMSPP I++PE
Sbjct: 417 RGTGLILGTEFVDNKSPNDPFPAEWGVGAYFGAECKKRGMLVRVAGDNIMMSPPLIITPE 476

Query: 421 EVDELISKYGKALKATEERVKELKSQQ 447
           EVDELIS YGKALKATEERV ELKSQ+
Sbjct: 477 EVDELISIYGKALKATEERVAELKSQK 503


Length = 504

>gnl|CDD|180401 PRK06105, PRK06105, aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|223239 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180994 PRK07480, PRK07480, putative aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|236026 PRK07482, PRK07482, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family Back     alignment and domain information
>gnl|CDD|235913 PRK07036, PRK07036, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168967 PRK07481, PRK07481, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235823 PRK06541, PRK06541, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181707 PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|171472 PRK12403, PRK12403, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236027 PRK07483, PRK07483, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180330 PRK05965, PRK05965, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233000 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|201078 pfam00202, Aminotran_3, Aminotransferase class-III Back     alignment and domain information
>gnl|CDD|181078 PRK07678, PRK07678, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|235884 PRK06917, PRK06917, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227325 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|235056 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235687 PRK06062, PRK06062, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235599 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|233098 TIGR00707, argD, transaminase, acetylornithine/succinylornithine family Back     alignment and domain information
>gnl|CDD|240281 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|180800 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|235656 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase Back     alignment and domain information
>gnl|CDD|235112 PRK03244, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|236336 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179933 PRK05093, argD, bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>gnl|CDD|132290 TIGR03246, arg_catab_astC, succinylornithine transaminase family Back     alignment and domain information
>gnl|CDD|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235894 PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|215335 PLN02624, PLN02624, ornithine-delta-aminotransferase Back     alignment and domain information
>gnl|CDD|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|180174 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|179736 PRK04073, rocD, ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>gnl|CDD|183486 PRK12381, PRK12381, bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase Back     alignment and domain information
>gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>gnl|CDD|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180441 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|234848 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>gnl|CDD|223080 COG0001, HemL, Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181189 PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>gnl|CDD|132415 TIGR03372, putres_am_tran, putrescine aminotransferase Back     alignment and domain information
>gnl|CDD|235885 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>gnl|CDD|235889 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235716 PRK06149, PRK06149, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236149 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|235892 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235685 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236032 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|233100 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|234607 PRK00062, PRK00062, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|233853 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>gnl|CDD|101376 PRK04013, argD, acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|183493 PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180471 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>gnl|CDD|236224 PRK08297, PRK08297, L-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase Back     alignment and domain information
>gnl|CDD|178100 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>gnl|CDD|215526 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|129782 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>gnl|CDD|234803 PRK00615, PRK00615, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235917 PRK07046, PRK07046, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 447
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 100.0
PLN02760504 4-aminobutyrate:pyruvate transaminase 100.0
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 100.0
COG0160447 GabT 4-aminobutyrate aminotransferase and related 100.0
PRK07481449 hypothetical protein; Provisional 100.0
PRK07482461 hypothetical protein; Provisional 100.0
PRK05965459 hypothetical protein; Provisional 100.0
PRK06105460 aminotransferase; Provisional 100.0
PRK07036466 hypothetical protein; Provisional 100.0
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 100.0
PRK07480456 putative aminotransferase; Validated 100.0
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK12403460 putative aminotransferase; Provisional 100.0
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK07483443 hypothetical protein; Provisional 100.0
PRK07678451 aminotransferase; Validated 100.0
PRK06062451 hypothetical protein; Provisional 100.0
PRK06541460 hypothetical protein; Provisional 100.0
PRK13360442 omega amino acid--pyruvate transaminase; Provision 100.0
PRK09221445 beta alanine--pyruvate transaminase; Provisional 100.0
PRK06917447 hypothetical protein; Provisional 100.0
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 100.0
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 100.0
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 100.0
PRK06082459 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 100.0
PRK05639457 4-aminobutyrate aminotransferase; Provisional 100.0
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 100.0
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK06058443 4-aminobutyrate aminotransferase; Provisional 100.0
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 100.0
PRK08593445 4-aminobutyrate aminotransferase; Provisional 100.0
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 100.0
PRK05769441 4-aminobutyrate aminotransferase; Provisional 100.0
PRK07495425 4-aminobutyrate aminotransferase; Provisional 100.0
PRK04612408 argD acetylornithine transaminase protein; Provisi 100.0
PRK08117433 4-aminobutyrate aminotransferase; Provisional 100.0
PRK08360443 4-aminobutyrate aminotransferase; Provisional 100.0
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 100.0
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 100.0
PRK06777421 4-aminobutyrate aminotransferase; Provisional 100.0
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 100.0
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 100.0
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 100.0
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 100.0
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 100.0
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 100.0
PRK08297443 L-lysine aminotransferase; Provisional 100.0
PRK09792421 4-aminobutyrate transaminase; Provisional 100.0
KOG1401433 consensus Acetylornithine aminotransferase [Amino 100.0
PRK061481013 hypothetical protein; Provisional 100.0
PRK03715395 argD acetylornithine transaminase protein; Provisi 100.0
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 100.0
PRK12381406 bifunctional succinylornithine transaminase/acetyl 100.0
PLN00144382 acetylornithine transaminase 100.0
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 100.0
PLN02624474 ornithine-delta-aminotransferase 100.0
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 100.0
PRK07046453 aminotransferase; Validated 100.0
PRK06149972 hypothetical protein; Provisional 100.0
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 100.0
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 100.0
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 100.0
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 100.0
PRK01278389 argD acetylornithine transaminase protein; Provisi 100.0
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 100.0
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 100.0
PRK03244398 argD acetylornithine aminotransferase; Provisional 100.0
PRK08088425 4-aminobutyrate aminotransferase; Validated 100.0
PRK02936377 argD acetylornithine aminotransferase; Provisional 100.0
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 100.0
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 100.0
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 100.0
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 100.0
PTZ00125400 ornithine aminotransferase-like protein; Provision 100.0
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 100.0
PRK04260375 acetylornithine aminotransferase; Provisional 100.0
PRK02627396 acetylornithine aminotransferase; Provisional 100.0
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 100.0
TIGR00707379 argD acetylornithine and succinylornithine aminotr 100.0
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 100.0
PRK07505402 hypothetical protein; Provisional 100.0
PLN02822481 serine palmitoyltransferase 100.0
PRK13393406 5-aminolevulinate synthase; Provisional 100.0
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 100.0
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 100.0
PRK09064407 5-aminolevulinate synthase; Validated 100.0
PLN02955476 8-amino-7-oxononanoate synthase 100.0
PRK07179407 hypothetical protein; Provisional 100.0
PLN03227392 serine palmitoyltransferase-like protein; Provisio 100.0
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.98
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.97
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.97
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.97
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.97
PRK13392410 5-aminolevulinate synthase; Provisional 99.97
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.96
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.96
PLN02483489 serine palmitoyltransferase 99.96
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.95
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.94
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.94
PRK06225380 aspartate aminotransferase; Provisional 99.93
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.93
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.92
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.92
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.91
PRK07682378 hypothetical protein; Validated 99.91
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.91
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.91
PRK07324373 transaminase; Validated 99.91
PRK06207405 aspartate aminotransferase; Provisional 99.91
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.91
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.91
PRK06108382 aspartate aminotransferase; Provisional 99.91
PLN00175413 aminotransferase family protein; Provisional 99.9
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.9
PRK09148405 aminotransferase; Validated 99.9
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.9
PRK08960387 hypothetical protein; Provisional 99.9
PRK07681399 aspartate aminotransferase; Provisional 99.9
PRK07309391 aromatic amino acid aminotransferase; Validated 99.9
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.89
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.89
PRK05764393 aspartate aminotransferase; Provisional 99.89
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.89
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.89
PRK08363398 alanine aminotransferase; Validated 99.89
PRK08636403 aspartate aminotransferase; Provisional 99.89
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.89
PRK06348384 aspartate aminotransferase; Provisional 99.89
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.89
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.89
PRK06290410 aspartate aminotransferase; Provisional 99.89
PRK08068389 transaminase; Reviewed 99.88
PRK12414384 putative aminotransferase; Provisional 99.88
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.88
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.88
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.88
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.88
PLN02656409 tyrosine transaminase 99.88
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.88
PLN02721353 threonine aldolase 99.88
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.88
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.88
PRK08175395 aminotransferase; Validated 99.88
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.88
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.88
PRK13520371 L-tyrosine decarboxylase; Provisional 99.88
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.88
PRK09082386 methionine aminotransferase; Validated 99.88
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.88
PLN02187462 rooty/superroot1 99.88
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.87
PRK09105370 putative aminotransferase; Provisional 99.87
PRK07337388 aminotransferase; Validated 99.87
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.87
PRK07683387 aminotransferase A; Validated 99.87
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.87
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.87
PRK06107402 aspartate aminotransferase; Provisional 99.87
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.87
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.87
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.87
PRK05942394 aspartate aminotransferase; Provisional 99.87
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.87
PRK07777387 aminotransferase; Validated 99.87
PRK08361391 aspartate aminotransferase; Provisional 99.87
PRK07568397 aspartate aminotransferase; Provisional 99.87
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 99.87
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.87
PRK08912387 hypothetical protein; Provisional 99.87
PTZ00433412 tyrosine aminotransferase; Provisional 99.86
PRK05957389 aspartate aminotransferase; Provisional 99.86
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.86
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.86
PTZ00377481 alanine aminotransferase; Provisional 99.86
PRK05839374 hypothetical protein; Provisional 99.86
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.86
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.86
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.86
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.86
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.86
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.86
PRK07550386 hypothetical protein; Provisional 99.86
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.86
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.86
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.86
PRK02948381 cysteine desulfurase; Provisional 99.85
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.85
PRK06855433 aminotransferase; Validated 99.85
PRK03321352 putative aminotransferase; Provisional 99.85
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.85
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.85
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.85
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.85
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.85
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.84
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.84
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.84
PLN02231534 alanine transaminase 99.84
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.84
PRK09265404 aminotransferase AlaT; Validated 99.84
PLN026721082 methionine S-methyltransferase 99.84
TIGR01814406 kynureninase kynureninase. This model describes ky 99.84
PRK08354311 putative aminotransferase; Provisional 99.83
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.83
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.83
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.83
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.83
PRK10534333 L-threonine aldolase; Provisional 99.83
PRK06836394 aspartate aminotransferase; Provisional 99.83
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.83
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.83
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.82
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.82
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.82
PRK07392360 threonine-phosphate decarboxylase; Validated 99.82
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.82
PTZ00376404 aspartate aminotransferase; Provisional 99.82
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.82
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 99.82
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.82
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 99.82
PLN02409401 serine--glyoxylate aminotransaminase 99.82
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.81
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.81
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.81
PRK07908349 hypothetical protein; Provisional 99.81
PLN02651364 cysteine desulfurase 99.8
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.8
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.8
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.8
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.79
PRK09275527 aspartate aminotransferase; Provisional 99.79
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.79
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.78
PLN02397423 aspartate transaminase 99.78
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.77
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.77
PRK08637388 hypothetical protein; Provisional 99.77
PRK14012404 cysteine desulfurase; Provisional 99.76
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.76
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.76
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.76
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.75
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.75
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.75
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.74
PLN02368407 alanine transaminase 99.73
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.73
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.72
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.72
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.72
PRK13580493 serine hydroxymethyltransferase; Provisional 99.71
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.71
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.71
PRK03080378 phosphoserine aminotransferase; Provisional 99.71
PLN03226475 serine hydroxymethyltransferase; Provisional 99.7
PLN02242418 methionine gamma-lyase 99.7
PRK06767386 methionine gamma-lyase; Provisional 99.68
PLN02414993 glycine dehydrogenase (decarboxylating) 99.68
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.68
PRK02769380 histidine decarboxylase; Provisional 99.67
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 99.67
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.66
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.66
PLN03032374 serine decarboxylase; Provisional 99.65
PRK08249398 cystathionine gamma-synthase; Provisional 99.65
PRK12566954 glycine dehydrogenase; Provisional 99.64
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.63
PRK05367954 glycine dehydrogenase; Provisional 99.63
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.63
PRK06234400 methionine gamma-lyase; Provisional 99.63
PRK06460376 hypothetical protein; Provisional 99.62
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.61
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.61
PRK07049427 methionine gamma-lyase; Validated 99.6
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.6
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.6
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.59
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.59
PRK08247366 cystathionine gamma-synthase; Reviewed 99.59
PRK07582366 cystathionine gamma-lyase; Validated 99.59
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.59
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.58
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.58
PRK08776405 cystathionine gamma-synthase; Provisional 99.58
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.58
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.57
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.57
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.57
PRK05968389 hypothetical protein; Provisional 99.57
PRK07503403 methionine gamma-lyase; Provisional 99.56
PRK08045386 cystathionine gamma-synthase; Provisional 99.56
PRK08861388 cystathionine gamma-synthase; Provisional 99.55
PRK08574385 cystathionine gamma-synthase; Provisional 99.55
PRK07811388 cystathionine gamma-synthase; Provisional 99.55
PLN02880490 tyrosine decarboxylase 99.55
PRK13237460 tyrosine phenol-lyase; Provisional 99.53
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.53
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.52
PRK07269364 cystathionine gamma-synthase; Reviewed 99.52
PLN02724 805 Molybdenum cofactor sulfurase 99.52
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.52
PRK09028394 cystathionine beta-lyase; Provisional 99.52
PRK07050394 cystathionine beta-lyase; Provisional 99.51
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.51
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.5
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.5
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.5
PLN02509464 cystathionine beta-lyase 99.5
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.5
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.5
PLN02263470 serine decarboxylase 99.5
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.49
PLN02590539 probable tyrosine decarboxylase 99.48
PRK08064390 cystathionine beta-lyase; Provisional 99.47
PRK04311464 selenocysteine synthase; Provisional 99.47
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.46
KOG0633375 consensus Histidinol phosphate aminotransferase [A 99.46
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.46
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.46
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.45
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.45
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.44
PRK07671377 cystathionine beta-lyase; Provisional 99.44
PRK05967395 cystathionine beta-lyase; Provisional 99.44
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.43
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.42
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.42
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.42
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.41
PRK05939397 hypothetical protein; Provisional 99.4
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.4
KOG0634472 consensus Aromatic amino acid aminotransferase and 99.39
PRK08114395 cystathionine beta-lyase; Provisional 99.38
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.33
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.32
PLN02271586 serine hydroxymethyltransferase 99.31
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.28
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.28
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.27
PRK06434384 cystathionine gamma-lyase; Validated 99.27
PLN02452365 phosphoserine transaminase 99.23
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.2
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.18
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.16
PRK12462364 phosphoserine aminotransferase; Provisional 99.14
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.12
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.07
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.05
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.04
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 99.04
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.04
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.0
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.0
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.0
PRK15029 755 arginine decarboxylase; Provisional 98.99
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 98.95
PRK05367 954 glycine dehydrogenase; Provisional 98.95
PRK13578 720 ornithine decarboxylase; Provisional 98.88
PRK15399 713 lysine decarboxylase LdcC; Provisional 98.87
PRK15400 714 lysine decarboxylase CadA; Provisional 98.76
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 98.74
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 98.69
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 98.6
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 98.6
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 98.46
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.33
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 98.31
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 98.3
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 98.27
KOG0629510 consensus Glutamate decarboxylase and related prot 98.25
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 98.19
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 98.12
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.11
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 98.07
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 98.04
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 97.97
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 97.92
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 97.79
PRK12566 954 glycine dehydrogenase; Provisional 97.45
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 97.16
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 95.62
KOG3843432 consensus Predicted serine hydroxymethyltransferas 95.61
COG4100416 Cystathionine beta-lyase family protein involved i 95.11
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 92.34
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
Probab=100.00  E-value=4.1e-83  Score=604.03  Aligned_cols=432  Identities=41%  Similarity=0.748  Sum_probs=397.4

Q ss_pred             CCCCCCcCccCCCCCCeEEEEecCcEEEeCCCCEEEecCCccccccCCCCCHHHHHHHHHHHhcCCcccccCcCCChHHH
Q 013204            1 MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSL   80 (447)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~g~~~~d~dg~~~lD~~~~~~~~~lG~~~p~v~~a~~~~~~~~~~~~~~~~~~~~~~~   80 (447)
                      +||||+++...... |.++++++|.|++|.|||+|||.+|++|++++||+||+|.+|+.+|++++.+++. +...+.+..
T Consensus        13 ~whP~t~~~~~~~~-~~~i~~aeG~yl~d~~G~r~lDg~sg~W~~~~Gh~~~~i~~Ai~~Q~~~l~~~~~-~~~t~~Pa~   90 (449)
T COG0161          13 LWHPFTQMRDPLAE-PRVIVRAEGVYLTDIDGRRYLDGMSGLWCVNHGHGRPEIAEAIKKQLDKLPHVMF-GGFTHEPAI   90 (449)
T ss_pred             eecccccccccccc-ceeeeecceeEEEeCCCCEEEecccHHHHhhcCcCCHHHHHHHHHHHHhCCchhh-cccCCchHH
Confidence            69999999988555 9999999999999999999999999999999999999999999999999887654 345777799


Q ss_pred             HHHHHHHHhcCcCCCCeEEEeCChhhHHHHHHHHHHHHHHhcCCCCcceEEEEcCCCccchhhhhcccCCcc-ccCCCCC
Q 013204           81 DLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPA-LHQKFDL  159 (447)
Q Consensus        81 ~l~~~l~~~~~~~~~~~v~~~~sGseA~~~Al~~~~~~~~~~~~~~~~~vi~~~~~yhg~~~~~~~~~~~~~-~~~~~~~  159 (447)
                      +|+++|+++.++.++++|+|++|||+|||.|+|++++|++.+|+++++++|...++|||.+.++++++|... ++..+..
T Consensus        91 ~LA~~L~~~aP~~~l~~vFf~~sGSeAvEtAlKma~qY~~~~G~p~r~~~Isr~~gYHG~T~ga~Sv~g~~~~~~~~~~~  170 (449)
T COG0161          91 ELAEKLAELAPEGGLDHVFFTDSGSEAVETALKMALQYWRARGQPQRKKFISRRNGYHGDTLGAMSVGGPVALRHAFYDP  170 (449)
T ss_pred             HHHHHHHHhCCCCCccEEEEeCCchHHHHHHHHHHHHHHHhcCCCcceEEEEeccCcCcccchheeccCchhhhhhhccc
Confidence            999999999865569999999999999999999999999999999999999999999999999999999544 4466677


Q ss_pred             CCCcceecCCCCcccCCCCCCChhHHHHHHHHHHHHHHHhhCCCcEEEEEEccccCC-CCCccCChhHHHHHHHHHHhcC
Q 013204          160 PAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGA-GGVIPPPATYFEKVQAVVKKYD  238 (447)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~l~~~~~~~~a~vi~epv~~~-~G~~~~~~~~l~~l~~l~~~~g  238 (447)
                      +.+...+++.|..|+.....+..+.+ ..++++||+++...++++++++|+||+.+. ||+++|++.||++++++|++||
T Consensus       171 ll~~~~~~~~P~~y~~~~~~~~~~~~-~~~a~~le~~i~~~g~~~IAAfI~EPv~g~agG~~~pp~~Yl~~vr~iC~ky~  249 (449)
T COG0161         171 LLPEVLHLPAPYAYRRGFFGEGDEEF-AEAADELEALILEHGPETIAAFIVEPVVGGAGGMLVPPPGYLKRVREICDKYG  249 (449)
T ss_pred             cccCceecCCCcccccCCCCCChHHH-HHHHHHHHHHHHhcCcccEEEEEecccccccCCcccCChHHHHHHHHHHHHcC
Confidence            77778899999888766666777777 788899999999999899999999998766 9999999999999999999999


Q ss_pred             CEEEEehhhcCCCccccccccccCCCCCCeeeecccCCCcccceeEEEeChhHHHHhhhccCCCCccCcCCCCCCcHHHH
Q 013204          239 ILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSC  318 (447)
Q Consensus       239 ~~li~DEv~~g~g~~g~~~~~~~~~~~~d~v~~sK~l~gg~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~  318 (447)
                      ++||+|||.|||||+|+.|+++++++.||++|++|+++|||+|+|+++.++++.+.+....  .+.|.|+.||++||++|
T Consensus       250 ILlI~DEV~tGFGRTG~~FA~e~~gi~PDi~~~aKGLT~GY~Pl~a~l~~~~I~~~~~~~~--~~~f~HG~TYsghPlac  327 (449)
T COG0161         250 ILLIADEVATGFGRTGKMFACEHAGIVPDILCLAKGLTGGYLPLSAVLTSDRIYEAFSDGD--AGAFMHGHTYSGNPLAC  327 (449)
T ss_pred             cEEEeecceeCCCcCchhhhhhhcCCCCCeeeecccccccchhhHhHhhhHHHHHHHhccc--CCeeccCCccccCHHHH
Confidence            9999999999999999999999999999999999999999999999999999999998654  67899999999999999


Q ss_pred             HHHHHHHHHHhhhcHHHHHHHHHHHHHHhHhh-ccCCCceeeEeeeeeEEEEEeecCCCCCCCCCCCcchHHHHHHHHHH
Q 013204          319 AVAIEALKIYKERNIVEQVNKIAPKFQDGVKA-FSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEK  397 (447)
Q Consensus       319 ~aa~a~l~~~~~~~~~~~~~~~~~~l~~~L~~-l~~~~~~~~~~~~g~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~l~~  397 (447)
                      ++|++.|++++++++.+++++++.+|.+.|+. +.+++.+.++++.|++.++++..+..++.+|  ..+....+...+++
T Consensus       328 AaAla~L~i~e~e~l~~~~~~~~~~l~~~L~~~l~~~p~VgdVR~~Gli~~iElv~d~~t~~~f--~~~~~~~~~~~~~e  405 (449)
T COG0161         328 AAALANLDILEEEDLLERVAEIGAYLQAGLQAALADHPLVGDVRGLGLIGAIELVADKATKTPF--EARVGARVRAAALE  405 (449)
T ss_pred             HHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhcccCCcEEEeeccceEEEEEEecccccccch--hhhHHHHHHHHHHH
Confidence            99999999999999999999999999999998 5778999999999999999999988888777  44567778899999


Q ss_pred             cCceEEeeCCEEEEecCCCCCHHHHHHHHHHHHHHHHHHHHH
Q 013204          398 HGMLVRVSGDNIMMSPPFIMSPEEVDELISKYGKALKATEER  439 (447)
Q Consensus       398 ~Gi~~~~~g~~iR~~~~~~~t~e~i~~~~~~l~~~l~~~~~~  439 (447)
                      +|++++|.|+.+-++||+++|++||+++++++.+++++..++
T Consensus       406 ~Gl~iRp~g~~i~~~PPliit~~eid~l~~~l~~al~~~~~~  447 (449)
T COG0161         406 RGLLIRPLGDVIYLMPPLIITREEIDELVDALREALDETLAD  447 (449)
T ss_pred             CCeEEeecCCEEEEcCCccCCHHHHHHHHHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999876543



>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
3nui_A478 Crystal Structure Of Omega-Transferase From Vibrio 2e-96
4grx_A465 Structure Of An Omega-Aminotransferase From Paracoc 5e-96
4e3q_A473 Pmp-Bound Form Of Aminotransferase Crystal Structur 4e-94
4e3r_A473 Plp-Bound Aminotransferase Mutant Crystal Structure 2e-92
3gju_A459 Crystal Structure Of A Putative Aminotransferase (M 2e-89
3fcr_A459 Crystal Structure Of Putative Aminotransferase (Yp_ 2e-84
3hmu_A472 Crystal Structure Of A Class Iii Aminotransferase F 2e-82
4a6r_A459 Crystal Structure Of The Omega Transaminase From Ch 2e-78
3i5t_A476 Crystal Structure Of Aminotransferase Prk07036 From 3e-64
3du4_A448 Crystal Structure Of 7-Keto-8-Aminopelargonic Acid 1e-60
3dod_A448 Crystal Structure Of Plp Bound 7,8-diaminopelargoni 1e-60
3n5m_A452 Crystals Structure Of A Bacillus Anthracis Aminotra 1e-59
3a8u_X449 Crystal Structure Of Omega-Amino Acid:pyruvate Amin 2e-50
3i4j_A430 Crystal Structure Of Aminotransferase, Class Iii Fr 4e-43
2eo5_A419 Crystal Structure Of 4-Aminobutyrate Aminotransfera 2e-41
3lg0_A422 Structure Of Plasmodium Falciparum Ornithine Delta- 3e-39
2e54_A385 Crystal Structure Of Acetylornithine Aminotransfera 9e-39
1d7r_A433 Crystal Structure Of The Complex Of 2,2-Dialkylglyc 2e-38
1dgd_A432 An Alkali Metal Ion Size-Dependent Switch In The Ac 2e-38
1z3z_A431 The Crystal Structure Of A Dgd Mutant: Q52a Length 3e-38
2ord_A397 Crystal Structure Of Acetylornithine Aminotransfera 3e-38
1m0n_A433 Structure Of Dialkylglycine Decarboxylase Complexed 3e-38
2pb0_A420 Structure Of Biosynthetic N-Acetylornithine Aminotr 1e-37
1z7d_A433 Ornithine Aminotransferase Py00104 From Plasmodium 1e-37
2eh6_A375 Crystal Structure Of Acetylornithine Aminotransfera 7e-37
1szk_A426 The Structure Of Gamma-Aminobutyrate Aminotransfera 2e-36
1sf2_A426 Structure Of E. Coli Gamma-Aminobutyrate Aminotrans 2e-36
1szs_A426 The Structure Of Gamma-aminobutyrate Aminotransfera 5e-36
1szu_A426 The Structure Of Gamma-Aminobutyrate Aminotransfera 7e-36
4adb_A406 Structural And Functional Study Of Succinyl-ornithi 1e-35
3ruy_A392 Crystal Structure Of The Ornithine-Oxo Acid Transam 4e-35
3nx3_A395 Crystal Structure Of Acetylornithine Aminotransfera 6e-33
1qj3_A429 Crystal Structure Of 7,8-Diaminopelargonic Acid Syn 1e-32
1s0a_A429 Crystal Structure Of The Y17f Mutant Of 7,8- Diamin 2e-32
1dty_A429 Crystal Structure Of Adenosylmethionine-8-Amino-7-O 3e-32
1s08_A429 Crystal Structure Of The D147n Mutant Of 7,8- Diami 4e-32
1s07_A429 Crystal Structure Of The R253a Mutant Of 7,8-Diamin 7e-32
1mgv_A429 Crystal Structure Of The R391a Mutant Of 7,8-Diamin 7e-32
2byj_A439 Ornithine Aminotransferase Mutant Y85i Length = 439 1e-31
1s09_A429 Crystal Structure Of The Y144f Mutant Of 7,8- Diami 1e-31
1s06_A429 Crystal Structure Of The R253k Mutant Of 7,8- Diami 1e-31
2can_A402 Human Ornithine Aminotransferase Complexed With L-C 2e-31
1oat_A439 Ornithine Aminotransferase Length = 439 3e-31
2byl_A439 Structure Of Ornithine Aminotransferase Triple Muta 1e-30
1vef_A395 Acetylornithine Aminotransferase From Thermus Therm 9e-30
3tft_A457 Crystal Structure Of 7,8-Diaminopelargonic Acid Syn 9e-30
3lv2_A462 Crystal Structure Of Mycobacterium Tuberculosis 7,8 8e-29
3bv0_A437 Crystal Structure Of Plp Bound 7,8-Diaminopelargoni 9e-29
3r4t_A467 Crystal Structure Of 4-Aminobutyrate Aminotransfera 3e-27
4ffc_A453 Crystal Structure Of A 4-Aminobutyrate Aminotransfe 1e-26
3oks_A451 Crystal Structure Of 4-Aminobutyrate Transaminase F 2e-25
4atp_A456 Structure Of Gaba-Transaminase A1r958 From Arthroba 2e-20
3q8n_A453 Crystal Structure Of 4-Aminobutyrate Transaminase F 1e-19
3l44_A434 Crystal Structure Of Bacillus Anthracis Heml-1, Glu 4e-18
3fqa_A427 Gabaculien Complex Of Gabaculine Resistant Gsam Ver 6e-16
2cfb_A411 Glutamate-1-Semialdehyde 2,1-Aminomutase From Therm 7e-16
3fq8_A427 M248i Mutant Of Gsam Length = 427 1e-15
2gsa_A432 Crystal Structure Of Glutamate-1-Semialdehyde Amino 1e-15
3fq7_A427 Gabaculine Complex Of Gsam Length = 427 3e-15
2hoy_A432 Inter-Subunit Signaling In Gsam Length = 432 3e-15
2zuk_A439 The Crystal Structure Of Alpha-Amino-Epsilon-Caprol 3e-15
3dxw_A452 The Crystal Structure Of Alpha-Amino-Epsilon-Caprol 5e-15
2epj_A434 Crystal Structure Of Glutamate-1-Semialdehyde 2,1-A 2e-14
2e7u_A424 Crystal Structure Of Glutamate-1-Semialdehyde 2,1-A 3e-14
3bs8_A438 Crystal Structure Of Glutamate 1-Semialdehyde Amino 4e-14
4e77_A429 2.0a Crystal Structure Of A Glutamate-1-Semialdehyd 8e-14
3k28_A429 Crystal Structure Of A Glutamate-1-Semialdehyde Ami 1e-12
2cy8_A453 Crystal Structure Of D-Phenylglycine Aminotransfera 1e-11
4a0g_A831 Structure Of Bifunctional Dapa Aminotransferase-Dtb 2e-11
4a0f_A831 Structure Of Selenomethionine Substituted Bifunctio 7e-11
2cin_A449 Lysine Aminotransferase From M. Tuberculosis In The 9e-11
2jjf_A449 N328a Mutant Of M. Tuberculosis Rv3290c Length = 44 1e-10
2jjh_A449 E243 Mutant Of M. Tuberculosis Rv3290c Length = 449 1e-10
2jje_A449 Crystal Structure Of T330s Mutant Of Rv3290c From M 2e-10
1ohv_A472 4-aminobutyrate-aminotransferase From Pig Length = 3e-09
4ao9_A454 Biochemical Properties And Crystal Structure Of A N 3e-06
2yku_A465 Structural Determinants Of The Beta-Selectivity Of 6e-06
>pdb|3NUI|A Chain A, Crystal Structure Of Omega-Transferase From Vibrio Fluvialis Js17 Length = 478 Back     alignment and structure

Iteration: 1

Score = 349 bits (895), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 162/417 (38%), Positives = 252/417 (60%), Gaps = 2/417 (0%) Query: 17 LVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTT 76 +V+ EG Y+ DVNG++YLD+ +GLW G L+ AA AQ P YH+F+ R + Sbjct: 45 VVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFFGRMS 104 Query: 77 KPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKS 136 ++ L+++L+E+ + +VF+TNSGSEANDT VK++W+ + A G+P K+K + R + Sbjct: 105 DQTVMLSEKLVEV-SPFDSGRVFYTNSGSEANDTMVKMLWFLHAAEGKPQKRKILTRWNA 163 Query: 137 YHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDL 196 YHG T ++AS++G P + F LP P +H CPHYWRY GETEE++ RLA LE+ Sbjct: 164 YHGVTAVSASMTGKP-YNSVFGLPLPGFVHLTCPHYWRYGEEGETEEQFVARLARELEET 222 Query: 197 ILKEGPETIAAFIAEXXXXXXXXXXXXXTYFEKVQAVVKKYDILFIADEVICAFGRLGTM 256 I +EG +TIA F AE YF+ + +++KYDI I+DEVIC FGR G Sbjct: 223 IQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNT 282 Query: 257 FGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPV 316 +GC Y PD + +K L++ + P+GA+++ PE+S+ + + + F HGFT SGHPV Sbjct: 283 WGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIEAIEEFPHGFTASGHPV 342 Query: 317 SCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKS 376 CA+A++A+ + + E V ++AP+F++ +K ++ P IGE RG G + E +K+ Sbjct: 343 GCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAERPNIGEYRGIGFMWALEAVKDKA 402 Query: 377 PNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPEEVDELISKYGKAL 433 PF + C G++ R G ++++ PPFI++ ++DE+ K KAL Sbjct: 403 SKTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPPFILTEAQMDEMFDKLEKAL 459
>pdb|4GRX|A Chain A, Structure Of An Omega-Aminotransferase From Paracoccus Denitrificans Length = 465 Back     alignment and structure
>pdb|4E3Q|A Chain A, Pmp-Bound Form Of Aminotransferase Crystal Structure From Vibrio Fluvialis Length = 473 Back     alignment and structure
>pdb|4E3R|A Chain A, Plp-Bound Aminotransferase Mutant Crystal Structure From Vibrio Fluvialis Length = 473 Back     alignment and structure
>pdb|3HMU|A Chain A, Crystal Structure Of A Class Iii Aminotransferase From Silicibacter Pomeroyi Length = 472 Back     alignment and structure
>pdb|4A6R|A Chain A, Crystal Structure Of The Omega Transaminase From Chromobacterium Violaceum In The Apo Form, Crystallised From Polyacrylic Acid Length = 459 Back     alignment and structure
>pdb|3I5T|A Chain A, Crystal Structure Of Aminotransferase Prk07036 From Rhodobacter Sphaeroides Kd131 Length = 476 Back     alignment and structure
>pdb|3DU4|A Chain A, Crystal Structure Of 7-Keto-8-Aminopelargonic Acid Bound 7,8- Diaminopelargonic Acid Synthase In Bacillus Subtilis Length = 448 Back     alignment and structure
>pdb|3DOD|A Chain A, Crystal Structure Of Plp Bound 7,8-diaminopelargonic Acid Synthase In Bacillus Subtilis Length = 448 Back     alignment and structure
>pdb|3N5M|A Chain A, Crystals Structure Of A Bacillus Anthracis Aminotransferase Length = 452 Back     alignment and structure
>pdb|3A8U|X Chain X, Crystal Structure Of Omega-Amino Acid:pyruvate Aminotransferase Length = 449 Back     alignment and structure
>pdb|3I4J|A Chain A, Crystal Structure Of Aminotransferase, Class Iii From Deinococcus Radiodurans Length = 430 Back     alignment and structure
>pdb|2EO5|A Chain A, Crystal Structure Of 4-Aminobutyrate Aminotransferase From Sulfolobus Tokodaii Strain7 Length = 419 Back     alignment and structure
>pdb|3LG0|A Chain A, Structure Of Plasmodium Falciparum Ornithine Delta-Aminotransferase Length = 422 Back     alignment and structure
>pdb|2E54|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From Thermotoga Maritima Length = 385 Back     alignment and structure
>pdb|1D7R|A Chain A, Crystal Structure Of The Complex Of 2,2-Dialkylglycine Decarboxylase With 5pa Length = 433 Back     alignment and structure
>pdb|1DGD|A Chain A, An Alkali Metal Ion Size-Dependent Switch In The Active Site Structure Of Dialkylglycine Decarboxylase Length = 432 Back     alignment and structure
>pdb|1Z3Z|A Chain A, The Crystal Structure Of A Dgd Mutant: Q52a Length = 431 Back     alignment and structure
>pdb|2ORD|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Ec 2.6.1.11) (Acoat) (Tm1785) From Thermotoga Maritima At 1.40 A Resolution Length = 397 Back     alignment and structure
>pdb|1M0N|A Chain A, Structure Of Dialkylglycine Decarboxylase Complexed With 1- Aminocyclopentanephosphonate Length = 433 Back     alignment and structure
>pdb|2PB0|A Chain A, Structure Of Biosynthetic N-Acetylornithine Aminotransferase From Salmonella Typhimurium: Studies On Substrate Specificity And Inhibitor Binding Length = 420 Back     alignment and structure
>pdb|1Z7D|A Chain A, Ornithine Aminotransferase Py00104 From Plasmodium Yoelii Length = 433 Back     alignment and structure
>pdb|2EH6|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From Aquifex Aeolicus Vf5 Length = 375 Back     alignment and structure
>pdb|1SZK|A Chain A, The Structure Of Gamma-Aminobutyrate Aminotransferase Mutant: E211s Length = 426 Back     alignment and structure
>pdb|1SF2|A Chain A, Structure Of E. Coli Gamma-Aminobutyrate Aminotransferase Length = 426 Back     alignment and structure
>pdb|1SZS|A Chain A, The Structure Of Gamma-aminobutyrate Aminotransferase Mutant: I50q Length = 426 Back     alignment and structure
>pdb|1SZU|A Chain A, The Structure Of Gamma-Aminobutyrate Aminotransferase Mutant: V241a Length = 426 Back     alignment and structure
>pdb|4ADB|A Chain A, Structural And Functional Study Of Succinyl-ornithine Transaminase From E. Coli Length = 406 Back     alignment and structure
>pdb|3RUY|A Chain A, Crystal Structure Of The Ornithine-Oxo Acid Transaminase Rocd From Bacillus Anthracis Length = 392 Back     alignment and structure
>pdb|3NX3|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Argd) From Campylobacter Jejuni Length = 395 Back     alignment and structure
>pdb|1QJ3|A Chain A, Crystal Structure Of 7,8-Diaminopelargonic Acid Synthase In Complex With 7-Keto-8-Aminopelargonic Acid Length = 429 Back     alignment and structure
>pdb|1S0A|A Chain A, Crystal Structure Of The Y17f Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|1DTY|A Chain A, Crystal Structure Of Adenosylmethionine-8-Amino-7-Oxonanoate Aminotransferase With Pyridoxal Phosphate Cofactor. Length = 429 Back     alignment and structure
>pdb|1S08|A Chain A, Crystal Structure Of The D147n Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|1S07|A Chain A, Crystal Structure Of The R253a Mutant Of 7,8-Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|1MGV|A Chain A, Crystal Structure Of The R391a Mutant Of 7,8-Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|2BYJ|A Chain A, Ornithine Aminotransferase Mutant Y85i Length = 439 Back     alignment and structure
>pdb|1S09|A Chain A, Crystal Structure Of The Y144f Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|1S06|A Chain A, Crystal Structure Of The R253k Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|2CAN|A Chain A, Human Ornithine Aminotransferase Complexed With L-Canaline Length = 402 Back     alignment and structure
>pdb|1OAT|A Chain A, Ornithine Aminotransferase Length = 439 Back     alignment and structure
>pdb|2BYL|A Chain A, Structure Of Ornithine Aminotransferase Triple Mutant Y85i Y55a G320f Length = 439 Back     alignment and structure
>pdb|1VEF|A Chain A, Acetylornithine Aminotransferase From Thermus Thermophilus Hb8 Length = 395 Back     alignment and structure
>pdb|3TFT|A Chain A, Crystal Structure Of 7,8-Diaminopelargonic Acid Synthase (Bioa) From Mycobacterium Tuberculosis, Pre-Reaction Complex With A 3,6- Dihydropyrid-2-One Heterocycle Inhibitor Length = 457 Back     alignment and structure
>pdb|3LV2|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis 7,8-Diaminopelargonic Acid Synthase In Complex With Substrate Analog Sinefungin Length = 462 Back     alignment and structure
>pdb|3BV0|A Chain A, Crystal Structure Of Plp Bound 7,8-Diaminopelargonic Acid Synthase In Mycobacterium Tuberculosis Length = 437 Back     alignment and structure
>pdb|3R4T|A Chain A, Crystal Structure Of 4-Aminobutyrate Aminotransferase Gabt From Mycobacterium Marinum Covalently Bound To Pyridoxal Phosphate Length = 467 Back     alignment and structure
>pdb|4FFC|A Chain A, Crystal Structure Of A 4-Aminobutyrate Aminotransferase (Gabt) From Mycobacterium Abscessus Length = 453 Back     alignment and structure
>pdb|3OKS|A Chain A, Crystal Structure Of 4-Aminobutyrate Transaminase From Mycobacterium Smegmatis Length = 451 Back     alignment and structure
>pdb|4ATP|A Chain A, Structure Of Gaba-Transaminase A1r958 From Arthrobacter Aurescens In Complex With Plp Length = 456 Back     alignment and structure
>pdb|3Q8N|A Chain A, Crystal Structure Of 4-Aminobutyrate Transaminase From Mycobacterium Smegmatis Length = 453 Back     alignment and structure
>pdb|3L44|A Chain A, Crystal Structure Of Bacillus Anthracis Heml-1, Glutamate Semialdehyde Aminotransferase Length = 434 Back     alignment and structure
>pdb|3FQA|A Chain A, Gabaculien Complex Of Gabaculine Resistant Gsam Version Length = 427 Back     alignment and structure
>pdb|2CFB|A Chain A, Glutamate-1-Semialdehyde 2,1-Aminomutase From Thermosynechococcus Elongatus Length = 411 Back     alignment and structure
>pdb|3FQ8|A Chain A, M248i Mutant Of Gsam Length = 427 Back     alignment and structure
>pdb|2GSA|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde Aminomutase (Aminotransferase, Wild-Type Form) Length = 432 Back     alignment and structure
>pdb|3FQ7|A Chain A, Gabaculine Complex Of Gsam Length = 427 Back     alignment and structure
>pdb|2HOY|A Chain A, Inter-Subunit Signaling In Gsam Length = 432 Back     alignment and structure
>pdb|2ZUK|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam (Different Binding Mode) Length = 439 Back     alignment and structure
>pdb|3DXW|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam Length = 452 Back     alignment and structure
>pdb|2EPJ|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde 2,1-Aminomutase From Aeropyrum Pernix Length = 434 Back     alignment and structure
>pdb|2E7U|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde 2,1-Aminomutase From Thermus Thermophilus Hb8 Length = 424 Back     alignment and structure
>pdb|3BS8|A Chain A, Crystal Structure Of Glutamate 1-Semialdehyde Aminotransferase Complexed With Pyridoxamine-5'-Phosphate From Bacillus Subtilis Length = 438 Back     alignment and structure
>pdb|4E77|A Chain A, 2.0a Crystal Structure Of A Glutamate-1-Semialdehyde Aminotransferase From Yersinia Pestis Co92 Length = 429 Back     alignment and structure
>pdb|3K28|A Chain A, Crystal Structure Of A Glutamate-1-Semialdehyde Aminotransferase From Bacillus Anthracis With Bound Pyridoxal 5'phosphate Length = 429 Back     alignment and structure
>pdb|2CY8|A Chain A, Crystal Structure Of D-Phenylglycine Aminotransferase (D-Phgat) From Pseudomonas Strutzeri St-201 Length = 453 Back     alignment and structure
>pdb|4A0G|A Chain A, Structure Of Bifunctional Dapa Aminotransferase-Dtb Synthetase From Arabidopsis Thaliana In Its Apo Form. Length = 831 Back     alignment and structure
>pdb|4A0F|A Chain A, Structure Of Selenomethionine Substituted Bifunctional Dapa Aminotransferase-Dethiobiotin Synthetase From Arabidopsis Thaliana In Its Apo Form. Length = 831 Back     alignment and structure
>pdb|2CIN|A Chain A, Lysine Aminotransferase From M. Tuberculosis In The Internal Aldimine Form Length = 449 Back     alignment and structure
>pdb|2JJF|A Chain A, N328a Mutant Of M. Tuberculosis Rv3290c Length = 449 Back     alignment and structure
>pdb|2JJH|A Chain A, E243 Mutant Of M. Tuberculosis Rv3290c Length = 449 Back     alignment and structure
>pdb|2JJE|A Chain A, Crystal Structure Of T330s Mutant Of Rv3290c From M. Tuberculosis Length = 449 Back     alignment and structure
>pdb|1OHV|A Chain A, 4-aminobutyrate-aminotransferase From Pig Length = 472 Back     alignment and structure
>pdb|4AO9|A Chain A, Biochemical Properties And Crystal Structure Of A Novel Beta-phenylalanine Aminotransferase From Variovorax Paradoxus Length = 454 Back     alignment and structure
>pdb|2YKU|A Chain A, Structural Determinants Of The Beta-Selectivity Of A Bacterial Aminotransferase Length = 465 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query447
3nui_A478 Pyruvate transaminase; amino transferase, transfer 0.0
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 0.0
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 0.0
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 0.0
3hmu_A472 Aminotransferase, class III; structural genomics, 0.0
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 0.0
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 0.0
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 0.0
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 1e-169
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 1e-124
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 1e-113
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 1e-111
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 1e-111
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 1e-108
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 1e-108
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 1e-107
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 1e-107
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 1e-105
1z7d_A433 Ornithine aminotransferase; structural genomics co 1e-100
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 1e-98
3ruy_A392 Ornithine aminotransferase; structural genomics, c 3e-97
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 5e-96
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 1e-93
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 2e-93
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 6e-93
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 1e-91
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 3e-89
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 9e-88
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 1e-35
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 3e-33
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 6e-30
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 7e-30
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 2e-29
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 5e-29
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 9e-28
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 9e-26
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>3nui_A Pyruvate transaminase; amino transferase, transferase; 2.00A {Vibrio fluvialis} Length = 478 Back     alignment and structure
 Score =  676 bits (1747), Expect = 0.0
 Identities = 176/442 (39%), Positives = 267/442 (60%), Gaps = 2/442 (0%)

Query: 1   MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATA 60
            L  FT          +V+   EG Y+ DVNG++YLD+ +GLW    G     L+ AA A
Sbjct: 29  SLYGFTDMPSLHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKA 88

Query: 61  QLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNN 120
           Q    P YH+F+ R +  ++ L+++L+E+ +     +VF+TNSGSEANDT VK++W+ + 
Sbjct: 89  QYERFPGYHAFFGRMSDQTVMLSEKLVEV-SPFDSGRVFYTNSGSEANDTMVKMLWFLHA 147

Query: 121 ALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGE 180
           A G+P K+K + R  +YHG T ++AS++G P  +  F LP P  +H  CPHYWRY   GE
Sbjct: 148 AEGKPQKRKILTRWNAYHGVTAVSASMTGKPY-NSVFGLPLPGFVHLTCPHYWRYGEEGE 206

Query: 181 TEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDIL 240
           TEE++  RLA  LE+ I +EG +TIA F AEPV+GAGGVIPP   YF+ +  +++KYDI 
Sbjct: 207 TEEQFVARLARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIP 266

Query: 241 FIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSN 300
            I+DEVIC FGR G  +GC  Y   PD +  +K L++ + P+GA+++ PE+S+ + +   
Sbjct: 267 VISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIE 326

Query: 301 TLGSFSHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEI 360
            +  F HGFT SGHPV CA+A++A+ +     + E V ++AP+F++ +K  ++ P IGE 
Sbjct: 327 AIEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAERPNIGEY 386

Query: 361 RGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDNIMMSPPFIMSPE 420
           RG G +   E   +K+   PF     +       C   G++ R  G ++++ PPFI++  
Sbjct: 387 RGIGFMWALEAVKDKASKTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPPFILTEA 446

Query: 421 EVDELISKYGKALKATEERVKE 442
           ++DE+  K  KAL      V  
Sbjct: 447 QMDEMFDKLEKALDKVFAEVAA 468


>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Length = 460 Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Length = 459 Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Length = 476 Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Length = 472 Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Length = 449 Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Length = 452 Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, pyridoxal phosphate, PSI-2, protein structure initiative; 1.70A {Deinococcus radiodurans} Length = 430 Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} PDB: 3drd_A 3du4_A* Length = 448 Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Length = 433 Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Length = 831 Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Length = 457 Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Length = 429 Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Length = 451 Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Length = 426 Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Length = 419 Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Length = 439 Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Length = 453 Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Length = 433 Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Length = 439 Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} Length = 392 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Length = 395 Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Length = 449 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Length = 420 Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Length = 395 Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Length = 397 Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Length = 472 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Length = 375 Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Length = 453 Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Length = 465 Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Length = 434 Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} Length = 434 Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Length = 427 Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Length = 429 Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} PDB: 3bs8_A* Length = 429 Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Length = 424 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query447
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 100.0
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 100.0
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 100.0
3hmu_A472 Aminotransferase, class III; structural genomics, 100.0
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 100.0
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 100.0
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 100.0
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 100.0
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 100.0
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 100.0
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 100.0
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 100.0
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 100.0
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 100.0
1z7d_A433 Ornithine aminotransferase; structural genomics co 100.0
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 100.0
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 100.0
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 100.0
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 100.0
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 100.0
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 100.0
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 100.0
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 100.0
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 100.0
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 100.0
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 100.0
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 100.0
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 100.0
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 100.0
4adb_A406 Succinylornithine transaminase; transferase, PLP e 100.0
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 100.0
3ruy_A392 Ornithine aminotransferase; structural genomics, c 100.0
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 100.0
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 100.0
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 100.0
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 100.0
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 100.0
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 100.0
3l8a_A421 METC, putative aminotransferase, probable beta-cys 100.0
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 100.0
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 100.0
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 100.0
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 100.0
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.98
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.98
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.97
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.97
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.97
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.97
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.97
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.97
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.96
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.96
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.96
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.96
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.96
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.96
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.96
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.96
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.96
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.96
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.96
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.96
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.96
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.96
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.96
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.96
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.96
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.96
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.96
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.95
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.95
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.95
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.95
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.95
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.95
3ele_A398 Amino transferase; RER070207001803, structural gen 99.95
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.95
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.92
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.95
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.95
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.95
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.95
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.95
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.95
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.95
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.95
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.95
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.95
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.95
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.94
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.94
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.94
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.94
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.94
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.94
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.94
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.94
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.94
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.94
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.94
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.94
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.94
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.94
3rq1_A418 Aminotransferase class I and II; structural genomi 99.94
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.93
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.93
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.93
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.93
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.93
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.93
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.93
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.93
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.93
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.92
1svv_A359 Threonine aldolase; structural genomics, structura 99.92
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.92
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.92
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.92
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.92
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.92
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.92
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.92
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.92
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.91
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.91
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.91
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.91
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.91
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.91
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.91
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.91
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.91
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.91
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.91
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.9
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.9
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.9
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.9
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.9
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.9
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.9
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.9
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.9
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.9
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.9
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.89
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.89
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.89
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.89
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.89
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.89
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.89
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.89
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.88
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.88
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.88
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.88
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.88
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.88
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.88
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.87
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.87
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.87
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.86
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.86
2fnu_A375 Aminotransferase; protein-product complex, structu 99.86
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.86
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.86
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.86
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.86
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.85
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.85
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.85
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.85
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.85
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.85
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.85
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.85
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.85
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.84
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.84
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.84
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.84
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.83
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.83
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.83
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.83
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.82
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.81
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.81
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.81
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.81
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.8
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.8
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.8
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.8
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.8
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.8
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.79
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.79
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.79
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.78
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.77
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.76
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.75
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.75
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.75
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.73
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.73
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.73
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.73
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.72
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.72
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.7
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.7
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.69
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.69
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.69
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.67
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.66
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.62
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.6
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.59
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.59
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.59
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.57
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.55
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.55
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.53
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.48
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.46
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.38
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.09
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
Probab=100.00  E-value=2e-82  Score=628.45  Aligned_cols=438  Identities=40%  Similarity=0.796  Sum_probs=401.8

Q ss_pred             CCCCCCcCccCCCCCCeEEEEecCcEEEeCCCCEEEecCCccccccCCCCCHHHHHHHHHHHhcCCcccccCcCCChHHH
Q 013204            1 MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPSL   80 (447)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~g~~~~d~dg~~~lD~~~~~~~~~lG~~~p~v~~a~~~~~~~~~~~~~~~~~~~~~~~   80 (447)
                      .||||+++.......|++|++|+|+||||.|||+||||.+++|++++||+||+|.+|+.++++++...+.+++.++++..
T Consensus        35 ~~h~~t~~~~~~~~~P~vi~rg~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~q~~~l~~~~~~~~~~~~~~~  114 (473)
T 4e3q_A           35 SLYGFTDMPSLHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFFGRMSDQTV  114 (473)
T ss_dssp             BCCSSCCHHHHHHHCCEEEEEEETTEEEETTCCEEEETTTTTTTCTTCSCCHHHHHHHHHHHHHCCCCCCCTTEEEHHHH
T ss_pred             cCCCCCChhhhccCCCEEEEeeecCEEEeCCCCEEEEcccCHHHhhccCCCHHHHHHHHHHHHhcccccccccccCHHHH
Confidence            49999999988888899999999999999999999999999999999999999999999999998766666666788999


Q ss_pred             HHHHHHHHhcCcCCCCeEEEeCChhhHHHHHHHHHHHHHHhcCCCCcceEEEEcCCCccchhhhhcccCCccccCCCCCC
Q 013204           81 DLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKFDLP  160 (447)
Q Consensus        81 ~l~~~l~~~~~~~~~~~v~~~~sGseA~~~Al~~~~~~~~~~~~~~~~~vi~~~~~yhg~~~~~~~~~~~~~~~~~~~~~  160 (447)
                      +|+++|++.. +.+.++|+|++||+|||+.|||++|+|+..+|++++.+||.|+++|||++.++++.++.+ ++..+..+
T Consensus       115 ~lAe~L~~~~-p~~~~~v~f~~sGsEA~e~AiKlAr~~~~~~g~~~r~~ii~~~~~yHG~t~~a~s~tg~~-~~~~~~~~  192 (473)
T 4e3q_A          115 MLSEKLVEVS-PFDSGRVFYTNSGSEANDTMVKMLWFLHAAEGKPQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLP  192 (473)
T ss_dssp             HHHHHHHHHS-SCSSCEEEEESSHHHHHHHHHHHHHHHHHHTTCTTCCEEEEETTCCCCSSHHHHHHSCCG-GGGGGTCS
T ss_pred             HHHHHHHhhC-CCCccEEEEeCchHHHHHHHHHHHHHHHHhcCCCCcceEEEeeceECCCccccccccccc-cccccCCC
Confidence            9999999996 446789999999999999999999999999999999999999999999999999999864 56667777


Q ss_pred             CCcceecCCCCcccCCCCCCChhHHHHHHHHHHHHHHHhhCCCcEEEEEEccccCCCCCccCChhHHHHHHHHHHhcCCE
Q 013204          161 APFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDIL  240 (447)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~l~~~~~~~~a~vi~epv~~~~G~~~~~~~~l~~l~~l~~~~g~~  240 (447)
                      .+...++++|+.+++..+....+.+...+.+++++.+...+++++|+||+||+++++|+++|+++||++|+++|++||++
T Consensus       193 ~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~~iAavi~EPiqg~gG~~~p~~~fl~~lr~lc~~~gil  272 (473)
T 4e3q_A          193 LPGFVHLTCPHYWRYGEEGETEEQFVARLARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIP  272 (473)
T ss_dssp             CTTEEEECCCCHHHHSCTTCCHHHHHHHHHHHHHHHHHHHCGGGEEEEEECSSBSTTTSBCCCTTHHHHHHHHHHHTTCC
T ss_pred             CCcccccCCCcccccccccchhhHHHHHHHHHHHHHHHhhCCCceEEEEeCCccCCCCceeCCHHHHHHHHHHhcccceE
Confidence            78888999998888777778888888888899999998888889999999999999999999999999999999999999


Q ss_pred             EEEehhhcCCCccccccccccCCCCCCeeeecccCCCcccceeEEEeChhHHHHhhhccCCCCccCcCCCCCCcHHHHHH
Q 013204          241 FIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVSCAV  320 (447)
Q Consensus       241 li~DEv~~g~g~~g~~~~~~~~~~~~d~v~~sK~l~gg~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~~a  320 (447)
                      ||+|||+|||||+|..|+++++|+.||++|++|+++||++|+|++++++++++.+.......+.+.|++||++||++|++
T Consensus       273 LI~DEV~tGfGRtG~~fa~e~~gv~PDi~t~~K~l~gG~~Pl~av~~~~~i~~~~~~~~~~~~~~~hg~T~~Gnpla~Aa  352 (473)
T 4e3q_A          273 VISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIEAIEEFPHGFTASGHPVGCAI  352 (473)
T ss_dssp             EEEECTTTSSSTTSSSCHHHHTTCCCSEEEECGGGGTTSSCCEEEEECHHHHHHHHHHHHHHSCCCCCCTTTTCHHHHHH
T ss_pred             EeccCccccCCcccchhHHHhcCCCCChHHhcccccCCCCCcccccccHHHHHHhccccccccccccCCCCCCCcchhhh
Confidence            99999999999999999999999999999999999999899999999999999886533233467899999999999999


Q ss_pred             HHHHHHHHhhhcHHHHHHHHHHHHHHhHhhccCCCceeeEeeeeeEEEEEeecCCCCCCCCCCCcchHHHHHHHHHHcCc
Q 013204          321 AIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGM  400 (447)
Q Consensus       321 a~a~l~~~~~~~~~~~~~~~~~~l~~~L~~l~~~~~~~~~~~~g~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Gi  400 (447)
                      ++++|++++++++.+++++++++|++.|+++.+++.+.+++|.|+++++++..+..+..+++........+.+.|+++|+
T Consensus       353 ala~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~v~~vRG~Gl~~gielv~~~~~~~~~~~~~~~~~~~~~~~~~~Gl  432 (473)
T 4e3q_A          353 ALKAIDVVMNEGLAENVRRLAPRFEERLKHIAERPNIGEYRGIGFMWALEAVKDKASKTPFDGNLSVSERIANTCTDLGL  432 (473)
T ss_dssp             HHHHHHHHHHSSHHHHHHHHHHHHHHHHHHHTTSTTEEEEEEETTEEEEEECSBTTTTBCCCGGGCHHHHHHHHHHHTTE
T ss_pred             hhhhhhhhccccHHHHHHHHHHHHHHHHHHHhcCCCeeEEeecceEEEEEEecCccccccccccHHHHHHHHHHHHHCCc
Confidence            99999999999999999999999999999997778889999999999999988777777777666677889999999999


Q ss_pred             eEEeeCCEEEEecCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q 013204          401 LVRVSGDNIMMSPPFIMSPEEVDELISKYGKALKATEERV  440 (447)
Q Consensus       401 ~~~~~g~~iR~~~~~~~t~e~i~~~~~~l~~~l~~~~~~~  440 (447)
                      ++.+.|+.+||+||+++|++|||+++++|+++++++..++
T Consensus       433 l~~~~g~~i~l~PPL~it~~eid~~~~~l~~al~~v~ael  472 (473)
T 4e3q_A          433 ICRPLGQSVVLCPPFILTEAQMDEMFDKLEKALDKVFAEV  472 (473)
T ss_dssp             ECEEETTEEEECCCTTCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEecCCEEEEeCCCCCCHHHHHHHHHHHHHHHHHHHHHh
Confidence            9999999999999999999999999999999999876654



>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 447
d2byla1404 c.67.1.4 (A:36-439) Ornithine aminotransferase {Hu 7e-92
d1z7da1404 c.67.1.4 (A:7-410) Ornithine aminotransferase {Pla 8e-88
d1sffa_425 c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA 3e-87
d1vefa1387 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine a 1e-83
d2gsaa_427 c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase 4e-73
d1s0aa_429 c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxonona 5e-73
d1zoda1431 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {P 2e-66
d1ohwa_461 c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA 1e-56
d2v1pa1467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 3e-29
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 6e-26
d1m6sa_343 c.67.1.1 (A:) Low-specificity threonine aldolase { 6e-07
d1v72a1345 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps 8e-07
d1fc4a_401 c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {E 4e-06
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 6e-05
d1svva_340 c.67.1.1 (A:) Low-specificity threonine aldolase { 0.002
d1b5pa_382 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 0.003
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 404 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Ornithine aminotransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  282 bits (721), Expect = 7e-92
 Identities = 102/431 (23%), Positives = 177/431 (41%), Gaps = 46/431 (10%)

Query: 8   GWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPF 67
           G  +    P+ +E+ +G Y++DV G+KY D L+ +     G   P++V A  +Q++ L  
Sbjct: 16  GAHNAHPLPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGHCHPKIVNALKSQVDKLTL 75

Query: 68  YHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPN- 126
               +         L +    +       KV   N+G EA +T  KL   +   +     
Sbjct: 76  TSRAFYNN-----VLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQK 130

Query: 127 -KKKFIARQKSYHGSTLIAASLSGLPALHQKFDLPAPFVLHTDCPHYWRYAHPGETEEEY 185
            K K +    ++ G TL A S S  P  +  F    P                       
Sbjct: 131 YKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPY---------------- 174

Query: 186 STRLANNLEDLILKEGPETIAAFIAEPVIGAGGVIPPPATYFEKVQAVVKKYDILFIADE 245
                N+L  L        +AAF+ EP+ G  GV+ P   Y   V+ +  ++ +LFIADE
Sbjct: 175 -----NDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADE 229

Query: 246 VICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSF 305
           +     R G     D  +++PD+V   KALS    P+ A+L   ++   I          
Sbjct: 230 IQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIK-------PG 282

Query: 306 SHGFTYSGHPVSCAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGL 365
            H  TY G+P+ C VAI AL++ +E N+ E  +K+    ++ +       ++  +RG GL
Sbjct: 283 EHFSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS-DVVTAVRGKGL 341

Query: 366 ILGTEFADNKSPNEPFPPEWGIGAYFGAQCEKHGMLVRVSGDN-IMMSPPFIMSPEEVDE 424
           +      + K  +               +   +G+L + +  + I  +PP ++  +E+ E
Sbjct: 342 LNAIVIKETKDWD---------AWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRE 392

Query: 425 LISKYGKALKA 435
            I    K + +
Sbjct: 393 SIEIINKTILS 403


>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 404 Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Length = 425 Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Length = 427 Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Length = 429 Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Length = 431 Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Length = 461 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Length = 343 Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Length = 401 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Length = 340 Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Length = 382 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query447
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 100.0
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 100.0
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 100.0
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 100.0
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 100.0
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 100.0
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 100.0
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 100.0
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 100.0
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.94
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.93
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.93
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.92
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.92
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.91
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.91
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.9
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.9
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.9
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.9
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.9
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.89
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.89
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.89
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.89
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.88
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.88
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.87
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.87
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.86
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.85
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.85
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.83
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.83
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.83
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.83
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.81
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.8
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.8
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.79
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.78
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.77
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.77
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.77
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.75
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.75
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.74
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.73
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.72
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.72
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.71
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.7
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.7
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.7
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.67
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.63
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.63
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.62
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.61
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.58
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.53
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.52
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.41
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.37
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.34
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.31
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.3
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.28
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.25
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.23
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.23
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.21
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.21
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 99.19
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.17
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.15
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.12
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.11
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.1
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.04
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.01
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 98.95
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 98.91
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 98.89
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.4e-68  Score=523.41  Aligned_cols=409  Identities=27%  Similarity=0.471  Sum_probs=342.5

Q ss_pred             CCCCCCcCccCCCCCCe-EEEEecCcEEEeCCCCEEEecCCccccccCCCCCHHHHHHHHHHHhcCCcccccCcCCChHH
Q 013204            1 MLAPFTAGWQSTDVHPL-VIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATAQLNTLPFYHSFWNRTTKPS   79 (447)
Q Consensus         1 ~~~~~~~~~~~~~~~~~-~~~~~~g~~~~d~dg~~~lD~~~~~~~~~lG~~~p~v~~a~~~~~~~~~~~~~~~~~~~~~~   79 (447)
                      .||||+++...   +|+ .+++++|+||||.|||+||||.+++++++|||+||+|++|+.++++++.+. .....++++.
T Consensus        13 ~~~p~~~~~~~---~p~~~i~~~~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~i~~Ai~~q~~~~~~~-~~~~~~~~~~   88 (429)
T d1s0aa_          13 ILHPFTSMTSP---LPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHV-MFGGITHAPA   88 (429)
T ss_dssp             BCCTTCCSSSC---CCCEEEEEEEBTEEEETTSCEEEESSTTTTTCTTCBSCHHHHHHHHHHHHHCSCC-CCSSEECHHH
T ss_pred             cCCCcccCCCC---CCCcceEEeECCEEEECCCCEEEECcccHHHHhhcCCcHHHHHHHHHHHHhcCCc-ccCCccchHH
Confidence            49999988544   555 488999999999999999999999999999999999999999999886543 2224577889


Q ss_pred             HHHHHHHHHhcCcCCCCeEEEeCChhhHHHHHHHHHHHHHHhcCCCCcceEEEEcCCCccchhhhhcccCCccccCCC-C
Q 013204           80 LDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARQKSYHGSTLIAASLSGLPALHQKF-D  158 (447)
Q Consensus        80 ~~l~~~l~~~~~~~~~~~v~~~~sGseA~~~Al~~~~~~~~~~~~~~~~~vi~~~~~yhg~~~~~~~~~~~~~~~~~~-~  158 (447)
                      .++++++.+.. +.+.++++|++||+||++.|+|++|+++..+|. ++.+||.++++|||.+.++++.++........ .
T Consensus        89 ~~l~~~l~~~~-~~~~~~v~f~~sGseA~e~A~k~ar~~~~~~g~-~~~~ii~~~~~yHG~t~~a~~~t~~~~~~~~~~~  166 (429)
T d1s0aa_          89 IELCRKLVAMT-PQPLECVFLADSGSVAVEVAMKMALQYWQAKGE-ARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWK  166 (429)
T ss_dssp             HHHHHHHHHHS-CTTCCEEEEESSHHHHHHHHHHHHHHHHHHHTC-CCCEEEEETTCCCCSSHHHHTTSCTTTTTGGGGT
T ss_pred             HHHHHHHHhhh-ccCcceeeeccccccchhhhhhhhhheeecccc-cccEEEEecCCccccchhhhhhcCCccccccccC
Confidence            99999999886 456789999999999999999999999888774 45789999999999999999998865443332 2


Q ss_pred             CCCCcceecCCCCcccCCCCCCChhHHHHHHHHHHHHHHHhhCCCcEEEEEEcccc-CCCCCccCChhHHHHHHHHHHhc
Q 013204          159 LPAPFVLHTDCPHYWRYAHPGETEEEYSTRLANNLEDLILKEGPETIAAFIAEPVI-GAGGVIPPPATYFEKVQAVVKKY  237 (447)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~l~~~~~~~~a~vi~epv~-~~~G~~~~~~~~l~~l~~l~~~~  237 (447)
                      .........+.+....  ....+..     +++++++.+... ++++++||+||++ +.||.++|+++|+++|+++|++|
T Consensus       167 ~~~~~~~~~~~~~~~~--~~~~~~~-----~~~~~~~~~~~~-~~~iaavivEPi~~~~gg~~~~~~~fl~~lr~lc~~~  238 (429)
T d1s0aa_         167 GYLPENLFAPAPQSRM--DGEWDER-----DMVGFARLMAAH-RHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDRE  238 (429)
T ss_dssp             TTSCCCEEECCCCSBC---CCCCGG-----GGHHHHHHHHHH-TTTEEEEEECSSEECTTTCEEBCTHHHHHHHHHHHHH
T ss_pred             cccccccccccccccc--ccccchh-----hhhhhhhhhhhc-CCccceeeecceeccCCCccCCCHHHHHHHHHHHHHc
Confidence            2222222222221111  1111111     135555555544 4689999999996 77888899999999999999999


Q ss_pred             CCEEEEehhhcCCCccccccccccCCCCCCeeeecccCCCcccceeEEEeChhHHHHhhhccCCCCccCcCCCCCCcHHH
Q 013204          238 DILFIADEVICAFGRLGTMFGCDKYSIKPDLVSFAKALSSAYMPIGAILVSPEVSEVIHSQSNTLGSFSHGFTYSGHPVS  317 (447)
Q Consensus       238 g~~li~DEv~~g~g~~g~~~~~~~~~~~~d~v~~sK~l~gg~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~  317 (447)
                      |++||+|||++||||+|..|+++++++.||++++||+++||++|+|++++++++++.+...  ..+.+.|++||++||++
T Consensus       239 gillI~DEV~tGfGRtG~~~~~~~~~v~PDi~~~gK~l~gG~~p~~av~~~~~i~~~~~~~--~~~~~~~~~T~~gnp~~  316 (429)
T d1s0aa_         239 GILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNG--EAGCFMHGPTFMGNPLA  316 (429)
T ss_dssp             TCEEEEECTTTTTTTTSSSSGGGGGTCCCSEEEECGGGGTSSSCCEEEEECHHHHHHHHTS--TTSSCSCCCTTTTCHHH
T ss_pred             CcceehhhccccccccccccccccceecccccccccccccccccccchhhHHHHHhccCCC--CCcceeecCCCCCCccc
Confidence            9999999999999999999999999999999999999999989999999999999988642  23467889999999999


Q ss_pred             HHHHHHHHHHHhhhcHHHHHHHHHHHHHHhHhhccCCCceeeEeeeeeEEEEEeecCCCCCCCCCCCcchHHHHHHHHHH
Q 013204          318 CAVAIEALKIYKERNIVEQVNKIAPKFQDGVKAFSDSPIIGEIRGTGLILGTEFADNKSPNEPFPPEWGIGAYFGAQCEK  397 (447)
Q Consensus       318 ~~aa~a~l~~~~~~~~~~~~~~~~~~l~~~L~~l~~~~~~~~~~~~g~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~l~~  397 (447)
                      |++++++|++++++++.++++++++++++.|+++.+.+.+.++++.|++.++++..+..           ...+...|++
T Consensus       317 ~aaa~a~L~~i~~~~~~~~~~~~g~~l~~~L~~l~~~~~v~~vrg~Gl~~~~e~~~~~~-----------~~~~~~~~~~  385 (429)
T d1s0aa_         317 CAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEMVADVRVLGAIGVVETTHPVN-----------MAALQKFFVE  385 (429)
T ss_dssp             HHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHGGGGGCTTEEEEEEETTEEEEEESSCBC-----------HHHHHHHHHH
T ss_pred             chhhhccccccccccccchhhHHHHHHHHHHHHhccCCceEEEeecccEEEEEecCccc-----------HHHHHHHHHH
Confidence            99999999999999999999999999999999997778899999999999999876432           4568899999


Q ss_pred             cCceEEeeCCEEEEecCCCCCHHHHHHHHHHHHHHHHHH
Q 013204          398 HGMLVRVSGDNIMMSPPFIMSPEEVDELISKYGKALKAT  436 (447)
Q Consensus       398 ~Gi~~~~~g~~iR~~~~~~~t~e~i~~~~~~l~~~l~~~  436 (447)
                      +|+++.+.|+.+||+||+++|++|||+++++|+++++++
T Consensus       386 ~Gl~~~~~g~~i~~~Ppl~it~~eid~~~~~l~~al~e~  424 (429)
T d1s0aa_         386 QGVWIRPFGKLIYLMPPYIILPQQLQRLTAAVNRAVQDE  424 (429)
T ss_dssp             TTEECCCBTTEEEECCCTTCCHHHHHHHHHHHHHHTSSG
T ss_pred             CCcEEEecCCEEEEeCCcCCCHHHHHHHHHHHHHHHHhh
Confidence            999999999999999999999999999999999998763



>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure