Citrus Sinensis ID: 013623

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44

MLGRVEQVMLAKAAASFGLPLASPPLRRNSNTDKLMNKCVLPLLNPNPVGRPGARVVLVRASGGDGGGGGYSRTPLETAGACELIDNDTGEKVIVWGGTDDDHDHDPPIPPKHLLDSSNWNKDPSQPTTSAPVLRNNDCSIPSKKGVISSFSRLKAQRVKAVVDKRSAMGKKTVNALKQEGRLSKTTPSLENFRELGEHIVDNDVPAESIDKNISDYNSRSNKHEKSGTKIDRGWRSGGSIHNLQYEPTDCPKQRHKYSADGDFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQGLSKSTSGSPRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRWYARTASLNIESHFSYI

cccHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccccccccccccccEEEEEEccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHcccEEccccEEEEEccccccccccccc

cccHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccccccccccccccHHHHHHccccccccccccccccccccEEEEEcccccEEEEEcccccccccccccccHHHHccccccccccccccccccHccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccccccccEEEEEcccccccccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHccccccccccccccEEEEEccHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHcccEEEEEccHHHHHHHHcccEEEcEEEEEEEccHHccccccccc

MLGRVEQVMLAKAAAsfglplaspplrrnsntdklmnkcvlpllnpnpvgrpgARVVLVRasggdgggggysrtpletagacelidndtgekvivwggtdddhdhdppippkhlldssnwnkdpsqpttsapvlrnndcsipskkgvisSFSRLKAQRVKAVVDKRSAMGKKTVNALKqegrlskttpsLENFRELgehivdndvpaesidknisdynsrsnkheksgtkidrgwrsggsihnlqyeptdcpkqrhkysadgdffsrksfkelgcsdYMIESLKrqnflrpsqiqamafppvvegksciladqsgsgktLAYLLPVIQRLRQEELQglskstsgsprvvilAPTAELASQVLSNcrslskcgvpfrsmvvtggfrqkTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRWYARTAslnieshfsyi

MLGRVEQVMLAKAaasfglplaspplrrnsntDKLMNKCVLPllnpnpvgrPGARVVLVRASGGDGGGGGYSRTPLETAGACELIDNDTGEKVIVWGGTDDDHDHDPPIPPKHLLDSSNWNKDPSQPttsapvlrnndcsipskkgvissfsrlkaQRVKavvdkrsamgkktvnalkqegrlskttpsLENFRELgehivdndvpaesidknisdynsrsnkheksgtkidrgwrsgGSIHNlqyeptdcpkqrhKYSADGDFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQglskstsgsprVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRWYARTASLNIESHFSYI

MLGRVEQVMLAKAAASFGLPLASPPLRRNSNTDKLMNKCVLPLLNPNPVGRPGARVVLVRASggdgggggYSRTPLETAGACELIDNDTGEKVIVWGGTdddhdhdppippkhlldSSNWNKDPSQPTTSAPVLRNNDCSIPSKKGVISSFSRLKAQRVKAVVDKRSAMGKKTVNALKQEGRLSKTTPSLENFRELGEHIVDNDVPAESIDKNISDYNSRSNKHEKSGTKIDRGWRSGGSIHNLQYEPTDCPKQRHKYSADGDFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQGLSKSTSGSPRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRWYARTASLNIESHFSYI

***********************************MNKCVLPLLNPN*******RVVL**********************ACELIDNDTGEKVIVWGG********************************************************************************************************************************************************************DFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLR***************RVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRWYARTASLNIE******

*******VMLAKAAASFGLPLASPP*R***NTDKLMNKCVLPLLNPNPVGRPGAR*VL***************TPLETAGACELIDNDTGEKVIVWGGTDDD********************************************************************************************************************************************************************RKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQR******************VVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRWYARTASLNIESHFSYI

MLGRVEQVMLAKAAASFGLPLASPPLRRNSNTDKLMNKCVLPLLNPNPVGRPGARVVLVRASGGDGGGGGYSRTPLETAGACELIDNDTGEKVIVWGGTDDDHDHDPPIPPKHLLDSSNWN**********PVLRNNDCSIPSKKGVISSFSRLKAQRVKAVVDKRSAMGKKTVNALKQEGRLSKTTPSLENFRELGEHIVDNDVPAESIDKNISDY*************IDRGWRSGGSIHNLQYEPTDCPKQRHKYSADGDFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQ*********PRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRWYARTASLNIESHFSYI

*L**VEQVMLAKA**SFGLPLASPPLRRNSNTDKLMNKCVLPLLNPNPVGRPGARVVLVRASGG*GGGGGYSRTPLETAGACELIDNDTGEKVIVWGGTDDDHDHDPPIPP********************PV***NDCSIPSKKGVISSFSRLKAQRVKAVVDKRSAMGKK***************************I**NDVPAESID****D*NSRSNKHEKSGTKIDRGWRSGGSIHNLQYEPTDCPKQRHKYSADGDFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQGLSKSTSGSPRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRWYARTASLNIESH****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		439	2.2.26 [Sep-21-2011]
Q0DVX2		641	DEAD-box ATP-dependent RN	yes	no	0.738	0.505	0.454	5e-74
Q8GUG7		781	DEAD-box ATP-dependent RN	yes	no	0.457	0.257	0.643	2e-70
Q56X76		621	DEAD-box ATP-dependent RN	no	no	0.332	0.235	0.408	3e-26
Q5VRY0		625	DEAD-box ATP-dependent RN	no	no	0.348	0.244	0.391	1e-23
P25888		454	ATP-dependent RNA helicas	N/A	no	0.328	0.317	0.388	4e-20
Q6CIV2		554	ATP-dependent RNA helicas	yes	no	0.328	0.259	0.372	1e-19
A6ZLH6		849	Pre-mRNA-processing ATP-d	N/A	no	0.357	0.184	0.335	2e-19
P21372		849	Pre-mRNA-processing ATP-d	yes	no	0.357	0.184	0.335	2e-19
Q9C718		501	DEAD-box ATP-dependent RN	no	no	0.318	0.279	0.337	2e-19
Q755N4		557	ATP-dependent RNA helicas	yes	no	0.323	0.254	0.353	2e-19

>sp\|Q0DVX2\|RH50_ORYSJ DEAD-box ATP-dependent RNA helicase 50 OS=Oryza sativa subsp. japonica GN=Os03g0108600 PE=2 SV=2	Back alignment and function desciption

 Score =  278 bits (712), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 165/363 (45%), Positives = 223/363 (61%), Gaps = 39/363 (10%)

Query: 74  TPLETAGACELIDNDTGEKVIVWGGTDDDHDHDPPIPPKHLLDSSNWNKDPSQPTTSAPV 133
            P++T GA  L+D  TG  VIVWGGTDD     P +        S   + P +P  +   
Sbjct: 57  VPMDTPGAYRLVDRATGRSVIVWGGTDDVSMPSPAV-------LSTTTRVPDRPKENG-- 107

Query: 134 LRNNDCSIPSKKGVISSFSRLKAQRVKAVVDKRSAMGKKTVNALKQEGRLSKTTPSLE-- 191
                     +   I +F RLKAQ+VK V+ +RSA  K+  +      R S++ PS E  
Sbjct: 108 ----------RSTSIGNFGRLKAQKVK-VLARRSAHLKREDSGRISTSRFSES-PSDESD 155

Query: 192 ------------NFRELGEHIVDNDVPAESIDKNISDYNSRSNKHEKSGTKIDRGWRSGG 239
                       N R+      D    A S++  +  Y   ++  +  G++   G +  G
Sbjct: 156 EDGTYFERDRARNTRQNSRSRDDKTRGAHSLNSVLRQYRG-ADDLDFPGSEATSGSKRWG 214

Query: 240 SIHNLQYEPTDCPKQRHKYSADGDFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAF 299
           +I ++ +   +   QR K   D  FFSR+SFKE+GCSD ++ +L+   F RPS IQAMA+
Sbjct: 215 NISDVTFGRQN---QRQKGPLDSGFFSRRSFKEIGCSDEILGALRSFGFPRPSHIQAMAY 271

Query: 300 PPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQGLSKSTSGSPRVVILAPTAELAS 359
            PV+EGKSCI+ DQSGSGKTLAYL PV+Q LR+EE++GL +S+  +PRVV+L PTAELAS
Sbjct: 272 RPVLEGKSCIIGDQSGSGKTLAYLCPVVQNLRKEEVEGLHRSSPRNPRVVVLTPTAELAS 331

Query: 360 QVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLI 419
           QVL+NCRS+SK GVPFRSMV TGGFRQKTQLE+L + +DVLIATPGRF++L++EG +QL 
Sbjct: 332 QVLNNCRSISKSGVPFRSMVATGGFRQKTQLESLDQELDVLIATPGRFLYLLQEGFVQLN 391

Query: 420 NLR 422
           NLR
Sbjct: 392 NLR 394

Probably involved in resistance to biotic and abiotic stresses. Confers tolerance to oxidative stress and mediates pathogenesis-related (PR) genes expression. Exhibits RNA-dependent ATPase and ATP-dependent RNA helicase activities in vitro.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q8GUG7\|RH50_ARATH DEAD-box ATP-dependent RNA helicase 50 OS=Arabidopsis thaliana GN=RH50 PE=2 SV=2	Back alignment and function description

>sp\|Q56X76\|RH39_ARATH DEAD-box ATP-dependent RNA helicase 39 OS=Arabidopsis thaliana GN=RH39 PE=2 SV=2	Back alignment and function description

>sp\|Q5VRY0\|RH39_ORYSJ DEAD-box ATP-dependent RNA helicase 39 OS=Oryza sativa subsp. japonica GN=Os01g0184500 PE=2 SV=1	Back alignment and function description

>sp\|P25888\|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3	Back alignment and function description

>sp\|Q6CIV2\|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1	Back alignment and function description

>sp\|A6ZLH6\|PRP5_YEAS7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRP5 PE=3 SV=1	Back alignment and function description

>sp\|P21372\|PRP5_YEAST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP5 PE=1 SV=1	Back alignment and function description

>sp\|Q9C718\|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=1 SV=1	Back alignment and function description

>sp\|Q755N4\|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		439
297736840		648	unnamed protein product [Vitis vinifera]	0.733	0.496	0.534	5e-95
225432238		707	PREDICTED: DEAD-box ATP-dependent RNA he	0.785	0.487	0.504	3e-92
449459868		648	PREDICTED: DEAD-box ATP-dependent RNA he	0.722	0.489	0.482	8e-78
219888667		424	unknown [Zea mays]	0.783	0.811	0.420	5e-76
413957214		649	putative DEAD-box ATP-dependent RNA heli	0.783	0.530	0.420	6e-76
226502877		655	uncharacterized protein LOC100280046 [Ze	0.797	0.534	0.420	1e-74
147854298		563	hypothetical protein VITISV_034872 [Viti	0.432	0.337	0.652	8e-73
326514124		654	predicted protein [Hordeum vulgare subsp	0.767	0.515	0.437	2e-72
115450203		653	Os03g0108600 [Oryza sativa Japonica Grou	0.738	0.496	0.454	3e-72
143456346		641	RecName: Full=DEAD-box ATP-dependent RNA	0.738	0.505	0.454	3e-72

>gi\|297736840\|emb\|CBI26041.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  354 bits (909), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 202/378 (53%), Positives = 244/378 (64%), Gaps = 56/378 (14%)

Query: 71  YSRTPLETAGACELIDNDTGEKVIVWGGTDDDHDHDPPIPPKHLLDSSNWNK-DPSQPTT 129
           YSR  ++T GA +LID++TGEK IVWGG DDD    PPIP K +L   +WN  D + PT 
Sbjct: 48  YSRRQMDTPGAYQLIDDETGEKFIVWGGIDDD----PPIPSKDVL---SWNPVDNNTPTP 100

Query: 130 S---------APVLRNNDCSIPSKKGVISSFSRLKAQRVKAVVDKRSAMGKKTVNALKQE 180
           S         A  ++ +       KGV  SF RLKAQRVKA+                  
Sbjct: 101 SKDGHAGIEPAAAVKKDVFPKAQTKGVTGSFGRLKAQRVKAL------------------ 142

Query: 181 GRLSKTTPSLENFRELGEHIVDNDVPAESIDKNISDYNSRSNKHEKSGTKID-------- 232
                TT + +  REL E+ + +D   +      S+      K  +S  KI         
Sbjct: 143 -----TTKTSKAKRELNEYKIHSDKTVKRDIGKFSELQITPEKPHRSDNKIAGADVLVPR 197

Query: 233 ------RGWRSGGSIHNLQYEPTDCPKQRHKYS--ADGDFFSRKSFKELGCSDYMIESLK 284
                 +GW  G ++ N ++E T+ PK+R K +  AD DFFS KSF++LGCSDYMIESL+
Sbjct: 198 VSTANLQGWGYGETMRNFEFETTNIPKRRGKGNSLADSDFFSGKSFRDLGCSDYMIESLR 257

Query: 285 RQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQGLSKSTSG 344
            Q F+RPS IQAMAF  V+EGKSCI+ADQSGSGKTLAYLLPVIQRLR+EELQGL KS++G
Sbjct: 258 GQLFVRPSHIQAMAFATVMEGKSCIIADQSGSGKTLAYLLPVIQRLREEELQGLGKSSAG 317

Query: 345 SPRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATP 404
            P+VVIL PTAELASQVLSNCRS+SK G PFRSM  TGGFRQ+TQLENLQ+ +DVLIATP
Sbjct: 318 CPQVVILVPTAELASQVLSNCRSISKFGAPFRSMAATGGFRQRTQLENLQQDLDVLIATP 377

Query: 405 GRFMFLIKEGILQLINLR 422
           GRFMFLIKEG LQL NLR
Sbjct: 378 GRFMFLIKEGFLQLTNLR 395

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225432238\|ref\|XP_002275635.1\| PREDICTED: DEAD-box ATP-dependent RNA helicase 50-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449459868\|ref\|XP_004147668.1\| PREDICTED: DEAD-box ATP-dependent RNA helicase 50-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|219888667\|gb\|ACL54708.1\| unknown [Zea mays]	Back alignment and taxonomy information

>gi\|413957214\|gb\|AFW89863.1\| putative DEAD-box ATP-dependent RNA helicase family protein [Zea mays]	Back alignment and taxonomy information

>gi\|226502877\|ref\|NP_001146459.1\| uncharacterized protein LOC100280046 [Zea mays] gi\|219887353\|gb\|ACL54051.1\| unknown [Zea mays] gi\|413957213\|gb\|AFW89862.1\| putative DEAD-box ATP-dependent RNA helicase family protein [Zea mays]	Back alignment and taxonomy information

>gi\|147854298\|emb\|CAN83429.1\| hypothetical protein VITISV_034872 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|326514124\|dbj\|BAJ92212.1\| predicted protein [Hordeum vulgare subsp. vulgare]	Back alignment and taxonomy information

>gi\|115450203\|ref\|NP_001048702.1\| Os03g0108600 [Oryza sativa Japonica Group] gi\|113547173\|dbj\|BAF10616.1\| Os03g0108600, partial [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|143456346\|sp\|Q0DVX2.2\|RH50_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 50 gi\|108705771\|gb\|ABF93566.1\| DEAD/DEAH box helicase, putative, expressed [Oryza sativa Japonica Group] gi\|215686822\|dbj\|BAG89672.1\| unnamed protein product [Oryza sativa Japonica Group] gi\|222624050\|gb\|EEE58182.1\| hypothetical protein OsJ_09113 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		439
TAIR\|locus:2077592		781	AT3G06980 [Arabidopsis thalian	0.457	0.257	0.643	1.6e-69
UNIPROTKB\|Q0DVX2		641	LOC_Os03g01830 "DEAD-box ATP-d	0.744	0.510	0.453	4e-67
TAIR\|locus:2118509		621	RH39 "RH39" [Arabidopsis thali	0.332	0.235	0.408	1.6e-26
UNIPROTKB\|Q83DM8		420	rhlE "ATP-dependent RNA helica	0.350	0.366	0.352	1e-21
TIGR_CMR\|CBU_0670		420	CBU_0670 "ATP-dependent RNA he	0.350	0.366	0.352	1e-21
UNIPROTKB\|Q9KS53		397	VC1407 "ATP-dependent RNA heli	0.309	0.342	0.380	1.7e-20
TIGR_CMR\|VC_1407		397	VC_1407 "ATP-dependent RNA hel	0.309	0.342	0.380	1.7e-20
TIGR_CMR\|CPS_1125		466	CPS_1125 "ATP-dependent RNA he	0.337	0.317	0.375	5.6e-20
ZFIN\|ZDB-GENE-061013-64		558	ddx28 "DEAD (Asp-Glu-Ala-Asp)	0.414	0.326	0.340	1.8e-19
TIGR_CMR\|SO_3783		535	SO_3783 "ATP-dependent RNA hel	0.334	0.274	0.385	2.7e-19

TAIR\|locus:2077592 AT3G06980 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 657 (236.3 bits), Expect = 1.6e-69, Sum P(2) = 1.6e-69
 Identities = 132/205 (64%), Positives = 161/205 (78%)

Query:   220 RSNKHEKSGTKIDRGWRSGGSIHNLQYEPTDCPKQRHKY--SADGDFFSRKSFKELGCSD 277
             R   H K      RGW    S+  +     D  ++R+K   + +  FFSRK+F E+GCS+
Sbjct:   326 RGGSHSKGSDTNSRGWGDRRSV--VYTRDMDDWRERNKTKDTRETGFFSRKTFAEIGCSE 383

Query:   278 YMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQG 337
              M+++LK QNF RP+ IQAMAF PV++GKSCI+ADQSGSGKTLAYL+PVIQRLR+EELQG
Sbjct:   384 DMMKALKEQNFDRPAHIQAMAFSPVIDGKSCIIADQSGSGKTLAYLVPVIQRLREEELQG 443

Query:   338 LSKSTSGSPRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGV 397
              SKS+ G PRV++L PTAELASQVL+NCRS+SK GVPFRSMVVTGGFRQ+TQLENL++GV
Sbjct:   444 HSKSSPGCPRVIVLVPTAELASQVLANCRSISKSGVPFRSMVVTGGFRQRTQLENLEQGV 503

Query:   398 DVLIATPGRFMFLIKEGILQLINLR 422
             DVLIATPGRF +L+ EGIL L NLR
Sbjct:   504 DVLIATPGRFTYLMNEGILGLSNLR 528

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0004386 "helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS

GO:0009507 "chloroplast" evidence=IDA

GO:0006364 "rRNA processing" evidence=RCA

GO:0006399 "tRNA metabolic process" evidence=RCA

GO:0006655 "phosphatidylglycerol biosynthetic process" evidence=RCA

GO:0009658 "chloroplast organization" evidence=RCA

GO:0009793 "embryo development ending in seed dormancy" evidence=RCA

GO:0010103 "stomatal complex morphogenesis" evidence=RCA

GO:0016226 "iron-sulfur cluster assembly" evidence=RCA

GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA

UNIPROTKB\|Q0DVX2 LOC_Os03g01830 "DEAD-box ATP-dependent RNA helicase 50" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2118509 RH39 "RH39" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q83DM8 rhlE "ATP-dependent RNA helicase" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_0670 CBU_0670 "ATP-dependent RNA helicase RhlE, putative" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KS53 VC1407 "ATP-dependent RNA helicase RhlE" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_1407 VC_1407 "ATP-dependent RNA helicase RhlE" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_1125 CPS_1125 "ATP-dependent RNA helicase, DEAD box family" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-061013-64 ddx28 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 28" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_3783 SO_3783 "ATP-dependent RNA helicase, DEAD box family" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		439
cd00268		203	cd00268, DEADc, DEAD-box helicases	3e-40
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	2e-39
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	1e-28
PRK11192		434	PRK11192, PRK11192, ATP-dependent RNA helicase Srm	2e-28
PRK10590		456	PRK10590, PRK10590, ATP-dependent RNA helicase Rhl	1e-24
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	2e-24
PTZ00110		545	PTZ00110, PTZ00110, helicase; Provisional	4e-22
PRK04837		423	PRK04837, PRK04837, ATP-dependent RNA helicase Rhl	5e-20
PRK11634		629	PRK11634, PRK11634, ATP-dependent RNA helicase Dea	6e-20
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	1e-19
PLN00206		518	PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel	1e-19
PRK04537		572	PRK04537, PRK04537, ATP-dependent RNA helicase Rhl	4e-17
PRK11776		460	PRK11776, PRK11776, ATP-dependent RNA helicase Dbp	3e-14
PTZ00424		401	PTZ00424, PTZ00424, helicase 45; Provisional	4e-13
PRK01297		475	PRK01297, PRK01297, ATP-dependent RNA helicase Rhl	7e-13
COG1201		814	COG1201, Lhr, Lhr-like helicases [General function	4e-06
TIGR03817		742	TIGR03817, DECH_helic, helicase/secretion neighbor	5e-06
COG1204		766	COG1204, COG1204, Superfamily II helicase [General	7e-05
COG1205		851	COG1205, COG1205, Distinct helicase family with a	4e-04
COG1199		654	COG1199, DinG, Rad3-related DNA helicases [Transcr	0.001

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

 Score =  142 bits (360), Expect = 3e-40
 Identities = 53/153 (34%), Positives = 85/153 (55%), Gaps = 8/153 (5%)

Query: 270 FKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQR 329
           F+ELG S  ++  +    F +P+ IQA A PP++ G+  I   Q+GSGKT A+L+P++++
Sbjct: 1   FEELGLSPELLRGIYALGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEK 60

Query: 330 LRQEELQGLSKSTSGSPRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQ 389
           L               P+ +ILAPT ELA Q+    R L K     + +V+ GG     Q
Sbjct: 61  L-------DPSPKKDGPQALILAPTRELALQIAEVARKLGKHT-NLKVVVIYGGTSIDKQ 112

Query: 390 LENLQEGVDVLIATPGRFMFLIKEGILQLINLR 422
           +  L+ G  +++ATPGR + L++ G L L  ++
Sbjct: 113 IRKLKRGPHIVVATPGRLLDLLERGKLDLSKVK 145

A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>gnl\|CDD\|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|240273 PTZ00110, PTZ00110, helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>gnl\|CDD\|185609 PTZ00424, PTZ00424, helicase 45; Provisional	Back alignment and domain information

>gnl\|CDD\|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>gnl\|CDD\|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		439
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	99.98
PTZ00110		545	helicase; Provisional	99.97
KOG0347		731	consensus RNA helicase [RNA processing and modific	99.97
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	99.97
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	99.97
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	99.97
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	99.97
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	99.97
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	99.97
KOG0346		569	consensus RNA helicase [RNA processing and modific	99.97
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	99.97
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	99.97
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	99.97
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	99.97
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	99.97
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	99.96
KOG0334		997	consensus RNA helicase [RNA processing and modific	99.96
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	99.96
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	99.96
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	99.96
KOG0343		758	consensus RNA Helicase [RNA processing and modific	99.96
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	99.95
PTZ00424		401	helicase 45; Provisional	99.95
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	99.94
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.94
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	99.93
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	99.93
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	99.92
KOG4284		980	consensus DEAD box protein [Transcription]	99.92
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	99.92
KOG0327		397	consensus Translation initiation factor 4F, helica	99.91
PRK02362		737	ski2-like helicase; Provisional	99.9
PRK00254		720	ski2-like helicase; Provisional	99.9
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.88
PRK13767		876	ATP-dependent helicase; Provisional	99.88
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	99.88
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.87
PRK01172		674	ski2-like helicase; Provisional	99.87
COG1201		814	Lhr Lhr-like helicases [General function predictio	99.85
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	99.82
PRK09401		1176	reverse gyrase; Reviewed	99.82
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	99.81
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	99.81
COG1205		851	Distinct helicase family with a unique C-terminal	99.8
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	99.8
PRK14701		1638	reverse gyrase; Provisional	99.8
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	99.8
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	99.8
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	99.79
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	99.77
PRK10689		1147	transcription-repair coupling factor; Provisional	99.75
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	99.75
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	99.75
COG1204		766	Superfamily II helicase [General function predicti	99.71
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.69
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.69
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.69
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	99.68
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	99.66
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.66
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.65
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.62
PHA02558		501	uvsW UvsW helicase; Provisional	99.6
PRK05580		679	primosome assembly protein PriA; Validated	99.59
COG1202		830	Superfamily II helicase, archaea-specific [General	99.59
PRK13766		773	Hef nuclease; Provisional	99.57
PHA02653		675	RNA helicase NPH-II; Provisional	99.52
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.51
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.48
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.48
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.48
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	99.47
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	99.44
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.41
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.4
KOG0354		746	consensus DEAD-box like helicase [General function	99.39
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.37
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	99.35
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.31
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.25
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	99.24
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.21
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.18
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.18
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	99.17
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.1
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	99.09
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.09
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	99.07
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	99.07
PRK09694		878	helicase Cas3; Provisional	98.97
KOG0353		695	consensus ATP-dependent DNA helicase [General func	98.96
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	98.93
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	98.92
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	98.92
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	98.89
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	98.89
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	98.88
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	98.8
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	98.8
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	98.72
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	98.69
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	98.69
PRK12326		764	preprotein translocase subunit SecA; Reviewed	98.65
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	98.62
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	98.56
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	98.54
COG1198		730	PriA Primosomal protein N' (replication factor Y)	98.54
CHL00122		870	secA preprotein translocase subunit SecA; Validate	98.46
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	98.46
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	98.45
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	98.44
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	98.36
COG4096		875	HsdR Type I site-specific restriction-modification	98.34
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	98.33
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.26
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	98.25
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	98.15
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	98.07
PF14617		252	CMS1: U3-containing 90S pre-ribosomal complex subu	97.97
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	97.81
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	97.79
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	97.78
COG4889		1518	Predicted helicase [General function prediction on	97.69
PRK14873		665	primosome assembly protein PriA; Provisional	97.65
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	97.63
PRK04914		956	ATP-dependent helicase HepA; Validated	97.57
PRK15483		986	type III restriction-modification system StyLTI en	97.55
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	97.54
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.49
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	97.38
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	97.31
TIGR00376		637	DNA helicase, putative. The gene product may repre	97.23
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	97.2
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	97.15
KOG1803		649	consensus DNA helicase [Replication, recombination	97.15
KOG1123		776	consensus RNA polymerase II transcription initiati	97.12
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	97.08
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.05
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	97.05
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	97.0
KOG2340		698	consensus Uncharacterized conserved protein [Funct	96.95
PF13245		76	AAA_19: Part of AAA domain	96.92
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	96.75
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	96.67
KOG0387		923	consensus Transcription-coupled repair protein CSB	96.64
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	96.58
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	96.55
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	96.32
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	96.3
COG0610		962	Type I site-specific restriction-modification syst	96.27
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	96.23
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	96.14
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	96.06
PRK13889		988	conjugal transfer relaxase TraA; Provisional	95.94
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	95.93
KOG4439		901	consensus RNA polymerase II transcription terminat	95.89
KOG1002		791	consensus Nucleotide excision repair protein RAD16	95.86
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	95.82
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	95.74
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	95.69
PRK10875		615	recD exonuclease V subunit alpha; Provisional	95.63
COG3587		985	Restriction endonuclease [Defense mechanisms]	95.59
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	95.44
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	95.42
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	95.17
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	94.98
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	94.9
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	94.87
KOG1805		1100	consensus DNA replication helicase [Replication, r	94.71
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	94.51
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	94.44
PRK04296		190	thymidine kinase; Provisional	94.32
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	94.25
smart00382		148	AAA ATPases associated with a variety of cellular	94.2
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	94.17
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	94.16
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	94.14
PRK13826		1102	Dtr system oriT relaxase; Provisional	93.67
PRK11054		684	helD DNA helicase IV; Provisional	93.59
COG1484		254	DnaC DNA replication protein [DNA replication, rec	93.48
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	93.47
PRK05298		652	excinuclease ABC subunit B; Provisional	93.42
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	93.41
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	93.23
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	93.09
PRK06526		254	transposase; Provisional	92.98
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	92.98
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	92.82
PRK10536		262	hypothetical protein; Provisional	92.37
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	92.34
PRK08181		269	transposase; Validated	92.02
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	91.97
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	91.96
PRK10689		1147	transcription-repair coupling factor; Provisional	91.82
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	91.76
PRK13833		323	conjugal transfer protein TrbB; Provisional	91.39
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	91.09
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	91.03
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	91.03
cd01126		384	TraG_VirD4 The TraG/TraD/VirD4 family are bacteria	90.88
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	90.87
PHA02533		534	17 large terminase protein; Provisional	90.81
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	90.71
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	90.61
PRK12402		337	replication factor C small subunit 2; Reviewed	90.47
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	90.27
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	90.17
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	89.95
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	89.94
KOG1131		755	consensus RNA polymerase II transcription initiati	89.81
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	89.81
PRK08727		233	hypothetical protein; Validated	89.79
COG3973		747	Superfamily I DNA and RNA helicases [General funct	89.73
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	89.73
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	89.72
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	89.68
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	89.56
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	89.51
PRK07952		244	DNA replication protein DnaC; Validated	89.43
PF02534		469	T4SS-DNA_transf: Type IV secretory system Conjugat	89.37
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	89.32
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	88.57
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	88.49
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	88.33
PF06733		174	DEAD_2: DEAD_2; InterPro: IPR010614 This represent	88.32
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	88.25
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	88.19
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	88.06
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	88.06
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	88.01
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	87.85
PRK00411		394	cdc6 cell division control protein 6; Reviewed	87.82
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	87.77
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	87.72
PRK13897		606	type IV secretion system component VirD4; Provisio	87.65
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	87.64
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	87.6
COG4185		187	Uncharacterized protein conserved in bacteria [Fun	87.55
PLN03025		319	replication factor C subunit; Provisional	87.49
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	87.19
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	87.05
KOG3089		271	consensus Predicted DEAD-box-containing helicase [	86.99
PRK13851		344	type IV secretion system protein VirB11; Provision	86.84
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	86.62
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	86.61
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	86.14
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	86.09
PRK14087		450	dnaA chromosomal replication initiation protein; P	85.91
PHA00729		226	NTP-binding motif containing protein	85.74
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	85.69
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	85.47
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	85.45
PRK13764		602	ATPase; Provisional	85.33
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	85.21
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	85.13
PTZ00112		1164	origin recognition complex 1 protein; Provisional	85.13
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	85.12
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	85.05
PRK08903		227	DnaA regulatory inactivator Hda; Validated	85.02
PRK13850		670	type IV secretion system protein VirD4; Provisiona	84.94
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	84.93
TIGR00064		272	ftsY signal recognition particle-docking protein F	84.92
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	84.86
PRK13880		636	conjugal transfer coupling protein TraG; Provision	84.67
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	84.55
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	84.16
PRK04195		482	replication factor C large subunit; Provisional	84.0
PRK00149		450	dnaA chromosomal replication initiation protein; R	83.77
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	83.61
PRK08084		235	DNA replication initiation factor; Provisional	83.51
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	83.36
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	83.26
COG0630		312	VirB11 Type IV secretory pathway, VirB11 component	82.93
TIGR00959		428	ffh signal recognition particle protein. This mode	82.78
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	82.51
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	82.47
PRK14974		336	cell division protein FtsY; Provisional	82.45
PRK10436		462	hypothetical protein; Provisional	82.45
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	82.19
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	82.08
PRK13876		663	conjugal transfer coupling protein TraG; Provision	82.02
PRK06893		229	DNA replication initiation factor; Validated	82.01
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	81.97
PRK06835		329	DNA replication protein DnaC; Validated	81.96
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	81.88
cd01127		410	TrwB Bacterial conjugation protein TrwB, ATP bindi	81.86
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	81.83
PF12846		304	AAA_10: AAA-like domain	81.78
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	81.65
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	81.41
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	81.29
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	81.25
PF03237		384	Terminase_6: Terminase-like family; InterPro: IPR0	81.2
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	81.14
PRK11823		446	DNA repair protein RadA; Provisional	81.13
PHA03333		752	putative ATPase subunit of terminase; Provisional	81.12
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	81.11
PRK00440		319	rfc replication factor C small subunit; Reviewed	81.04
PF10412		386	TrwB_AAD_bind: Type IV secretion-system coupling p	80.89
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	80.86
PRK13822		641	conjugal transfer coupling protein TraG; Provision	80.49
PRK05642		234	DNA replication initiation factor; Validated	80.45
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	80.29
PTZ00110		545	helicase; Provisional	80.28
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	80.18
TIGR03819		340	heli_sec_ATPase helicase/secretion neighborhood AT	80.18
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	80.1
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	80.03

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=1.1e-35  Score=312.22  Aligned_cols=169  Identities=40%  Similarity=0.631  Sum_probs=155.4

Q ss_pred             ccccccccCCCHHHHHHHHHCCCCCCCHHHHHHhhhHhcCCcEEEEcCCCCCcceeehhHHHHHHHHHHhhccCCCCCCC
Q 013623          266 SRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQGLSKSTSGS  345 (439)
Q Consensus       266 s~~sF~elgL~~~Ll~aL~~~gf~~pTpIQ~~aIP~iLsGrDvli~ApTGSGKTlaylLPiL~~l~~~~~~~~~~~~~~g  345 (439)
                      +...|.+++|+++++.+|+..||..|||||.++||.+++|+|++++|.|||||||+|++|++.++....   .......+
T Consensus        89 ~~~~f~~~~ls~~~~~~lk~~g~~~PtpIQaq~wp~~l~GrD~v~iA~TGSGKTLay~lP~i~~l~~~~---~~~~~~~~  165 (519)
T KOG0331|consen   89 SSAAFQELGLSEELMKALKEQGFEKPTPIQAQGWPIALSGRDLVGIARTGSGKTLAYLLPAIVHLNNEQ---GKLSRGDG  165 (519)
T ss_pred             cchhhhcccccHHHHHHHHhcCCCCCchhhhcccceeccCCceEEEeccCCcchhhhhhHHHHHHHhcc---ccccCCCC
Confidence            345899999999999999999999999999999999999999999999999999999999999998631   23455679


Q ss_pred             CeEEEEcCcHHHHHHHHHHHHhhhcCCCCceEEEEECCCChHHHHHHhcCCCcEEEEChHHHHHHHHhCCCCCCCcccEE
Q 013623          346 PRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRWYA  425 (439)
Q Consensus       346 p~aLILvPTrELA~Qi~~~l~~L~k~~~~i~v~~l~Gg~~~~~q~~~L~~g~dILVaTPgrLldlL~~~~l~L~~Lr~LV  425 (439)
                      |++|||+||||||.||...+..++. ...++++|+|||.+...|+..++++++|+|||||||+++|+++.++|.+|.|||
T Consensus       166 P~vLVL~PTRELA~QV~~~~~~~~~-~~~~~~~cvyGG~~~~~Q~~~l~~gvdiviaTPGRl~d~le~g~~~l~~v~ylV  244 (519)
T KOG0331|consen  166 PIVLVLAPTRELAVQVQAEAREFGK-SLRLRSTCVYGGAPKGPQLRDLERGVDVVIATPGRLIDLLEEGSLNLSRVTYLV  244 (519)
T ss_pred             CeEEEEcCcHHHHHHHHHHHHHHcC-CCCccEEEEeCCCCccHHHHHHhcCCcEEEeCChHHHHHHHcCCccccceeEEE
Confidence            9999999999999999999999998 467899999999999999999999999999999999999999999999999999


Q ss_pred             EeCCc-----cchhhhcc
Q 013623          426 RTASL-----NIESHFSY  438 (439)
Q Consensus       426 lDEAD-----~fe~~~~~  438 (439)
                      |||||     .|+++++.
T Consensus       245 LDEADrMldmGFe~qI~~  262 (519)
T KOG0331|consen  245 LDEADRMLDMGFEPQIRK  262 (519)
T ss_pred             eccHHhhhccccHHHHHH
Confidence            99997     45555544

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK13897 type IV secretion system component VirD4; Provisional	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>COG4185 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3089 consensus Predicted DEAD-box-containing helicase [General function prediction only]	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK13850 type IV secretion system protein VirD4; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK13880 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>PRK13876 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging []	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13822 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		439
1wrb_A		253	Crystal Structure Of The N-Terminal Reca-Like Domai		1e-20
3iuy_A		228	Crystal Structure Of Ddx53 Dead-Box Domain Length =		1e-18
2gxq_A		207	Hera N-Terminal Domain In Complex With Amp, Crystal		2e-17
3mwj_A		207	Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap		4e-17
4a4d_A		253	Crystal Structure Of The N-Terminal Domain Of The H		3e-16
3fe2_A		242	Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D		3e-16
2db3_A		434	Structural Basis For Rna Unwinding By The Dead-Box		2e-15
2i4i_A		417	Crystal Structure Of Human Dead-Box Rna Helicase Dd		1e-14
1q0u_A		219	Crystal Structure Of The Bstdead N-Terminal Domain		4e-14
2kbe_A		226	Solution Structure Of Amino-Terminal Domain Of Dbp5		1e-13
3ber_A		249	Human Dead-Box Rna-Helicase Ddx47, Conserved Domain		2e-13
3ly5_A		262	Ddx18 Dead-Domain Length = 262		2e-13
1vec_A		206	Crystal Structure Of The N-Terminal Domain Of RckP5		4e-13
3pew_A		395	S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3		4e-13
3pey_A		395	S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length		5e-13
1hv8_A		367	Crystal Structure Of A Dead Box Protein From The Hy		6e-12
1s2m_A		400	Crystal Structure Of The Dead Box Protein Dhh1p Len		8e-12
3dkp_A		245	Human Dead-Box Rna-Helicase Ddx52, Conserved Domain		8e-12
2pl3_A		236	Human Dead-Box Rna Helicase Ddx10, Dead Domain In C		1e-10
2z0m_A		337	Crystal Structure Of Hypothetical Atp-Dependent Rna		3e-10
3eiq_A		414	Crystal Structure Of Pdcd4-eif4a Length = 414		4e-09
2j0u_B		374	The Crystal Structure Of Eif4aiii-Barentsz Complex		5e-09
2zu6_A		388	Crystal Structure Of The Eif4a-Pdcd4 Complex Length		6e-09
2j0q_A		410	The Crystal Structure Of The Exon Junction Complex		2e-08
2j0u_A		374	The Crystal Structure Of Eif4aiii-Barentsz Complex		2e-08
2xb2_A		411	Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar		2e-08
3bor_A		237	Crystal Structure Of The Deadc Domain Of Human Tran		2e-08
2hyi_C		413	Structure Of The Human Exon Junction Complex With A		2e-08
2hxy_A		391	Crystal Structure Of Human Apo-Eif4aiii Length = 39		3e-08
2vso_A		395	Crystal Structure Of A Translation Initiation Compl		1e-07
1qde_A		224	Crystal Structure Of The Atpase Domain Of Translati		1e-07
1qva_A		223	Yeast Initiation Factor 4a N-Terminal Domain Length		1e-07
2g9n_A		221	Structure Of The Dead Domain Of Human Eukaryotic In		3e-07
1fuu_A		394	Yeast Initiation Factor 4a Length = 394		4e-07
1xtj_A		386	Structure Of Human Uap56 In Complex With Adp Length		4e-07
1xti_A		391	Structure Of Wildtype Human Uap56 Length = 391		4e-07
1xtk_A		390	Structure Of Decd To Dead Mutation Of Human Uap56 L		4e-07
1t6n_A		220	Crystal Structure Of The N-Terminal Domain Of Human		8e-07
3fmp_B		479	Crystal Structure Of The Nucleoporin Nup214 In Comp		8e-06
3fht_A		412	Crystal Structure Of Human Dbp5 In Complex With Amp		9e-06
3fmo_B		300	Crystal Structure Of The Nucleoporin Nup214 In Comp		9e-06
3ews_A		445	Human Dead-Box Rna-Helicase Ddx19 In Complex With A		1e-05
3g0h_A		424	Human Dead-box Rna Helicase Ddx19, In Complex With		1e-05
2oxc_A		230	Human Dead-Box Rna Helicase Ddx20, Dead Domain In C		1e-05
3fhc_B		235	Crystal Structure Of Human Dbp5 In Complex With Nup		2e-05
3sqw_A		579	Structure Of Mss116p (Nte Deletion) Bound To Ssrna		2e-05
3i5x_A		563	Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len		3e-05
3sqx_A		512	Structure Of Mss116p (Nte And C-Tail Double Deletio		4e-05

>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253