Citrus Sinensis ID: 013746

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MAGSELQNSQNAQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVSEAEKLLKEAESAKETVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVDAIWKKTKDNVLKMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI
cccccccccccccccHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEccccccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccEEEEEcccccccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccEEccccHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccEEEEEEcccHHcccHHHHHHHHHHcccEEEc
cccccccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHcccccEEEEEHHHHHHHHccccHEEccccEEEEEEccccccHHHHHHHHHHHccccEEEEEcccccccccccHHHHHcEEEEccccccccEEEccHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccHHHEccHHHHHHHHHHHccccEEHHHcccccccccccccHHHHHHHHHHcccEEEEEEEEEccccccccHHHHccccEEEEEEccHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccccccEEEEcccccccccccHHHHHHEEcccccEEEEEEccHHHHHHHHHHHHHHHccccEEEc
magselqnsqnaqidgNTLAAKSLSLFGathmfgvvgipvTSLANRAVQLGVRFIAFHNEQSAGYAASAygyltgkpgilltvsgpgcvhglaglsngmintWPIVMisgscdqkdfgrgdfqeldqveavkpfskFAVKAKDITEVPKCVAQVLERAvsgrpggcyldlptdvlhqTISVSEAEKLLKEAESAKETvtqggivnsDIDKAVSLLKEAkkplivfgkGAAYARAEGELKKLVEstgipflptpmgkgllpdthplAATAARSLAIGQCDVALVVGARLNWllhfgeppkwskdvKFVLVDAIWKKTKDNVLKMEVQLAKDvvpfnfmtpMRIIRDAilgvgspapilvsegantmDVGRAVLVqteprcrldagtwgtmGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI
MAGSELQNSQNAQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFavkakditevPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVSEAEKLLKEAESAketvtqggivnsdIDKAVSLLKEakkplivfgKGAAYARAEGELKKLVESTGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHfgeppkwskdvKFVLVDAIWKKTKDNVLKMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI
MAGSELQNSQNAQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQsagyaasaygyLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVseaekllkeaesakeTVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVDAIWKKTKDNVLKMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI
******************LAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVS*****************QGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVDAIWKKTKDNVLKMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMI***
******************LAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVSEAEKLLK*************IVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVDAIWKKTKDNVLKMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI
***********AQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVSEAEKLLKEAESAKETVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVDAIWKKTKDNVLKMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI
*************IDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVSEAEKLLKEAESAKETVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVDAIWKKTKDNVLKMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGSELQNSQNAQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISxxxxxxxxxxxxxxxxxxxxxGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVDAIWKKTKDNVLKMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
Q9LF46572 2-hydroxyacyl-CoA lyase O yes no 0.942 0.720 0.715 0.0
Q8CHM7581 2-hydroxyacyl-CoA lyase 1 yes no 0.938 0.705 0.404 3e-97
Q9UJ83578 2-hydroxyacyl-CoA lyase 1 yes no 0.945 0.714 0.401 1e-96
Q9QXE0581 2-hydroxyacyl-CoA lyase 1 yes no 0.940 0.707 0.397 8e-96
P40149568 Oxalyl-CoA decarboxylase N/A no 0.947 0.728 0.392 8e-88
P0AFI0564 Probable oxalyl-CoA decar N/A no 0.924 0.716 0.402 7e-83
P0AFI1564 Probable oxalyl-CoA decar N/A no 0.924 0.716 0.402 7e-83
Q9Y7M1568 Putative 2-hydroxyacyl-Co yes no 0.924 0.711 0.409 2e-77
P39994560 Putative 2-hydroxyacyl-Co yes no 0.915 0.714 0.382 3e-75
Q54DA9 580 Probable 2-hydroxyacyl-Co yes no 0.659 0.496 0.447 2e-70
>sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=2 SV=1 Back     alignment and function desciption
 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/457 (71%), Positives = 368/457 (80%), Gaps = 45/457 (9%)

Query: 14  IDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYL 73
           IDGN L AKSLS  G THMFGVVGIPVTSLA+RA+ LG+RFIAFHNEQSAGYAASAYGYL
Sbjct: 12  IDGNVLVAKSLSHLGVTHMFGVVGIPVTSLASRAMALGIRFIAFHNEQSAGYAASAYGYL 71

Query: 74  TGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKP 133
           TGKPGILLTVSGPGCVHGLAGLSN  +NTWP+VMISGSCDQ+D GRGDFQELDQ+EAVK 
Sbjct: 72  TGKPGILLTVSGPGCVHGLAGLSNAWVNTWPMVMISGSCDQRDVGRGDFQELDQIEAVKA 131

Query: 134 FSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVSEAEKLLKEAES 193
           FSK + KAKD+ E+P CV++VL+RAVSGRPGGCYLD+PTDVL Q IS SEA+KL+ E E 
Sbjct: 132 FSKLSEKAKDVREIPDCVSRVLDRAVSGRPGGCYLDIPTDVLRQKISESEADKLVDEVER 191

Query: 194 AKETVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPTP 253
           +++     G + S+I+ AVSLL++A++PLIVFGKGAAY+RAE ELKKLVE TGIPFLPTP
Sbjct: 192 SRKEEPIRGSLRSEIESAVSLLRKAERPLIVFGKGAAYSRAEDELKKLVEITGIPFLPTP 251

Query: 254 MGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVD--- 310
           MGKGLLPDTH  +ATAARSLAIG+CDVALVVGARLNWLLHFGE PKW KDVKF+LVD   
Sbjct: 252 MGKGLLPDTHEFSATAARSLAIGKCDVALVVGARLNWLLHFGESPKWDKDVKFILVDVSE 311

Query: 311 ------------------------------------------AIWKKTKDNVLKMEVQLA 328
                                                     +I KK K+N  KME+QLA
Sbjct: 312 EEIELRKPHLGIVGDAKTVIGLLNREIKDDPFCLGKSNSWVESISKKAKENGEKMEIQLA 371

Query: 329 KDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGT 388
           KDVVPFNF+TPMRIIRDAIL V  P+P++VSEGANTMDVGR+VLVQ EPR RLDAGTWGT
Sbjct: 372 KDVVPFNFLTPMRIIRDAILAVEGPSPVVVSEGANTMDVGRSVLVQKEPRTRLDAGTWGT 431

Query: 389 MGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVE 425
           MGVGLGYCIAAA+A P+RLVVAVEGDSGFGFSA+EVE
Sbjct: 432 MGVGLGYCIAAAVASPDRLVVAVEGDSGFGFSAMEVE 468
Catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 Back     alignment and function description
>sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 Back     alignment and function description
>sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 Back     alignment and function description
>sp|P0AFI0|OXC_ECOLI Probable oxalyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=oxc PE=1 SV=1 Back     alignment and function description
>sp|P0AFI1|OXC_ECO57 Probable oxalyl-CoA decarboxylase OS=Escherichia coli O157:H7 GN=oxc PE=3 SV=1 Back     alignment and function description
>sp|Q9Y7M1|YGK4_SCHPO Putative 2-hydroxyacyl-CoA lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.04 PE=3 SV=1 Back     alignment and function description
>sp|P39994|YEC0_YEAST Putative 2-hydroxyacyl-CoA lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL020C PE=1 SV=1 Back     alignment and function description
>sp|Q54DA9|HACL1_DICDI Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
449529020 578 PREDICTED: 2-hydroxyacyl-CoA lyase-like 0.961 0.726 0.730 0.0
225462809 575 PREDICTED: 2-hydroxyacyl-CoA lyase [Viti 0.972 0.739 0.711 0.0
255574292 574 2-hydroxyphytanoyl-CoA lyase, putative [ 0.972 0.740 0.723 0.0
147782269 575 hypothetical protein VITISV_044048 [Viti 0.972 0.739 0.704 0.0
356553206 566 PREDICTED: 2-hydroxyacyl-CoA lyase-like 0.945 0.729 0.728 0.0
449467435 574 PREDICTED: LOW QUALITY PROTEIN: 2-hydrox 0.951 0.724 0.721 0.0
211906508 565 pyruvate decarboxylase [Gossypium hirsut 0.942 0.729 0.748 0.0
12049590 572 Oxalyl-CoA decarboxylase [Arabidopsis th 0.945 0.722 0.713 0.0
15237954 572 2-hydroxyacyl-CoA lyase [Arabidopsis tha 0.942 0.720 0.715 0.0
429840542 588 pyruvate decarboxylase 3, partial [Diosp 0.956 0.710 0.711 0.0
>gi|449529020|ref|XP_004171499.1| PREDICTED: 2-hydroxyacyl-CoA lyase-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/467 (73%), Positives = 374/467 (80%), Gaps = 47/467 (10%)

Query: 6   LQNSQNAQ--IDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSA 63
           LQN    Q  IDGN LAA +L+  G   MFGVVGIPVTSLA RAV LG+RFIAFHNEQSA
Sbjct: 8   LQNDLRFQGPIDGNVLAAMALARCGVDRMFGVVGIPVTSLATRAVSLGIRFIAFHNEQSA 67

Query: 64  GYAASAYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQ 123
           GYAASAYGYLTG+PG+LLTVSGPGCVHGLAG+SN M+N WP+VMISGSCDQ+DFGRGDFQ
Sbjct: 68  GYAASAYGYLTGRPGVLLTVSGPGCVHGLAGVSNAMVNAWPLVMISGSCDQRDFGRGDFQ 127

Query: 124 ELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVSE 183
           ELDQVEAVKPFSK +VKA DI+E+P CVA+VL  AVSGRPGGCY DLP+DVLHQTIS SE
Sbjct: 128 ELDQVEAVKPFSKISVKATDISEIPNCVARVLNSAVSGRPGGCYFDLPSDVLHQTISESE 187

Query: 184 AEKLLKEAESAKETVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVE 243
           AE+LL  AE          + NS I++A+SLLK A++PLIVFGKGAA ARAEG LKKLVE
Sbjct: 188 AERLLVAAEEFARREVIPRVPNSQIEEAISLLKHAERPLIVFGKGAALARAEGPLKKLVE 247

Query: 244 STGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKD 303
           +TGIPFLPTPMGKGLLPDTH LAATAARSLAIG+CDVALVVGARLNWLLHFGEPPKWSKD
Sbjct: 248 TTGIPFLPTPMGKGLLPDTHELAATAARSLAIGKCDVALVVGARLNWLLHFGEPPKWSKD 307

Query: 304 VKFVLVD---------------------------------------------AIWKKTKD 318
           VKF+LVD                                             AI +K KD
Sbjct: 308 VKFILVDICKEEVELRNPHLGLIGDAKEVLESINKEIKDDPFCLGKSHPWVEAISQKAKD 367

Query: 319 NVLKMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPR 378
           NV KME+QLA+DVVPFNF+TPMRIIRDAIL +GSPAPILVSEGANTMDVGR+VLVQTEPR
Sbjct: 368 NVAKMELQLARDVVPFNFLTPMRIIRDAILALGSPAPILVSEGANTMDVGRSVLVQTEPR 427

Query: 379 CRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVE 425
            RLDAGTWGTMGVGLGYCIAAA+A P+RLVVAVEGDSGFGFSA+EVE
Sbjct: 428 TRLDAGTWGTMGVGLGYCIAAAVASPDRLVVAVEGDSGFGFSAMEVE 474

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225462809|ref|XP_002266004.1| PREDICTED: 2-hydroxyacyl-CoA lyase [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574292|ref|XP_002528060.1| 2-hydroxyphytanoyl-CoA lyase, putative [Ricinus communis] gi|223532521|gb|EEF34310.1| 2-hydroxyphytanoyl-CoA lyase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147782269|emb|CAN69570.1| hypothetical protein VITISV_044048 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553206|ref|XP_003544949.1| PREDICTED: 2-hydroxyacyl-CoA lyase-like [Glycine max] Back     alignment and taxonomy information
>gi|449467435|ref|XP_004151428.1| PREDICTED: LOW QUALITY PROTEIN: 2-hydroxyacyl-CoA lyase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|211906508|gb|ACJ11747.1| pyruvate decarboxylase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|12049590|emb|CAC19854.1| Oxalyl-CoA decarboxylase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15237954|ref|NP_197240.1| 2-hydroxyacyl-CoA lyase [Arabidopsis thaliana] gi|75174050|sp|Q9LF46.1|HACL_ARATH RecName: Full=2-hydroxyacyl-CoA lyase; AltName: Full=2-hydroxyphytanoyl-CoA lyase; Short=2-HPCL; AltName: Full=Oxalyl-CoA decarboxylase gi|9755761|emb|CAC01733.1| 2-hydroxyphytanoyl-CoA lyase-like protein [Arabidopsis thaliana] gi|20466616|gb|AAM20625.1| 2-hydroxyphytanoyl-CoA lyase-like protein [Arabidopsis thaliana] gi|23198152|gb|AAN15603.1| 2-hydroxyphytanoyl-CoA lyase-like protein [Arabidopsis thaliana] gi|332005036|gb|AED92419.1| 2-hydroxyacyl-CoA lyase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|429840542|gb|AGA15798.1| pyruvate decarboxylase 3, partial [Diospyros kaki] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
TAIR|locus:2167205 572 AT5G17380 [Arabidopsis thalian 0.679 0.519 0.723 2.8e-163
UNIPROTKB|F1NYG7 574 HACL1 "Uncharacterized protein 0.693 0.527 0.396 7.1e-90
UNIPROTKB|F1MVP8 581 HACL1 "Uncharacterized protein 0.732 0.550 0.401 2.1e-88
RGD|619849 581 Hacl1 "2-hydroxyacyl-CoA lyase 0.729 0.549 0.401 5.6e-88
UNIPROTKB|Q9UJ83 578 HACL1 "2-hydroxyacyl-CoA lyase 0.743 0.562 0.389 2.4e-87
MGI|MGI:1929657 581 Hacl1 "2-hydroxyacyl-CoA lyase 0.736 0.554 0.393 3.1e-87
UNIPROTKB|E2R9K1 581 HACL1 "Uncharacterized protein 0.741 0.557 0.387 8.1e-87
UNIPROTKB|J9NS82 763 HACL1 "Uncharacterized protein 0.741 0.424 0.387 8.1e-87
ZFIN|ZDB-GENE-040426-2058 568 hacl1 "2-hydroxyacyl-CoA lyase 0.693 0.533 0.415 7.2e-86
UNIPROTKB|O53639 582 oxcA "PROBABLE OXALYL-CoA DECA 0.670 0.503 0.439 1.5e-85
TAIR|locus:2167205 AT5G17380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1119 (399.0 bits), Expect = 2.8e-163, Sum P(2) = 2.8e-163
 Identities = 215/297 (72%), Positives = 240/297 (80%)

Query:    14 IDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQXXXXXXXXXXXL 73
             IDGN L AKSLS  G THMFGVVGIPVTSLA+RA+ LG+RFIAFHNEQ           L
Sbjct:    12 IDGNVLVAKSLSHLGVTHMFGVVGIPVTSLASRAMALGIRFIAFHNEQSAGYAASAYGYL 71

Query:    74 TGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKP 133
             TGKPGILLTVSGPGCVHGLAGLSN  +NTWP+VMISGSCDQ+D GRGDFQELDQ+EAVK 
Sbjct:    72 TGKPGILLTVSGPGCVHGLAGLSNAWVNTWPMVMISGSCDQRDVGRGDFQELDQIEAVKA 131

Query:   134 FSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXXX 193
             FSK + KAKD+ E+P CV++VL+RAVSGRPGGCYLD+PTDVL Q IS             
Sbjct:   132 FSKLSEKAKDVREIPDCVSRVLDRAVSGRPGGCYLDIPTDVLRQKISESEADKLVDEVER 191

Query:   194 XXXTVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPTP 253
                     G + S+I+ AVSLL++A++PLIVFGKGAAY+RAE ELKKLVE TGIPFLPTP
Sbjct:   192 SRKEEPIRGSLRSEIESAVSLLRKAERPLIVFGKGAAYSRAEDELKKLVEITGIPFLPTP 251

Query:   254 MGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVD 310
             MGKGLLPDTH  +ATAARSLAIG+CDVALVVGARLNWLLHFGE PKW KDVKF+LVD
Sbjct:   252 MGKGLLPDTHEFSATAARSLAIGKCDVALVVGARLNWLLHFGESPKWDKDVKFILVD 308
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004737 "pyruvate decarboxylase activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016740 "transferase activity" evidence=IEA
GO:0030976 "thiamine pyrophosphate binding" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
GO:0046482 "para-aminobenzoic acid metabolic process" evidence=RCA
UNIPROTKB|F1NYG7 HACL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVP8 HACL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|619849 Hacl1 "2-hydroxyacyl-CoA lyase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJ83 HACL1 "2-hydroxyacyl-CoA lyase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1929657 Hacl1 "2-hydroxyacyl-CoA lyase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9K1 HACL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS82 HACL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2058 hacl1 "2-hydroxyacyl-CoA lyase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O53639 oxcA "PROBABLE OXALYL-CoA DECARBOXYLASE OXCA" [Mycobacterium tuberculosis H37Rv (taxid:83332)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LF46HACL_ARATH4, ., 1, ., -, ., -0.71550.94270.7202yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT5G17380
pyruvate decarboxylase family protein; pyruvate decarboxylase family protein; FUNCTIONS IN- pyruvate decarboxylase activity, magnesium ion binding, thiamin pyrophosphate binding, transferase activity, catalytic activity; LOCATED IN- cellular_component unknown; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- TPP-binding enzymes, conserved site (InterPro-IPR000399), Thiamine pyrophosphate enzyme, central region (InterPro-IPR012000), Thiamine pyrophosphate enzyme, N-terminal TPP binding region (InterPro-IPR012001), Thiamine pyrophosphate [...] (572 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT3G23940
dehydratase family; dehydratase family; FUNCTIONS IN- catalytic activity, dihydroxy-acid dehydr [...] (608 aa)
•     • 0.848
AT2G01490
phytanoyl-CoA dioxygenase (PhyH) family protein; phytanoyl-CoA dioxygenase (PhyH) family protei [...] (283 aa)
      • 0.788
AT5G19440
cinnamyl-alcohol dehydrogenase, putative (CAD); similar to Eucalyptus gunnii alcohol dehydrogen [...] (326 aa)
   •  • 0.776
AT5G16290
acetolactate synthase small subunit, putative; acetolactate synthase small subunit, putative; F [...] (477 aa)
•     • 0.711
AT1G72680.1-P
cinnamyl-alcohol dehydrogenase, putative; CINNAMYL-ALCOHOL DEHYDROGENASE (CAD1); FUNCTIONS IN- [...] (355 aa)
   •    0.661
IIL1
IIL1 (ISOPROPYL MALATE ISOMERASE LARGE SUBUNIT 1); 4 iron, 4 sulfur cluster binding / hydro-lya [...] (509 aa)
•     • 0.658
OMR1
OMR1 (L-O-METHYLTHREONINE RESISTANT 1); L-threonine ammonia-lyase; first enzyme in the biosynth [...] (592 aa)
•    •• 0.633
AT3G11340
UDP-glucoronosyl/UDP-glucosyl transferase family protein; UDP-glucoronosyl/UDP-glucosyl transfe [...] (447 aa)
   •  • 0.589
AT5G56350
pyruvate kinase, putative; pyruvate kinase, putative; FUNCTIONS IN- pyruvate kinase activity, p [...] (498 aa)
   •    0.565
AT2G31810
acetolactate synthase small subunit, putative; acetolactate synthase small subunit, putative; F [...] (491 aa)
•     • 0.563

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
PRK09259569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 1e-152
TIGR03254554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 1e-137
COG0028550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 2e-91
PRK05858542 PRK05858, PRK05858, hypothetical protein; Provisio 1e-56
PRK06276 586 PRK06276, PRK06276, acetolactate synthase catalyti 1e-47
TIGR00118558 TIGR00118, acolac_lg, acetolactate synthase, large 1e-43
cd07035155 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) bindin 2e-41
PRK06725570 PRK06725, PRK06725, acetolactate synthase 3 cataly 3e-40
PRK08266542 PRK08266, PRK08266, hypothetical protein; Provisio 4e-39
pfam02776172 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate en 3e-38
PRK07282566 PRK07282, PRK07282, acetolactate synthase catalyti 1e-37
PRK06048561 PRK06048, PRK06048, acetolactate synthase 3 cataly 4e-37
PRK08527563 PRK08527, PRK08527, acetolactate synthase 3 cataly 7e-37
PRK07710571 PRK07710, PRK07710, acetolactate synthase catalyti 9e-37
PRK08322 547 PRK08322, PRK08322, acetolactate synthase; Reviewe 3e-36
PRK06456 572 PRK06456, PRK06456, acetolactate synthase catalyti 3e-35
CHL00099 585 CHL00099, ilvB, acetohydroxyacid synthase large su 3e-35
cd02004172 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate 3e-35
PRK07418 616 PRK07418, PRK07418, acetolactate synthase 3 cataly 2e-34
PRK08155564 PRK08155, PRK08155, acetolactate synthase catalyti 3e-32
pfam00205136 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate en 5e-32
PRK06965 587 PRK06965, PRK06965, acetolactate synthase 3 cataly 1e-30
PRK09107 595 PRK09107, PRK09107, acetolactate synthase 3 cataly 1e-30
PRK07524535 PRK07524, PRK07524, hypothetical protein; Provisio 2e-30
PRK08979 572 PRK08979, PRK08979, acetolactate synthase 3 cataly 2e-30
PRK11269 591 PRK11269, PRK11269, glyoxylate carboligase; Provis 5e-30
PRK07525 588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 9e-30
PRK07789 612 PRK07789, PRK07789, acetolactate synthase 1 cataly 2e-29
PRK08617 552 PRK08617, PRK08617, acetolactate synthase; Reviewe 4e-29
PRK08611 576 PRK08611, PRK08611, pyruvate oxidase; Provisional 1e-28
PRK08199 557 PRK08199, PRK08199, thiamine pyrophosphate protein 1e-28
PRK08978 548 PRK08978, PRK08978, acetolactate synthase 2 cataly 2e-28
TIGR01504 588 TIGR01504, glyox_carbo_lig, glyoxylate carboligase 3e-28
TIGR03457 579 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acety 4e-28
TIGR02418 539 TIGR02418, acolac_catab, acetolactate synthase, ca 5e-28
PRK07979 574 PRK07979, PRK07979, acetolactate synthase 3 cataly 6e-28
PRK06154565 PRK06154, PRK06154, hypothetical protein; Provisio 2e-27
PLN02470 585 PLN02470, PLN02470, acetolactate synthase 6e-27
COG3960 592 COG3960, COG3960, Glyoxylate carboligase [General 1e-26
PRK06466 574 PRK06466, PRK06466, acetolactate synthase 3 cataly 2e-26
PRK06112 578 PRK06112, PRK06112, acetolactate synthase catalyti 2e-26
PRK06882 574 PRK06882, PRK06882, acetolactate synthase 3 cataly 3e-26
COG3961557 COG3961, COG3961, Pyruvate decarboxylase and relat 6e-24
PRK06457 549 PRK06457, PRK06457, pyruvate dehydrogenase; Provis 1e-23
TIGR02720 575 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase 2e-20
cd07039164 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding dom 3e-19
PRK08327569 PRK08327, PRK08327, acetolactate synthase catalyti 8e-16
PRK07064 544 PRK07064, PRK07064, hypothetical protein; Provisio 2e-15
COG3962 617 COG3962, COG3962, Acetolactate synthase [Amino aci 3e-15
PRK08273 597 PRK08273, PRK08273, thiamine pyrophosphate protein 4e-11
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) 6e-11
pfam02775151 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate en 2e-09
cd02010177 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) fam 4e-09
PRK06546 578 PRK06546, PRK06546, pyruvate dehydrogenase; Provis 3e-08
TIGR03393 539 TIGR03393, indolpyr_decarb, indolepyruvate decarbo 7e-08
PRK07525 588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 1e-07
cd02015186 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) fa 2e-07
cd02013196 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP 3e-07
cd07038162 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) b 3e-07
PRK08617552 PRK08617, PRK08617, acetolactate synthase; Reviewe 2e-06
cd06586154 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding 2e-06
PRK09124 574 PRK09124, PRK09124, pyruvate dehydrogenase; Provis 6e-06
TIGR02418539 TIGR02418, acolac_catab, acetolactate synthase, ca 7e-06
cd02014178 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) fam 1e-05
PLN02573 578 PLN02573, PLN02573, pyruvate decarboxylase 3e-05
PRK07092530 PRK07092, PRK07092, benzoylformate decarboxylase; 4e-05
PRK12474518 PRK12474, PRK12474, hypothetical protein; Provisio 9e-05
PRK08322547 PRK08322, PRK08322, acetolactate synthase; Reviewe 1e-04
TIGR03394 535 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylp 1e-04
PRK08978548 PRK08978, PRK08978, acetolactate synthase 2 cataly 3e-04
PRK08199557 PRK08199, PRK08199, thiamine pyrophosphate protein 0.001
PRK06466 574 PRK06466, PRK06466, acetolactate synthase 3 cataly 0.001
cd02002178 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) fa 0.001
PLN02470 585 PLN02470, PLN02470, acetolactate synthase 0.003
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information 
 Score =  444 bits (1143), Expect = e-152
 Identities = 205/465 (44%), Positives = 276/465 (59%), Gaps = 54/465 (11%)

Query: 9   SQNAQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAAS 68
            Q    DG  L   +L L G   ++GVVGIP+T LA  A   G+R+I F +EQSAG AA+
Sbjct: 5   DQLQLTDGFHLVIDALKLNGIDTIYGVVGIPITDLARLAQAEGIRYIGFRHEQSAGNAAA 64

Query: 69  AYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQK--DFGRGDFQELD 126
           A G+LT KPG+ LTVS PG ++GL  L+N   N +P++MISGS +++  D  +GD++ELD
Sbjct: 65  AAGFLTQKPGVCLTVSAPGFLNGLTALANATTNCFPMIMISGSSEREIVDLQQGDYEELD 124

Query: 127 QVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVSEAEK 186
           Q+ A KPF K A +     ++   VA+ +  AVSGRPGG YLDLP  VL QT+   EA  
Sbjct: 125 QLNAAKPFCKAAFRVNRAEDIGIGVARAIRTAVSGRPGGVYLDLPAKVLAQTMDADEALT 184

Query: 187 -LLKEAESAKETVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVEST 245
            L+K  + A   +         +D+A+ LLK+AK+PLI+ GKGAAYA+A+ ++++ VE T
Sbjct: 185 SLVKVVDPAPAQLPA----PEAVDRALDLLKKAKRPLIILGKGAAYAQADEQIREFVEKT 240

Query: 246 GIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVK 305
           GIPFLP  M KGLLPDTHP +A AARSLA+   DV L+VGARLNWLL  G+   W  D K
Sbjct: 241 GIPFLPMSMAKGLLPDTHPQSAAAARSLALANADVVLLVGARLNWLLSHGKGKTWGADKK 300

Query: 306 FVLVD--------------------------------------------AIWKKTKDNVL 321
           F+ +D                                            A+ ++ + N  
Sbjct: 301 FIQIDIEPQEIDSNRPIAAPVVGDIGSVMQALLAGLKQNTFKAPAEWLDALAERKEKNAA 360

Query: 322 KMEVQLAKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRL 381
           KM  +L+ D  P NF   +  IRD +    +P   LV+EGANT+D+ R ++   +PR RL
Sbjct: 361 KMAEKLSTDTQPMNFYNALGAIRDVL--KENPDIYLVNEGANTLDLARNIIDMYKPRHRL 418

Query: 382 DAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEV 426
           D GTWG MG+G+GY IAAA+    + VVA+EGDS FGFS +EVE 
Sbjct: 419 DCGTWGVMGIGMGYAIAAAVET-GKPVVAIEGDSAFGFSGMEVET 462

Length = 569
>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235629 PRK05858, PRK05858, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235766 PRK06276, PRK06276, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|232833 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>gnl|CDD|132918 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>gnl|CDD|180672 PRK06725, PRK06725, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181337 PRK08266, PRK08266, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|217224 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate enzyme, N-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181458 PRK08527, PRK08527, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236076 PRK07710, PRK07710, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|180569 PRK06456, PRK06456, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|214363 CHL00099, ilvB, acetohydroxyacid synthase large subunit Back     alignment and domain information
>gnl|CDD|238962 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|215786 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate enzyme, central domain Back     alignment and domain information
>gnl|CDD|180780 PRK06965, PRK06965, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236380 PRK09107, PRK09107, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181602 PRK08979, PRK08979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|183066 PRK11269, PRK11269, glyoxylate carboligase; Provisional Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|236098 PRK07789, PRK07789, acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236312 PRK08617, PRK08617, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|213633 TIGR01504, glyox_carbo_lig, glyoxylate carboligase Back     alignment and domain information
>gnl|CDD|132497 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic Back     alignment and domain information
>gnl|CDD|181185 PRK07979, PRK07979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|235718 PRK06154, PRK06154, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information
>gnl|CDD|226469 COG3960, COG3960, Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|235700 PRK06112, PRK06112, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|168717 PRK06882, PRK06882, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|226470 COG3961, COG3961, Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|180570 PRK06457, PRK06457, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|213733 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase Back     alignment and domain information
>gnl|CDD|132922 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>gnl|CDD|236243 PRK08327, PRK08327, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180820 PRK07064, PRK07064, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|226471 COG3962, COG3962, Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181344 PRK08273, PRK08273, thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>gnl|CDD|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|217223 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|238968 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>gnl|CDD|180614 PRK06546, PRK06546, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132434 TIGR03393, indolpyr_decarb, indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|238973 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>gnl|CDD|238971 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>gnl|CDD|132921 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>gnl|CDD|236312 PRK08617, PRK08617, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|181661 PRK09124, PRK09124, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic Back     alignment and domain information
>gnl|CDD|238972 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>gnl|CDD|215311 PLN02573, PLN02573, pyruvate decarboxylase Back     alignment and domain information
>gnl|CDD|235931 PRK07092, PRK07092, benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|139002 PRK12474, PRK12474, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|132435 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|238960 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 100.0
KOG1185571 consensus Thiamine pyrophosphate-requiring enzyme 100.0
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 100.0
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 100.0
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 100.0
PRK05858542 hypothetical protein; Provisional 100.0
PRK11269 591 glyoxylate carboligase; Provisional 100.0
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 100.0
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 100.0
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK08155564 acetolactate synthase catalytic subunit; Validated 100.0
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK08322547 acetolactate synthase; Reviewed 100.0
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 100.0
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 100.0
PLN02470 585 acetolactate synthase 100.0
PRK08617552 acetolactate synthase; Reviewed 100.0
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 100.0
PRK07525 588 sulfoacetaldehyde acetyltransferase; Validated 100.0
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 100.0
PRK07586514 hypothetical protein; Validated 100.0
PRK12474518 hypothetical protein; Provisional 100.0
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK08199557 thiamine pyrophosphate protein; Validated 100.0
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 100.0
PRK08273 597 thiamine pyrophosphate protein; Provisional 100.0
PRK07524535 hypothetical protein; Provisional 100.0
PRK06154565 hypothetical protein; Provisional 100.0
PRK06457 549 pyruvate dehydrogenase; Provisional 100.0
PRK08611 576 pyruvate oxidase; Provisional 100.0
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 100.0
PRK06546 578 pyruvate dehydrogenase; Provisional 100.0
PLN02573578 pyruvate decarboxylase 100.0
PRK09124 574 pyruvate dehydrogenase; Provisional 100.0
PRK08327569 acetolactate synthase catalytic subunit; Validated 100.0
PRK08266542 hypothetical protein; Provisional 100.0
PRK06112578 acetolactate synthase catalytic subunit; Validated 100.0
PRK07092530 benzoylformate decarboxylase; Reviewed 100.0
PRK07064544 hypothetical protein; Provisional 100.0
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 100.0
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 100.0
KOG4166 675 consensus Thiamine pyrophosphate-requiring enzyme 100.0
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 100.0
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 100.0
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 100.0
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 100.0
KOG1184561 consensus Thiamine pyrophosphate-requiring enzyme 100.0
COG3960 592 Glyoxylate carboligase [General function predictio 100.0
COG3962 617 Acetolactate synthase [Amino acid transport and me 100.0
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 100.0
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 100.0
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 100.0
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 100.0
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 100.0
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 100.0
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 100.0
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 99.97
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 99.96
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.93
TIGR03336 595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 99.91
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.89
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 99.87
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 99.85
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.85
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.84
cd02003 205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.83
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.83
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.82
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.82
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.8
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.78
PRK06163202 hypothetical protein; Provisional 99.74
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 99.72
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.7
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.68
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.67
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.67
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.67
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.65
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.6
cd03376 235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.59
cd02018 237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.57
PRK11867 286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.54
TIGR02177 287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.53
PRK05778 301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.51
PRK11869 280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.49
PRK09628 277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.45
PRK11866 279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.45
TIGR00315162 cdhB CO dehydrogenase/acetyl-CoA synthase complex, 99.4
PRK00945171 acetyl-CoA decarbonylase/synthase complex subunit 99.38
PRK08659376 2-oxoglutarate ferredoxin oxidoreductase subunit a 98.98
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 98.94
COG4032172 Predicted thiamine-pyrophosphate-binding protein [ 98.92
PRK07119352 2-ketoisovalerate ferredoxin reductase; Validated 98.91
TIGR03710562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 98.81
PRK08366390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 98.75
PRK09622407 porA pyruvate flavodoxin oxidoreductase subunit al 98.73
PRK08367394 porA pyruvate ferredoxin oxidoreductase subunit al 98.7
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 98.69
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 98.68
TIGR03181 341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 98.67
COG4231 640 Indolepyruvate ferredoxin oxidoreductase, alpha an 98.66
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 98.62
cd02000 293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 98.62
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 98.6
CHL00149 341 odpA pyruvate dehydrogenase E1 component alpha sub 98.5
TIGR03182 315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 98.43
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and relate 98.37
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 98.35
PRK05899 624 transketolase; Reviewed 98.31
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 98.31
PLN02374 433 pyruvate dehydrogenase (acetyl-transferring) 98.08
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.01
COG1880170 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon 98.0
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 97.85
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 97.84
PF02552167 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA sy 97.2
PRK11864 300 2-ketoisovalerate ferredoxin oxidoreductase subuni 96.52
PRK11865 299 pyruvate ferredoxin oxidoreductase subunit beta; P 96.46
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 96.44
COG1029 429 FwdB Formylmethanofuran dehydrogenase subunit B [E 96.34
PF13292 270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 96.18
PF02779178 Transket_pyr: Transketolase, pyrimidine binding do 96.08
cd02011 227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 95.99
PTZ00182355 3-methyl-2-oxobutanate dehydrogenase; Provisional 95.91
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 95.86
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 95.84
TIGR00232653 tktlase_bact transketolase, bacterial and yeast. T 95.67
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 95.52
PLN02790654 transketolase 95.48
smart00861168 Transket_pyr Transketolase, pyrimidine binding dom 95.34
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 95.32
PTZ00089661 transketolase; Provisional 95.31
PRK12753663 transketolase; Reviewed 95.22
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 95.2
cd02017 386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 95.16
PRK12754663 transketolase; Reviewed 95.13
PF00456 332 Transketolase_N: Transketolase, thiamine diphospha 95.12
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 95.08
PLN02790 654 transketolase 95.08
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 94.89
COG1013 294 PorB Pyruvate:ferredoxin oxidoreductase and relate 94.53
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 94.47
PRK09212327 pyruvate dehydrogenase subunit beta; Validated 94.38
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 94.38
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 94.36
PRK05444580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 94.32
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding 94.25
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 94.11
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 94.02
PRK12571641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 93.93
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 93.92
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 93.92
cd02761 415 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the 93.9
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 93.81
CHL00144327 odpB pyruvate dehydrogenase E1 component beta subu 93.8
TIGR00204617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 93.79
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 93.72
PRK12753 663 transketolase; Reviewed 93.71
PRK05261 785 putative phosphoketolase; Provisional 93.67
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 93.62
PF09364 379 XFP_N: XFP N-terminal domain; InterPro: IPR018970 93.59
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 93.56
PRK12754 663 transketolase; Reviewed 93.56
PTZ00089 661 transketolase; Provisional 93.55
PRK06163202 hypothetical protein; Provisional 93.42
PLN02582677 1-deoxy-D-xylulose-5-phosphate synthase 93.39
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 93.38
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 93.28
PRK05261785 putative phosphoketolase; Provisional 93.21
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 93.19
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 93.06
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 93.06
PRK05899624 transketolase; Reviewed 93.06
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 93.05
PRK12315581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 93.04
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 92.96
PLN02269 362 Pyruvate dehydrogenase E1 component subunit alpha 92.84
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 92.56
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 92.53
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 92.34
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 92.14
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 92.05
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 91.98
PRK13012896 2-oxoacid dehydrogenase subunit E1; Provisional 91.97
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 91.95
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 91.93
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 91.78
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 91.61
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 91.53
PRK08327569 acetolactate synthase catalytic subunit; Validated 91.51
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 91.45
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 91.33
PRK08611576 pyruvate oxidase; Provisional 91.3
PLN02234641 1-deoxy-D-xylulose-5-phosphate synthase 91.28
COG3958312 Transketolase, C-terminal subunit [Carbohydrate tr 91.19
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 91.03
PRK09124574 pyruvate dehydrogenase; Provisional 90.96
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 90.87
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 90.82
PRK08322547 acetolactate synthase; Reviewed 90.44
PRK07524535 hypothetical protein; Provisional 90.41
PRK08155564 acetolactate synthase catalytic subunit; Validated 90.38
PRK09444462 pntB pyridine nucleotide transhydrogenase; Provisi 90.14
TIGR03186889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 90.11
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 90.1
PRK06546578 pyruvate dehydrogenase; Provisional 90.07
PRK08617552 acetolactate synthase; Reviewed 89.96
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 89.81
PRK08266542 hypothetical protein; Provisional 89.81
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 89.8
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 89.79
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 89.67
PRK06112578 acetolactate synthase catalytic subunit; Validated 89.56
PRK07064544 hypothetical protein; Provisional 89.35
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 89.1
PRK06154565 hypothetical protein; Provisional 89.08
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 88.97
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 88.81
PF02233463 PNTB: NAD(P) transhydrogenase beta subunit; InterP 88.69
PRK11269591 glyoxylate carboligase; Provisional 88.6
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 88.55
PRK05858542 hypothetical protein; Provisional 88.49
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 88.42
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 88.25
PLN02470585 acetolactate synthase 88.24
PLN02573578 pyruvate decarboxylase 88.12
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 88.07
PRK08273597 thiamine pyrophosphate protein; Provisional 88.02
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 87.91
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 87.76
COG0021 663 TktA Transketolase [Carbohydrate transport and met 87.71
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 87.71
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 87.7
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 87.66
PRK08199557 thiamine pyrophosphate protein; Validated 87.66
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 87.63
PLN02683356 pyruvate dehydrogenase E1 component subunit beta 87.6
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 87.52
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 87.47
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 87.4
PLN02225701 1-deoxy-D-xylulose-5-phosphate synthase 87.33
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 87.24
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 87.02
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 87.01
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 86.94
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 86.87
PRK10886196 DnaA initiator-associating protein DiaA; Provision 86.8
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 86.68
COG1282463 PntB NAD/NADP transhydrogenase beta subunit [Energ 86.66
PRK07092530 benzoylformate decarboxylase; Reviewed 86.56
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 86.52
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 86.38
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 86.23
PRK06457549 pyruvate dehydrogenase; Provisional 86.11
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 85.99
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 85.87
CHL00099585 ilvB acetohydroxyacid synthase large subunit 85.69
PF0076686 ETF_alpha: Electron transfer flavoprotein FAD-bind 84.85
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 84.03
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 84.02
KOG0523 632 consensus Transketolase [Carbohydrate transport an 84.02
PF00676 300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 83.8
PF13580138 SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_ 83.27
TIGR03129 421 one_C_dehyd_B formylmethanofuran dehydrogenase sub 82.45
PRK07586514 hypothetical protein; Validated 82.04
PRK12474518 hypothetical protein; Provisional 81.98
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 81.93
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 81.17
COG3957 793 Phosphoketolase [Carbohydrate transport and metabo 81.12
PRK00414192 gmhA phosphoheptose isomerase; Reviewed 80.9
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1e-94  Score=744.61  Aligned_cols=411  Identities=31%  Similarity=0.492  Sum_probs=351.3

Q ss_pred             CCcHHHHHHHHHHhcCCCEEEecCCCChHHHHHHHHhCCCcEeeccchHHHHHHHHHHHhHhCCcEEEEEcCChhhHhhH
Q 013746           13 QIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVHGL   92 (437)
Q Consensus        13 ~~~~~~~i~~~L~~~Gv~~vFg~pG~~~~~l~~al~~~~i~~i~~~~E~~A~~~A~gyar~tg~~~v~~~t~GpG~~n~~   92 (437)
                      +|+++|++++.|+++||++|||+||+++++++|+|++.+|++|.+|||++|+|||+||+|+|||||||++|+|||++|++
T Consensus         1 ~~~ga~~lv~~L~~~GV~~VFGiPG~~i~~~~dal~~~~i~~I~~RHEq~Aa~mAdgyar~TGkpgV~~~tsGPGatN~~   80 (550)
T COG0028           1 MMTGAEALVEALEANGVDTVFGIPGGSILPLYDALYDSGIRHILVRHEQGAAFAADGYARATGKPGVCLVTSGPGATNLL   80 (550)
T ss_pred             CCcHHHHHHHHHHHcCCcEEEeCCCccHHHHHHHHHhCCCcEEEeccHHHHHHHHHHHHHHcCCCEEEEECCCCcHHHHH
Confidence            48999999999999999999999999999999999988999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhCCCcEEEEecCCCccCCCCCCCCCcchhhhccCccceeeecCCcCchHHHHHHHHHHhhcCCCceeEEEcCc
Q 013746           93 AGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPT  172 (437)
Q Consensus        93 ~gi~~A~~~~~Pvl~I~g~~~~~~~~~~~~q~~d~~~~~~~~~k~~~~v~~~~~~~~~l~~A~~~a~~~~~GPv~l~iP~  172 (437)
                      +||++|+.|++|||+||||.++..+++++||++|+..|++|++||++++.+++++++.+++||++|.++|||||||+||.
T Consensus        81 tgla~A~~d~~Pll~itGqv~~~~~g~~afQe~D~~~l~~p~tk~~~~v~~~~~ip~~i~~Af~~A~sgrpGpv~i~iP~  160 (550)
T COG0028          81 TGLADAYMDSVPLLAITGQVPTSLIGTDAFQEVDQVGLFRPITKYNFEVRSPEDIPEVVARAFRIALSGRPGPVVVDLPK  160 (550)
T ss_pred             HHHHHHHhcCCCEEEEeCCccccccCcchhhhcchhhHhhhhheeEEEeCCHHHHHHHHHHHHHHHhcCCCceEEEEcCh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhccccchhHHHHHHHHhhhhcccccCCCCCH-HHHHHHHHHHHhCCCcEEEEcCCcCccchHHHHHHHHHHhCCCeee
Q 013746          173 DVLHQTISVSEAEKLLKEAESAKETVTQGGIVN-SDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLP  251 (437)
Q Consensus       173 dv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~a~rPvil~G~g~~~~~~~~~l~~lae~~g~pv~t  251 (437)
                      |++.++++.......       ..+...+.+.+ +++++++++|++||||+|++|+|+.++++.+++++|+|++++||++
T Consensus       161 Dv~~~~~~~~~~~~~-------~~~~~~p~~~~~~~i~~aa~~L~~AkrPvIl~G~G~~~a~a~~~l~~lae~~~~Pv~~  233 (550)
T COG0028         161 DVLAAEAEEPGPEPA-------ILPPYRPAPPPPEAIRKAAELLAEAKRPVILAGGGVRRAGASEELRELAEKLGAPVVT  233 (550)
T ss_pred             hHhhccccccccccc-------ccccCCCCCCcHHHHHHHHHHHHhCCCCEEEECCCccccccHHHHHHHHHHHCCCEEE
Confidence            999998765321011       01122232333 8899999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCcccH-------HHHhchhcCCEEEEEcCcCCCccccCCCCCCCCCceEEEhH--------------
Q 013746          252 TPMGKGLLPDTHPLAATA-------ARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVD--------------  310 (437)
Q Consensus       252 t~~gkg~~~~~hp~~~G~-------~~~~~l~~aDlvl~iG~~~~~~~~~~~~~~~~~~~~~i~vd--------------  310 (437)
                      |++|||.+|++||+|+|.       ..+.++++||+||+||++|+++.+.  +..|.+..++||||              
T Consensus       234 t~~gkg~~p~~hp~~lG~~g~~g~~~a~~~~~~aDlll~vG~rf~~~~~~--~~~f~~~~~ii~iDidp~ei~k~~~~~~  311 (550)
T COG0028         234 TLMGKGAVPEDHPLSLGMLGMHGTKAANEALEEADLLLAVGARFDDRVTG--YSGFAPPAAIIHIDIDPAEIGKNYPVDV  311 (550)
T ss_pred             ccCcCccCCCCCccccccccccccHHHHHHhhcCCEEEEecCCCcccccc--hhhhCCcCCEEEEeCChHHhCCCCCCCe
Confidence            999999999999999985       3567889999999999999987665  23333332399998              


Q ss_pred             -----------hHHhhhhhhHHHHHHHH-----------h-c-cCCCCCcccHHHHHHHHHhccCCCCCEEEeC-cchHH
Q 013746          311 -----------AIWKKTKDNVLKMEVQL-----------A-K-DVVPFNFMTPMRIIRDAILGVGSPAPILVSE-GANTM  365 (437)
Q Consensus       311 -----------~l~~~~~~~~~~~~~~~-----------~-~-~~~~~~~~~~~~~i~~~l~~~~~~~~i~v~~-g~~~~  365 (437)
                                 +|.+.+......|....           . . ......+.++++.|++.+    ++|.|+++| |.++.
T Consensus       312 ~i~gD~~~~l~~L~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~v~~~l~~~~----~~daiv~~d~G~~~~  387 (550)
T COG0028         312 PIVGDAKATLEALLEELKPERAAWLEELLEARAAYRDLALEELADDGIKPQYVIKVLRELL----PDDAIVVTDVGQHQM  387 (550)
T ss_pred             eEeccHHHHHHHHHHhhhhcchHHHHHHHHHHHhhhhhhhhccCCCccCHHHHHHHHHHhC----CCCeEEEeCCcHHHH
Confidence                       12222211001111110           0 0 111123555666666655    888899888 88888


Q ss_pred             HHHHHhhhhcCCCeeecCCCCCCCcchHHHHHHHhHhCCCCcEEEEEcCccccCCHHHHHHHHHcCcccccC
Q 013746          366 DVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI  437 (437)
Q Consensus       366 ~~~~~~~~~~~~~~~~~~~~~g~mG~~lpaAiGaala~p~~~vv~i~GDG~f~~~~~eL~Ta~r~~l~i~~i  437 (437)
                      |..++ ++..+|++++.++++|+||||+|+|||||++.|+|+||+|+|||||+|++|||+|++||++|+++|
T Consensus       388 w~a~~-~~~~~p~~~~~s~~~GtMG~glPaAIGAkla~P~r~Vv~i~GDG~F~m~~qEL~Ta~r~~lpv~iv  458 (550)
T COG0028         388 WAARY-FDFYRPRRFLTSGGLGTMGFGLPAAIGAKLAAPDRKVVAIAGDGGFMMNGQELETAVRYGLPVKIV  458 (550)
T ss_pred             HHHHh-cccCCCCcEEcCCCCccccchHHHHHHHHhhCCCCcEEEEEcccHHhccHHHHHHHHHhCCCEEEE
Confidence            88765 588899999999999999999999999999999999999999999999999999999999999865

>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>KOG1184 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only] Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>COG1880 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon subunit [Energy production and conversion] Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>PF02552 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA synthase epsilon subunit; InterPro: IPR003704 Carbon monoxide dehydrogenase (Cdh) from Methanosarcina mazei (Methanosarcina frisia) Go1 is a Ni2+-, Fe2+-, and S2-containing alpha2beta2 heterotetramer [] Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2 Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>smart00861 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>PRK09212 pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02761 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>COG3958 Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PF02233 PNTB: NAD(P) transhydrogenase beta subunit; InterPro: IPR012136 NAD(P) transhydrogenase catalyses the transfer of reducing equivalents between NAD(H) and NADP(H), coupled to the translocation of protons across a membrane [] Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PLN02683 pyruvate dehydrogenase E1 component subunit beta Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>COG1282 PntB NAD/NADP transhydrogenase beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PF00766 ETF_alpha: Electron transfer flavoprotein FAD-binding domain; InterPro: IPR014731 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>KOG0523 consensus Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PF13580 SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_A 3BJZ_D 2XBL_B 2X3Y_F 2YVA_B 3CVJ_D 3TRJ_D Back     alignment and domain information
>TIGR03129 one_C_dehyd_B formylmethanofuran dehydrogenase subunit B Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2q27_A564 Crystal Structure Of Oxalyl-Coa Decarboxylase From 1e-80
2c31_A568 Crystal Structure Of Oxalyl-Coa Decarboxylase In Co 4e-79
3e9y_A 584 Arabidopsis Thaliana Acetohydroxyacid Synthase In C 1e-25
1ybh_A 590 Crystal Structure Of Arabidopsis Thaliana Acetohydr 1e-25
1jsc_A 630 Crystal Structure Of The Catalytic Subunit Of Yeast 4e-25
1n0h_A 677 Crystal Structure Of Yeast Acetohydroxyacid Synthas 5e-25
2pan_A 616 Crystal Structure Of E. Coli Glyoxylate Carboligase 1e-21
1ozg_A 566 The Crystal Structure Of Klebsiella Pneumoniae Acet 1e-18
1ozg_A566 The Crystal Structure Of Klebsiella Pneumoniae Acet 1e-04
1pox_A 585 The Refined Structures Of A Stabilized Mutant And O 1e-17
1y9d_A 603 Pyruvate Oxidase Variant V265a From Lactobacillus P 1e-17
2ez4_A 603 Pyruvate Oxidase Variant F479w Length = 603 2e-17
4fee_A 603 High-Resolution Structure Of Pyruvate Oxidase In Co 3e-17
1pow_A 585 The Refined Structures Of A Stabilized Mutant And O 3e-17
3iaf_A 570 Structure Of Benzaldehyde Lyase A28s Mutant With Mo 3e-16
2ag0_A 563 Crystal Structure Of Benzaldehyde Lyase (Bal)- Nati 3e-16
3d7k_A 570 Crystal Structure Of Benzaldehyde Lyase In Complex 3e-16
2uz1_B 563 1.65 Angstrom Structure Of Benzaldehyde Lyase Compl 3e-16
3iae_A 570 Structure Of Benzaldehyde Lyase A28s Mutant With Be 4e-16
2ag1_A 563 Crystal Structure Of Benzaldehyde Lyase (Bal)- Seme 2e-15
1v5f_A 589 Crystal Structure Of Pyruvate Oxidase Complexed Wit 2e-10
1v5e_A 590 Crystal Structure Of Pyruvate Oxidase Containing Fa 2e-10
2pgn_A 589 The Crystal Structure Of Fad And Thdp-Dependent Cyc 3e-10
1upb_A 573 Carboxyethylarginine Synthase From Streptomyces Cla 9e-09
1upa_A 573 Carboxyethylarginine Synthase From Streptomyces Cla 3e-08
2vjy_A 563 Pyruvate Decarboxylase From Kluyveromyces Lactis In 2e-07
3f6b_X525 Crystal Structure Of Benzoylformate Decarboxylase I 3e-07
2v3w_A528 Crystal Structure Of The Benzoylformate Decarboxyla 3e-07
1yno_A527 High Resolution Structure Of Benzoylformate Decarbo 4e-07
1pi3_A528 E28q Mutant Benzoylformate Decarboxylase From Pseud 4e-07
2fwn_A528 Phosphorylation Of An Active Site Serine In A Thdp- 4e-07
1po7_A528 High Resolution Structure Of E28a Mutant Benzoylfor 4e-07
2fn3_A528 High Resolution Structure Of S26a Mutant Of Benzoyl 4e-07
3fzn_A534 Intermediate Analogue In Benzoylformate Decarboxyla 4e-07
1mcz_A528 Benzoylformate Decarboxylase From Pseudomonas Putid 4e-07
3ey9_A 572 Structural Basis For Membrane Binding And Catalytic 5e-06
1pvd_A 555 Crystal Structure Of The Thiamin Diphosphate Depend 6e-06
1pyd_A 556 Catalytic Centers In The Thiamin Diphosphate Depend 6e-06
3eya_A 549 Structural Basis For Membrane Binding And Catalytic 6e-06
2w93_A 563 Crystal Structure Of The Saccharomyces Cerevisiae P 7e-06
1qpb_A 563 Pyruvate Decarboyxlase From Yeast (Form B) Complexe 1e-05
2vk8_A 563 Crystal Structure Of The Saccharomyces Cerevisiae P 5e-05
2vk1_A 563 Crystal Structure Of The Saccharomyces Cerevisiae P 5e-05
2vbf_A 570 The Holostructure Of The Branched-Chain Keto Acid D 8e-04
>pdb|2Q27|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase From Escherichia Coli Length = 564 Back     alignment and structure 
Iteration: 1

 Score =  296 bits (759), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 173/458 (37%), Positives = 251/458 (54%), Gaps = 53/458 (11%)
Query: 15  DGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQXXXXXXXXXXXLT 74
           DG  +  ++L       ++GVVGIPVT +A  A   G+R+I F +EQ           LT
Sbjct: 9   DGMHIIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYAAAASGFLT 68
Query: 75  GKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQK--DFGRGDFQELDQVEAVK 132
            KPGI LTVS PG ++GL  L+N  +N +P++MISGS D+   D  +GD++ELDQ+ A K
Sbjct: 69  QKPGICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGDYEELDQMNAAK 128
Query: 133 PFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXX 192
           P++K A +     ++   +A+ +  +VSGRPGG YLDLP +VL  T+             
Sbjct: 129 PYAKAAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEKDEALTTIVKVE 188
Query: 193 XXXXTVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPFLPT 252
                +         +  A+SLL +A++PLI+ GKGAAY++A+ +L++ +ES  IPFLP 
Sbjct: 189 NPSPALLP---CPKSVTSAISLLAKAERPLIILGKGAAYSQADEQLREFIESAQIPFLPM 245
Query: 253 PMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVDA- 311
            M KG+L DTHPL+A AARS A+   DV ++VGARLNWLL  G+   W+ D +F+ +D  
Sbjct: 246 SMAKGILEDTHPLSAAAARSFALANADVVMLVGARLNWLLAHGK-KGWAADTQFIQLDIE 304
Query: 312 --------------------------------------IWK-----KTKDNVLKMEVQLA 328
                                                 +W+       + N  KM  +L+
Sbjct: 305 PQEIDSNRPIAVPVVGDIASSMQGMLAELKQNTFTTPLVWRDILNIHKQQNAQKMHEKLS 364
Query: 329 KDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPRCRLDAGTWGT 388
            D  P N+   +  +RD +    +    LV+EGANT+D  R ++   +PR RLD GTWG 
Sbjct: 365 TDTQPLNYFNALSAVRDVLR--ENQDIYLVNEGANTLDNARNIIDMYKPRRRLDCGTWGV 422
Query: 389 MGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEV 426
           MG+G+GY I A++      VVA+EGDS FGFS +E+E 
Sbjct: 423 MGIGMGYAIGASVTSGSP-VVAIEGDSAFGFSGMEIET 459
>pdb|2C31|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase In Complex With The Cofactor Derivative Thiamin-2-Thiazolone Diphosphate And Adenosine Diphosphate Length = 568 Back     alignment and structure
>pdb|3E9Y|A Chain A, Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With Monosulfuron Length = 584 Back     alignment and structure
>pdb|1YBH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With A Sulfonylurea Herbicide Chlorimuron Ethyl Length = 590 Back     alignment and structure
>pdb|1JSC|A Chain A, Crystal Structure Of The Catalytic Subunit Of Yeast Acetohydroxyacid Synthase: A Target For Herbicidal Inhibitors Length = 630 Back     alignment and structure
>pdb|1N0H|A Chain A, Crystal Structure Of Yeast Acetohydroxyacid Synthase In Complex With A Sulfonylurea Herbicide, Chlorimuron Ethyl Length = 677 Back     alignment and structure
>pdb|2PAN|A Chain A, Crystal Structure Of E. Coli Glyoxylate Carboligase Length = 616 Back     alignment and structure
>pdb|1OZG|A Chain A, The Crystal Structure Of Klebsiella Pneumoniae Acetolactate Synthase With Enzyme-bound Cofactor And With An Unusual Intermediate Length = 566 Back     alignment and structure
>pdb|1OZG|A Chain A, The Crystal Structure Of Klebsiella Pneumoniae Acetolactate Synthase With Enzyme-bound Cofactor And With An Unusual Intermediate Length = 566 Back     alignment and structure
>pdb|1POX|A Chain A, The Refined Structures Of A Stabilized Mutant And Of Wild-Type Pyruvate Oxidase From Lactobacillus Plantarum Length = 585 Back     alignment and structure
>pdb|1Y9D|A Chain A, Pyruvate Oxidase Variant V265a From Lactobacillus Plantarum Length = 603 Back     alignment and structure
>pdb|2EZ4|A Chain A, Pyruvate Oxidase Variant F479w Length = 603 Back     alignment and structure
>pdb|4FEE|A Chain A, High-Resolution Structure Of Pyruvate Oxidase In Complex With Reaction Intermediate 2-Hydroxyethyl-Thiamin Diphosphate Carbanion-Enamine, Crystal B Length = 603 Back     alignment and structure
>pdb|1POW|A Chain A, The Refined Structures Of A Stabilized Mutant And Of Wild-Type Pyruvate Oxidase From Lactobacillus Plantarum Length = 585 Back     alignment and structure
>pdb|3IAF|A Chain A, Structure Of Benzaldehyde Lyase A28s Mutant With Monomethyl Benzoylphosphonate Length = 570 Back     alignment and structure
>pdb|2AG0|A Chain A, Crystal Structure Of Benzaldehyde Lyase (Bal)- Native Length = 563 Back     alignment and structure
>pdb|3D7K|A Chain A, Crystal Structure Of Benzaldehyde Lyase In Complex With The Inhibitor Mbp Length = 570 Back     alignment and structure
>pdb|2UZ1|B Chain B, 1.65 Angstrom Structure Of Benzaldehyde Lyase Complexed With 2-Methyl-2,4-Pentanediol Length = 563 Back     alignment and structure
>pdb|3IAE|A Chain A, Structure Of Benzaldehyde Lyase A28s Mutant With Benzoylphosphonate Length = 570 Back     alignment and structure
>pdb|2AG1|A Chain A, Crystal Structure Of Benzaldehyde Lyase (Bal)- Semet Length = 563 Back     alignment and structure
>pdb|1V5F|A Chain A, Crystal Structure Of Pyruvate Oxidase Complexed With Fad And Tpp, From Aerococcus Viridans Length = 589 Back     alignment and structure
>pdb|1V5E|A Chain A, Crystal Structure Of Pyruvate Oxidase Containing Fad, From Aerococcus Viridans Length = 590 Back     alignment and structure
>pdb|2PGN|A Chain A, The Crystal Structure Of Fad And Thdp-Dependent Cyclohexane-1,2-Dione Hydrolase In Complex With Cyclohexane-1,2-Dione Length = 589 Back     alignment and structure
>pdb|1UPB|A Chain A, Carboxyethylarginine Synthase From Streptomyces Clavuligerus Length = 573 Back     alignment and structure
>pdb|1UPA|A Chain A, Carboxyethylarginine Synthase From Streptomyces Clavuligerus (semet Structure) Length = 573 Back     alignment and structure
>pdb|2VJY|A Chain A, Pyruvate Decarboxylase From Kluyveromyces Lactis In Complex With The Substrate Analogue Methyl Acetylphosphonate Length = 563 Back     alignment and structure
>pdb|3F6B|X Chain X, Crystal Structure Of Benzoylformate Decarboxylase In Complex With The Pyridyl Inhibitor Paa Length = 525 Back     alignment and structure
>pdb|2V3W|A Chain A, Crystal Structure Of The Benzoylformate Decarboxylase Variant L461a From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|1YNO|A Chain A, High Resolution Structure Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 527 Back     alignment and structure
>pdb|1PI3|A Chain A, E28q Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|2FWN|A Chain A, Phosphorylation Of An Active Site Serine In A Thdp- Dependent Enzyme By Phosphonate Inactivation Length = 528 Back     alignment and structure
>pdb|1PO7|A Chain A, High Resolution Structure Of E28a Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|2FN3|A Chain A, High Resolution Structure Of S26a Mutant Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 528 Back     alignment and structure
>pdb|3FZN|A Chain A, Intermediate Analogue In Benzoylformate Decarboxylase Length = 534 Back     alignment and structure
>pdb|1MCZ|A Chain A, Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With An Inhibitor, R-Mandelate Length = 528 Back     alignment and structure
>pdb|3EY9|A Chain A, Structural Basis For Membrane Binding And Catalytic Activation Of The Peripheral Membrane Enzyme Pyruvate Oxidase From Escherichia Coli Length = 572 Back     alignment and structure
>pdb|1PVD|A Chain A, Crystal Structure Of The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase From The Yeast Saccharomyces Cerevisiae At 2.3 Angstroms Resolution Length = 555 Back     alignment and structure
>pdb|1PYD|A Chain A, Catalytic Centers In The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase At 2.4 Angstroms Resolution Length = 556 Back     alignment and structure
>pdb|3EYA|A Chain A, Structural Basis For Membrane Binding And Catalytic Activation Of The Peripheral Membrane Enzyme Pyruvate Oxidase From Escherichia Coli Length = 549 Back     alignment and structure
>pdb|2W93|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With The Surrogate Pyruvamide Length = 563 Back     alignment and structure
>pdb|1QPB|A Chain A, Pyruvate Decarboyxlase From Yeast (Form B) Complexed With Pyruvamide Length = 563 Back     alignment and structure
>pdb|2VK8|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|2VK1|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant D28a In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|2VBF|A Chain A, The Holostructure Of The Branched-Chain Keto Acid Decarboxylase (Kdca) From Lactococcus Lactis Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 1e-112
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 1e-104
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 2e-53
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 1e-51
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 9e-50
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 3e-49
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 2e-47
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 3e-46
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 2e-45
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 1e-44
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 2e-44
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 3e-44
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 3e-44
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 5e-39
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 9e-07
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 1e-38
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 6e-06
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 4e-37
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 1e-06
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 8e-36
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 2e-05
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 7e-35
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 9e-07
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 8e-34
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 1e-06
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 7e-26
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 6e-24
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 4e-18
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1djl_A207 Transhydrogenase DIII; rossmann fold dinucleotide 3e-04
2fsv_C203 NAD(P) transhydrogenase subunit beta; NAD(P) trans 5e-04
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
 Score =  340 bits (875), Expect = e-112
 Identities = 180/468 (38%), Positives = 263/468 (56%), Gaps = 54/468 (11%)

Query: 7   QNSQNAQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYA 66
            +      DG  +   +L +     M+GVVGIP+T+LA      G RF +F +EQ AGYA
Sbjct: 3   NDDNVELTDGFHVLIDALKMNDIDTMYGVVGIPITNLARMWQDDGQRFYSFRHEQHAGYA 62

Query: 67  ASAYGYLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQK--DFGRGDFQE 124
           AS  GY+ GKPG+ LTVS PG ++G+  L++   N +P++++SGS +++  D  +GD++E
Sbjct: 63  ASIAGYIEGKPGVCLTVSAPGFLNGVTSLAHATTNCFPMILLSGSSEREIVDLQQGDYEE 122

Query: 125 LDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVSEA 184
           +DQ+   +P  K + +   I ++P  +A+ +  AVSGRPGG Y+DLP  +  QTISV EA
Sbjct: 123 MDQMNVARPHCKASFRINSIKDIPIGIARAVRTAVSGRPGGVYVDLPAKLFGQTISVEEA 182

Query: 185 EKLLKEAESAKETVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVES 244
            KLL +                 I +A  L+K AK+P+I+ GKGAAYA+ + E++ LVE 
Sbjct: 183 NKLLFKPIDP---APAQIPAEDAIARAADLIKNAKRPVIMLGKGAAYAQCDDEIRALVEE 239

Query: 245 TGIPFLPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSK-- 302
           TGIPFLP  M KGLLPD HP +A A R+ A+ QCDV +++GARLNWL+  G+   W    
Sbjct: 240 TGIPFLPMGMAKGLLPDNHPQSAAATRAFALAQCDVCVLIGARLNWLMQHGKGKTWGDEL 299

Query: 303 -------------------------DVKFVL-----------------VDAIWKKTKDNV 320
                                    D+K  +                   A+  K   N 
Sbjct: 300 KKYVQIDIQANEMDSNQPIAAPVVGDIKSAVSLLRKALKGAPKADAEWTGALKAKVDGNK 359

Query: 321 LKMEVQLAKDVV--PFNFMTPMRIIRDAILGVGSPAPILVSEGANTMDVGRAVLVQTEPR 378
            K+  ++  +      N+   + ++RD +L   +P   LV+EGAN +D  R ++   +PR
Sbjct: 360 AKLAGKMTAETPSGMMNYSNSLGVVRDFMLA--NPDISLVNEGANALDNTRMIVDMLKPR 417

Query: 379 CRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEV 426
            RLD+GTWG MG+G+GYC+AAA A   + V+AVEGDS FGFS +E+E 
Sbjct: 418 KRLDSGTWGVMGIGMGYCVAAA-AVTGKPVIAVEGDSAFGFSGMELET 464
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Length = 590 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Length = 549 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Length = 603 Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Length = 566 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Length = 528 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Length = 590 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Length = 578 Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Length = 604 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Length = 556 Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Length = 170 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1djl_A Transhydrogenase DIII; rossmann fold dinucleotide binding fold reverse binding of N oxidoreductase; HET: NAP; 2.00A {Homo sapiens} SCOP: c.31.1.4 PDB: 1pt9_A* 1u31_A* Length = 207 Back     alignment and structure
>2fsv_C NAD(P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunits, oxidoreductas; HET: NAD NAP; 2.30A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1e3t_A* 1hzz_C* 1nm5_C* 1u28_C* 1u2d_C* 1u2g_C* 2fr8_C* 2frd_C* Length = 203 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 100.0
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 100.0
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 100.0
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 100.0
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 100.0
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 100.0
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 100.0
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 100.0
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 100.0
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 100.0
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 100.0
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 100.0
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 100.0
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 100.0
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 100.0
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 100.0
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 100.0
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 100.0
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 100.0
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 100.0
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 99.72
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alph 99.68
1ytl_A174 Acetyl-COA decarboxylase/synthase complex epsilon 99.68
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 98.91
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 98.71
2bfd_A 400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 98.53
1w85_A 368 Pyruvate dehydrogenase E1 component, alpha subunit 98.45
1umd_A 367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 98.43
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 98.43
1qs0_A 407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 98.37
2ozl_A 365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 98.36
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 98.35
3l84_A 632 Transketolase; TKT, structural genomics, center fo 98.34
3uk1_A 711 Transketolase; structural genomics, seattle struct 98.24
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 98.22
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 98.2
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 98.18
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 98.17
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 98.16
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 98.15
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 98.1
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 97.9
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 96.92
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 96.43
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 96.11
1qs0_B338 2-oxoisovalerate dehydrogenase beta-subunit; heter 95.62
1w85_B324 Pyruvate dehydrogenase E1 component, beta subunit; 95.54
2r8o_A669 Transketolase 1, TK 1; reaction intermediate, calc 95.49
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 95.49
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 95.42
2ozl_B341 PDHE1-B, pyruvate dehydrogenase E1 component subun 95.41
1umd_B324 E1-beta, 2-OXO acid dehydrogenase beta subunit; al 95.22
3kom_A663 Transketolase; rossmann fold, csgid, transferase, 95.14
2bfd_B342 2-oxoisovalerate dehydrogenase beta subunit; oxido 94.95
1ik6_A369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o 94.44
2e6k_A651 Transketolase; structural genomics, NPPSFA, nation 94.41
2o1s_A621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 94.31
1r9j_A673 Transketolase; domains, EACH of the alpha/beta typ 94.25
1gpu_A680 Transketolase; transferase(ketone residues); HET: 94.18
3mos_A616 Transketolase, TK; thiamin diphosphate TPP THDP en 94.0
3l84_A632 Transketolase; TKT, structural genomics, center fo 93.85
2o1x_A629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 93.8
1itz_A675 Transketolase; calvin cycle, cofactor, thiamine py 93.73
3m49_A690 Transketolase; alpha-beta-alpha sandwich, csgid, t 93.09
3uk1_A711 Transketolase; structural genomics, seattle struct 92.79
3rim_A700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 92.76
1pno_A180 NAD(P) transhydrogenase subunit beta; nucleotide b 92.51
1d4o_A184 NADP(H) transhydrogenase; nucleotide-binding fold, 92.46
1djl_A207 Transhydrogenase DIII; rossmann fold dinucleotide 91.99
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 91.98
2fsv_C203 NAD(P) transhydrogenase subunit beta; NAD(P) trans 91.91
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 91.51
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 91.05
2bru_C186 NAD(P) transhydrogenase subunit beta; paramagnetic 90.45
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 90.37
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 89.25
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 88.42
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 88.38
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 86.94
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 86.89
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 86.88
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 85.78
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 85.47
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 84.77
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 83.65
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 83.59
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 81.54
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 81.45
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 81.26
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 80.83
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
Probab=100.00  E-value=5.5e-83  Score=669.82  Aligned_cols=419  Identities=43%  Similarity=0.753  Sum_probs=354.1

Q ss_pred             cCCcHHHHHHHHHHhcCCCEEEecCCCChHHHHHHHHhCCCcEeeccchHHHHHHHHHHHhHhCCcEEEEEcCChhhHhh
Q 013746           12 AQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQLGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVHG   91 (437)
Q Consensus        12 ~~~~~~~~i~~~L~~~Gv~~vFg~pG~~~~~l~~al~~~~i~~i~~~~E~~A~~~A~gyar~tg~~~v~~~t~GpG~~n~   91 (437)
                      ..|+++++|++.|+++||+||||+||+++++|++++.+++|++|.+|||++|+|||+||+|+||||+||++|+|||++|+
T Consensus         6 ~~~~~a~~l~~~L~~~GV~~vfg~PG~~~~~l~~al~~~~i~~i~~~hE~~Aa~~A~Gyar~tg~pgv~~~TsGpG~~N~   85 (564)
T 2q28_A            6 QMTDGMHIIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYAAAASGFLTQKPGICLTVSAPGFLNG   85 (564)
T ss_dssp             CEEEHHHHHHHHHHHTTCCEEEECCCTTTHHHHHHHHHTTCEEEECSSHHHHHHHHHHHHHHHSSCEEEEECSHHHHHHH
T ss_pred             ccCcHHHHHHHHHHHcCCCEEEECCCcchHHHHHHHHhCCCcEEeeCCHHHHHHHHHHHHHHhCCCEEEEEccCchHHHH
Confidence            44799999999999999999999999999999999987789999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhCCCcEEEEecCCCccCCC--CCCCCCcchhhhccCccceeeecCCcCchHHHHHHHHHHhhcCCCceeEEE
Q 013746           92 LAGLSNGMINTWPIVMISGSCDQKDFG--RGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLD  169 (437)
Q Consensus        92 ~~gi~~A~~~~~Pvl~I~g~~~~~~~~--~~~~q~~d~~~~~~~~~k~~~~v~~~~~~~~~l~~A~~~a~~~~~GPv~l~  169 (437)
                      ++||++||.+++|||+|+|++++...+  ++.+|++||..+++++|||++++++++++++.+++||+.|.++|||||||+
T Consensus        86 ~~gi~~A~~~~vPll~itg~~~~~~~~~~~~~~Q~~dq~~~~~~~tk~~~~v~~~~~~~~~i~~A~~~A~~~~~GPV~l~  165 (564)
T 2q28_A           86 LTALANATVNGFPMIMISGSSDRAIVDLQQGDYEELDQMNAAKPYAKAAFRVNQPQDLGIALARAIRVSVSGRPGGVYLD  165 (564)
T ss_dssp             HHHHHHHHHHTCCEEEEEEECCHHHHHTTSCCTTCCCHHHHHGGGSSEEEECCSGGGHHHHHHHHHHHHHSSSCCEEEEE
T ss_pred             HHHHHHHHhcCCCEEEEeCCCCccccCCCCCccccccHHHHHHHhhheeeecCCHHHHHHHHHHHHHHHhcCCCceEEEE
Confidence            999999999999999999999998777  789999999999999999999999999999999999999999999999999


Q ss_pred             cCcchhccccchhHHHHHHHHhhhhcccccCCCCCHHHHHHHHHHHHhCCCcEEEEcCCcCccchHHHHHHHHHHhCCCe
Q 013746          170 LPTDVLHQTISVSEAEKLLKEAESAKETVTQGGIVNSDIDKAVSLLKEAKKPLIVFGKGAAYARAEGELKKLVESTGIPF  249 (437)
Q Consensus       170 iP~dv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~rPvil~G~g~~~~~~~~~l~~lae~~g~pv  249 (437)
                      ||.|++.++++.... ..+.. + ...+...+.+++..+++++++|++|+||+|++|+|+.++++.+++++|||++|+||
T Consensus       166 iP~dv~~~~~~~~~~-~~~~~-~-~~~~~~~~~~~~~~i~~~~~~l~~a~rpvIl~G~g~~~~~a~~~l~~lae~~~~Pv  242 (564)
T 2q28_A          166 LPANVLAATMEKDEA-LTTIV-K-VENPSPALLPCPKSVTSAISLLAKAERPLIILGKGAAYSQADEQLREFIESAQIPF  242 (564)
T ss_dssp             EEHHHHHCEEEHHHH-HHTCC-C-CSCSSCCEEECHHHHHHHHHHHHHCSSEEEEECHHHHHHTCHHHHHHHHHHHTCCE
T ss_pred             cCHHHhhcccccccc-ccccc-c-ccCCCCCCCCCHHHHHHHHHHHHcCCCcEEEECcccccccHHHHHHHHHHHhCCCE
Confidence            999998776543200 00000 0 00111122456788999999999999999999999988889999999999999999


Q ss_pred             eeCCCCCCCCCCCCCCcccHHHHhchhcCCEEEEEcCcCCCccccCCCCCCCCCceEEEhH-------------------
Q 013746          250 LPTPMGKGLLPDTHPLAATAARSLAIGQCDVALVVGARLNWLLHFGEPPKWSKDVKFVLVD-------------------  310 (437)
Q Consensus       250 ~tt~~gkg~~~~~hp~~~G~~~~~~l~~aDlvl~iG~~~~~~~~~~~~~~~~~~~~~i~vd-------------------  310 (437)
                      ++|++|||.+|++||+++|...++++++||+||.||+++++..+++. ..|.++.++||||                   
T Consensus       243 ~~t~~~~g~~~~~hp~~~G~~~~~~l~~aDlvl~iG~~~~~~~~~~~-~~~~~~~~~i~id~d~~~~~~~~~~~~~i~~d  321 (564)
T 2q28_A          243 LPMSMAKGILEDTHPLSAAAARSFALANADVVMLVGARLNWLLAHGK-KGWAADTQFIQLDIEPQEIDSNRPIAVPVVGD  321 (564)
T ss_dssp             EECGGGTTSSCTTCTTBCGGGHHHHHHHCSEEEEESCCCSGGGGGGT-TTSCTTCEEEEEESCGGGTTSSSCCSEEEESC
T ss_pred             EeccCccccCCCCChhhcChHHHhHhhcCCEEEEECCcccccccccc-cccCCCCeEEEEeCCHHHhcCCCCCCeEEEcC
Confidence            99999999999999999998888889999999999999987655454 4566678999987                   


Q ss_pred             ------hHHhhhhh----hHHHHHH-----------HH----hccCCCCCcccHHHHHHHHHhccCCCCCEEEeCcchHH
Q 013746          311 ------AIWKKTKD----NVLKMEV-----------QL----AKDVVPFNFMTPMRIIRDAILGVGSPAPILVSEGANTM  365 (437)
Q Consensus       311 ------~l~~~~~~----~~~~~~~-----------~~----~~~~~~~~~~~~~~~i~~~l~~~~~~~~i~v~~g~~~~  365 (437)
                            +|.+.+..    ....|..           ..    .....++++.++++.|++.++  .|++.++++||++.+
T Consensus       322 ~~~~l~~L~~~l~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~--~~~d~ivv~dg~~~~  399 (564)
T 2q28_A          322 IASSMQGMLAELKQNTFTTPLVWRDILNIHKQQNAQKMHEKLSTDTQPLNYFNALSAVRDVLR--ENQDIYLVNEGANTL  399 (564)
T ss_dssp             HHHHHHHHHHHHHHSCCCCCHHHHHHHHHHHHHHHHHHHHHHTCCCSSBCHHHHHHHHHHHHT--TCTTCEEEEESSHHH
T ss_pred             HHHHHHHHHHHhhhcCcCCcHHHHHHHHHHHHhhhhhhhhhhccCCCCcCHHHHHHHHHHHhc--CCCCEEEEECCchHH
Confidence                  12121111    0011110           00    112345666677777776663  156788888999888


Q ss_pred             HHHHHhhhhcCCCeeecCCCCCCCcchHHHHHHHhHhCCCCcEEEEEcCccccCCHHHHHHHHHcCcccccC
Q 013746          366 DVGRAVLVQTEPRCRLDAGTWGTMGVGLGYCIAAAIACPERLVVAVEGDSGFGFSAVEVEVWLSCIIMISSI  437 (437)
Q Consensus       366 ~~~~~~~~~~~~~~~~~~~~~g~mG~~lpaAiGaala~p~~~vv~i~GDG~f~~~~~eL~Ta~r~~l~i~~i  437 (437)
                      |+.+.++....|++++.++++|+||+++|+|+|++++ |+++||+++|||||+|++|||+|++||++|++.|
T Consensus       400 ~~~~~~~~~~~p~~~~~~g~~g~~G~~l~~AiGaa~a-~~~~vv~i~GDGsf~~~~~el~ta~~~~l~~~iv  470 (564)
T 2q28_A          400 DNARNIIDMYKPRRRLDCGTWGVMGIGMGYAIGASVT-SGSPVVAIEGDSAFGFSGMEIETICRYNLPVTIV  470 (564)
T ss_dssp             HHHHHHSCCCSSSCEEESTTTTCTTCHHHHHHHHHHH-HCSCEEEEEEHHHHHTTGGGHHHHHHTTCCEEEE
T ss_pred             HHHHHHhcccCCCeEecCCCCCcccchHHHHHHHhhc-CCCcEEEEEcchHhhccHHHHHHHHHhCCCeEEE
Confidence            8877767778889999999999999999999999999 8999999999999999999999999999998754
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>1ytl_A Acetyl-COA decarboxylase/synthase complex epsilon 2; structural genomics; 1.80A {Archaeoglobus fulgidus} SCOP: c.31.1.6 Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Back     alignment and structure
>1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Back     alignment and structure
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>1pno_A NAD(P) transhydrogenase subunit beta; nucleotide binding fold, oxidoreductase; HET: NAP; 2.10A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1pnq_A* 1xlt_C* 2oor_C* 1ptj_C* 2oo5_C* Back     alignment and structure
>1d4o_A NADP(H) transhydrogenase; nucleotide-binding fold, protein-NADP(H) complex, inverted binding of NADP(H), oxidoreductase; HET: NAP; 1.21A {Bos taurus} SCOP: c.31.1.4 Back     alignment and structure
>1djl_A Transhydrogenase DIII; rossmann fold dinucleotide binding fold reverse binding of N oxidoreductase; HET: NAP; 2.00A {Homo sapiens} SCOP: c.31.1.4 PDB: 1pt9_A* 1u31_A* Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>2fsv_C NAD(P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunits, oxidoreductas; HET: NAD NAP; 2.30A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1e3t_A* 1hzz_C* 1nm5_C* 1u28_C* 1u2d_C* 1u2g_C* 2fr8_C* 2frd_C* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 437
d1t9ba2175 c.36.1.5 (A:89-263) Acetohydroxyacid synthase cata 8e-27
d1ybha2195 c.36.1.5 (A:86-280) Acetohydroxyacid synthase cata 2e-26
d2ji7a2188 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalo 3e-20
d1ozha2181 c.36.1.5 (A:7-187) Catabolic acetolactate synthase 3e-19
d1ytla1158 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synth 5e-17
d2ez9a2174 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus 2e-15
d1q6za2180 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {P 1e-14
d2ji7a1175 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxa 2e-14
d1ovma1161 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxyla 2e-14
d2ihta2186 c.36.1.5 (A:12-197) Carboxyethylarginine synthase 3e-14
d1pvda2180 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's 8e-14
d1zpda1175 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymom 1e-13
d2djia2184 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus vi 5e-13
d1q6za1160 c.31.1.3 (A:182-341) Benzoylformate decarboxylase 1e-12
d1ovma2178 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase 2e-12
d1zpda2186 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomon 4e-12
d2ji7a3183 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxa 9e-12
d1ozha1179 c.31.1.3 (A:188-366) Catabolic acetolactate syntha 2e-11
d1ybha1179 c.31.1.3 (A:281-459) Acetohydroxyacid synthase cat 3e-11
d2ihta1177 c.31.1.3 (A:198-374) Carboxyethylarginine synthase 4e-10
d1pvda1179 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker 2e-09
d1t9ba1171 c.31.1.3 (A:290-460) Acetohydroxyacid synthase cat 1e-07
d1zpda3 204 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymom 5e-06
d2djia1177 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus 2e-05
d2ez9a1183 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacill 4e-04
d1ovma3196 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxyla 6e-04
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase Pyr module
domain: Acetohydroxyacid synthase catalytic subunit
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  103 bits (258), Expect = 8e-27
 Identities = 47/167 (28%), Positives = 79/167 (47%), Gaps = 1/167 (0%)

Query: 14  IDGNTLAAKSLSLFGATHMFGVVGIPVTSLAN-RAVQLGVRFIAFHNEQSAGYAASAYGY 72
           + G  +  + +S      +FG  G  +  + +         F+   +EQ AG+ A  Y  
Sbjct: 4   LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 63

Query: 73  LTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVK 132
            +GKPG++L  SGPG  + +  +++   +  P+V+ +G       G   FQE D V   +
Sbjct: 64  ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISR 123

Query: 133 PFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTI 179
             +K+ V  K + E+P  + +  E A SGRPG   +DLP DV    +
Sbjct: 124 SCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKDVTAAIL 170
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 195 Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 188 Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 181 Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 158 Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 174 Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 180 Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 175 Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 161 Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 186 Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 175 Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 184 Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 160 Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 178 Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 186 Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 183 Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 179 Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 177 Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 179 Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 204 Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 177 Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 183 Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 196 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 100.0
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 100.0
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 100.0
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 100.0
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 100.0
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 100.0
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 100.0
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 100.0
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 100.0
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 100.0
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 100.0
d2ez9a3 228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.89
d1ybha3 208 Acetohydroxyacid synthase catalytic subunit {Thale 99.88
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.88
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.86
d2djia3 229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.86
d1t9ba3 227 Acetohydroxyacid synthase catalytic subunit {Baker 99.86
d1zpda3 204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.85
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.85
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.85
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.85
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.85
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.85
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 99.84
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 99.84
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.84
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.84
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.83
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.83
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 99.83
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 99.81
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 99.8
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.79
d1ytla1158 Acetyl-CoA decarbonylase/synthase complex epsilon 99.65
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 98.82
d1gpua2197 Transketolase (TK), Pyr module {Baker's yeast (Sac 97.04
d1itza2192 Transketolase (TK), Pyr module {Maize (Zea mays) [ 96.79
d1r9ja1190 Transketolase (TK), Pyr module {Leishmania mexican 96.56
d2r8oa1195 Transketolase (TK), Pyr module {Escherichia coli [ 96.54
d1gpua1 335 Transketolase (TK), PP module {Baker's yeast (Sacc 96.33
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 95.96
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 95.86
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 95.83
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 95.73
d1r9ja2 336 Transketolase (TK), PP module {Leishmania mexicana 95.67
d2r8oa2 331 Transketolase (TK), PP module {Escherichia coli [T 95.52
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 95.43
d1itza1 338 Transketolase (TK), PP module {Maize (Zea mays) [T 94.84
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 94.67
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 94.3
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 94.27
d1w85a_ 365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 93.59
d2ozla1 361 E1-beta subunit of pyruvate dehydrogenase (PP modu 93.58
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 93.2
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 93.02
d2bfda1 395 Branched-chain alpha-keto acid dehydrogenase, PP m 92.52
d1umda_ 362 Branched-chain alpha-keto acid dehydrogenase, PP m 91.65
d1pnoa_180 Transhydrogenase domain III (dIII) {Rhodospirillum 91.62
d1d4oa_177 Transhydrogenase domain III (dIII) {Cow (Bos tauru 91.5
d1qs0a_ 407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 91.45
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 90.99
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 89.16
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 88.12
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 87.84
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 87.39
d1umdb1186 Branched-chain alpha-keto acid dehydrogenase, Pyr 85.96
d2ieaa2 415 Pyruvate dehydrogenase E1 component, PP module {Es 85.94
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 85.79
d2c42a2 447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 83.39
d1qs0b1204 2-oxoisovalerate dehydrogenase (E1B), Pyr module { 81.06
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase Pyr module
domain: Pyruvate oxidase
species: Lactobacillus plantarum [TaxId: 1590]

Probab=100.00  E-value=4.3e-48  Score=340.22  Aligned_cols=168  Identities=23%  Similarity=0.429  Sum_probs=161.8

Q ss_pred             CCcHHHHHHHHHHhcCCCEEEecCCCChHHHHHHHHh--CCCcEeeccchHHHHHHHHHHHhHhCCcEEEEEcCChhhHh
Q 013746           13 QIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANRAVQ--LGVRFIAFHNEQSAGYAASAYGYLTGKPGILLTVSGPGCVH   90 (437)
Q Consensus        13 ~~~~~~~i~~~L~~~Gv~~vFg~pG~~~~~l~~al~~--~~i~~i~~~~E~~A~~~A~gyar~tg~~~v~~~t~GpG~~n   90 (437)
                      .|+++|+|++.|+++||++|||+||+++++|+++|.+  .+|++|.+|||++|+|||+||+|+||||++|++|+|||++|
T Consensus         2 ~m~~~~~i~~~L~~~Gv~~vFgipG~~~~~l~dal~~~~~~i~~i~~r~E~~A~~~A~gyar~tgk~gv~~~t~GpG~~N   81 (174)
T d2ez9a2           2 NILAGAAVIKVLEAWGVDHLYGIPGGSINSIMDALSAERDRIHYIQVRHEEVGAMAAAADAKLTGKIGVCFGSAGPGGTH   81 (174)
T ss_dssp             EEEHHHHHHHHHHHTTCCEEEECCCGGGHHHHHHHHHTTTTSEEEECSSHHHHHHHHHHHHHHHSSCEEEEECTTHHHHT
T ss_pred             CchHHHHHHHHHHHCCCCEEEEECCHhHHHHHHHHHhcCCCcEEEEecccchhHHHHHHHHhhcCceeEEeecccccccc
Confidence            5889999999999999999999999999999999953  47999999999999999999999999999999999999999


Q ss_pred             hHHHHHHhhhCCCcEEEEecCCCccCCCCCCCCCcchhhhccCccceeeecCCcCchHHHHHHHHHHhhcCCCceeEEEc
Q 013746           91 GLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDL  170 (437)
Q Consensus        91 ~~~gi~~A~~~~~Pvl~I~g~~~~~~~~~~~~q~~d~~~~~~~~~k~~~~v~~~~~~~~~l~~A~~~a~~~~~GPv~l~i  170 (437)
                      +++||++||.|++|||+|+|+.+++..+++.+|++||..+++++|||++++.+++++++.+++||+.|.+ +||||||+|
T Consensus        82 ~~~gl~~A~~~~~P~l~i~g~~~~~~~~~~~~Q~~d~~~~~~~itk~~~~v~~~~~~~~~i~~A~~~A~~-~pGPv~l~i  160 (174)
T d2ez9a2          82 LMNGLYDAREDHVPVLALIGQFGTTGMNMDTFQEMNENPIYADVADYNVTAVNAATLPHVIDEAIRRAYA-HQGVAVVQI  160 (174)
T ss_dssp             THHHHHHHHHTTCCEEEEEEECCTTTTTSCCTTCCCCHHHHTTTCSEEEECCCSTTHHHHHHHHHHHHHH-HTSEEEEEE
T ss_pred             hhhhHHHHHhcCccceeeeccccccccCccccccchhhhhhccccccccccccHHHHHHHHHHHHHHHhC-CCCCEEEEe
Confidence            9999999999999999999999999999999999999999999999999999999999999999999987 469999999


Q ss_pred             Ccchhccccch
Q 013746          171 PTDVLHQTISV  181 (437)
Q Consensus       171 P~dv~~~~~~~  181 (437)
                      |.|++.++++.
T Consensus       161 P~Dv~~~~i~~  171 (174)
T d2ez9a2         161 PVDLPWQQIPA  171 (174)
T ss_dssp             ETTGGGSEEET
T ss_pred             CcccccCcCCc
Confidence            99999998864
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itza2 c.36.1.6 (A:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1r9ja1 c.36.1.6 (A:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1d4oa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1umdb1 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure