Citrus Sinensis ID: 013949
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 433 | 2.2.26 [Sep-21-2011] | |||||||
| Q9AXT8 | 912 | DNA (cytosine-5)-methyltr | N/A | no | 0.729 | 0.346 | 0.486 | 4e-86 | |
| Q8LPU5 | 915 | DNA (cytosine-5)-methyltr | N/A | no | 0.766 | 0.362 | 0.462 | 2e-83 | |
| Q9ARI6 | 915 | DNA (cytosine-5)-methyltr | N/A | no | 0.766 | 0.362 | 0.462 | 3e-83 | |
| O49139 | 791 | Putative DNA (cytosine-5) | yes | no | 0.801 | 0.438 | 0.470 | 2e-81 | |
| Q94F88 | 839 | DNA (cytosine-5)-methyltr | no | no | 0.806 | 0.415 | 0.428 | 6e-77 | |
| Q94F87 | 1295 | DNA (cytosine-5)-methyltr | no | no | 0.796 | 0.266 | 0.408 | 1e-70 | |
| P34881 | 1534 | DNA (cytosine-5)-methyltr | no | no | 0.362 | 0.102 | 0.303 | 6e-06 | |
| Q7Y1I7 | 1527 | DNA (cytosine-5)-methyltr | no | no | 0.392 | 0.111 | 0.271 | 2e-05 | |
| B1Q3J6 | 1529 | DNA (cytosine-5)-methyltr | no | no | 0.341 | 0.096 | 0.254 | 2e-05 | |
| P13864 | 1620 | DNA (cytosine-5)-methyltr | yes | no | 0.237 | 0.063 | 0.289 | 0.0008 |
| >sp|Q9AXT8|CMT1_MAIZE DNA (cytosine-5)-methyltransferase 1 OS=Zea mays GN=MET2A PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 318 bits (816), Expect = 4e-86, Method: Compositional matrix adjust.
Identities = 174/358 (48%), Positives = 224/358 (62%), Gaps = 42/358 (11%)
Query: 72 FVGPPVSVDEALKRYPDRYKYSSKGHKKKKVAAGVSSIGALNEEEEVLQARCHYTQASVD 131
F+G PV+ DEA +P RY S+ K +EEE L+ARCHY A VD
Sbjct: 137 FIGSPVAADEARSNWPKRYGRSTAAKKP--------------DEEEELKARCHYRSAKVD 182
Query: 132 GCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDLAYLV-- 189
+Y LGDD YVKA E DYI RI E FE D YF RWF+RAEDTVI L +
Sbjct: 183 NVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQCHYFTCRWFFRAEDTVINSLVSISVD 242
Query: 190 ----DRKRVFLSDVEDDNPLNCIVSKAKIAEVAANMDLEAKQKNIPPCDLYYDMKYTLPH 245
D +RVFLS+ ++DN L+CI+SK KI V NMD +AK + I CDLYYDM Y++ +
Sbjct: 243 GHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDPNMDPKAKAQLIESCDLYYDMSYSVAY 302
Query: 246 LTFSNINNESNRRDSDASSTISS-----ETGSNSPIGEPEMSLLDLYSGCGAMSTGLCIG 300
TF+NI++E+ + SD +S ISS ET S+ P +LLDLYSGCG MSTGLC+G
Sbjct: 303 STFANISSENGQSGSDTASGISSDDVDLETSSSMPTRT--ATLLDLYSGCGGMSTGLCLG 360
Query: 301 ASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSLLKEWAKLCQYFSIYDT 360
A+LSG+KL TRWA+D N AC+SLK+NHP+T+VRNE AD+FL+LLKEWA LC+ + + D
Sbjct: 361 AALSGLKLETRWAVDFNSFACQSLKYNHPQTEVRNEKADEFLALLKEWAVLCKKY-VQDV 419
Query: 361 DKVPEQSLNFMSEDEEEEEEEENDDDSNVPNEEFEVESLTAVCYGDPNKTKKPGVYFK 418
D N S E++ D+DS + +EF VE L +CYG ++ G+YFK
Sbjct: 420 DS------NLAS------SEDQADEDSPLDKDEFVVEKLVGICYGGSDREN--GIYFK 463
|
Involved in the CpXpG methylation and in gene silencing. Zea mays (taxid: 4577) EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 7 |
| >sp|Q8LPU5|CMT3_MAIZE DNA (cytosine-5)-methyltransferase 3 OS=Zea mays GN=DMT105 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ARI6|CMT2_MAIZE DNA (cytosine-5)-methyltransferase 2 OS=Zea mays GN=ZMET5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O49139|CMT1_ARATH Putative DNA (cytosine-5)-methyltransferase CMT1 OS=Arabidopsis thaliana GN=CMT1 PE=5 SV=2 | Back alignment and function description |
|---|
| >sp|Q94F88|CMT3_ARATH DNA (cytosine-5)-methyltransferase CMT3 OS=Arabidopsis thaliana GN=CMT3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q94F87|CMT2_ARATH DNA (cytosine-5)-methyltransferase CMT2 OS=Arabidopsis thaliana GN=CMT2 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|P34881|DNMT1_ARATH DNA (cytosine-5)-methyltransferase 1 OS=Arabidopsis thaliana GN=DMT1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7Y1I7|DNM1A_ORYSJ DNA (cytosine-5)-methyltransferase 1A OS=Oryza sativa subsp. japonica GN=MET1A PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|B1Q3J6|DNM1B_ORYSJ DNA (cytosine-5)-methyltransferase 1B OS=Oryza sativa subsp. japonica GN=MET1B PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P13864|DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus GN=Dnmt1 PE=1 SV=5 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 433 | ||||||
| 225441510 | 829 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.842 | 0.440 | 0.583 | 1e-116 | |
| 297739809 | 827 | unnamed protein product [Vitis vinifera] | 0.836 | 0.437 | 0.576 | 1e-114 | |
| 255579031 | 845 | protein with unknown function [Ricinus c | 0.898 | 0.460 | 0.541 | 1e-111 | |
| 356540854 | 830 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.838 | 0.437 | 0.531 | 1e-105 | |
| 356495335 | 834 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.840 | 0.436 | 0.529 | 1e-104 | |
| 356497585 | 868 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.847 | 0.422 | 0.522 | 1e-101 | |
| 358345790 | 827 | DNA (cytosine-5)-methyltransferase [Medi | 0.833 | 0.436 | 0.498 | 3e-97 | |
| 159461700 | 925 | CMT-type DNA-methyltransferase [Elaeis g | 0.780 | 0.365 | 0.524 | 5e-96 | |
| 357484051 | 835 | DNA (cytosine-5)-methyltransferase [Medi | 0.789 | 0.409 | 0.502 | 1e-93 | |
| 330370547 | 824 | chromomethylase 3 [Gossypium hirsutum] | 0.806 | 0.423 | 0.506 | 1e-91 |
| >gi|225441510|ref|XP_002275932.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 424 bits (1090), Expect = e-116, Method: Compositional matrix adjust.
Identities = 227/389 (58%), Positives = 286/389 (73%), Gaps = 24/389 (6%)
Query: 48 EEPVELVTRVKKKTQKNKPDSDLFFVGPPVSVDEALKRYPDRYKYSSKGHKKKKVAAGVS 107
EE L V KKT+K++ ++ VG P+SV+EA +++P RY ++K K
Sbjct: 9 EEAAPLQPCVVKKTKKSRAAAEASVVGAPISVNEARQKWPQRYISTNKFRKGSDSRTKDE 68
Query: 108 SIGALNEEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEP 167
SI E E++LQAR H+T+A VDGC+Y L D AYVKAE+G D+IA+IVELFE++D EP
Sbjct: 69 SI----EAEDILQARRHFTEAVVDGCIYKLYDYAYVKAEDGQPDFIAKIVELFETIDREP 124
Query: 168 YFKARWFYRAEDTVIKDLAYLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVAANMDLEAKQ 227
YF A+WF+RAEDTVIKD A+LVD+KRVF SD+ DDNPL+CIVSK +I +VA N+DL K+
Sbjct: 125 YFTAQWFFRAEDTVIKDHAHLVDQKRVFYSDMRDDNPLDCIVSKVEIVQVAPNVDLAEKE 184
Query: 228 KNIPPCDLYYDMKYTLPHLTFSNINNESNRRDSDASSTISSET-------GSNSPIGEPE 280
K IPPCDLYYDM Y+L HLTF+N+ E++R +SD SSTISSE G NS IGE
Sbjct: 185 KTIPPCDLYYDMSYSLKHLTFANLLTENSRTESDESSTISSEIGLNSTTDGINSAIGESS 244
Query: 281 ---------MSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPET 331
M+LLDLYSGCGAMSTGLC+GASLSG+KLVTRWA+DINPHAC+SLK NHPET
Sbjct: 245 QVHKFQGSGMTLLDLYSGCGAMSTGLCLGASLSGLKLVTRWAVDINPHACESLKLNHPET 304
Query: 332 KVRNEAADDFLSLLKEWAKLCQYFSIYDTDKVPEQSLNFMS--EDEEEEEEEENDDDSNV 389
+VRNEAA+DFLSLLKEWA LC+ FS+ + + PE +N +S ++EE+ + DD S V
Sbjct: 305 EVRNEAAEDFLSLLKEWATLCEDFSLLGSRR-PE-VVNPISNRSGSDDEEDADGDDGSPV 362
Query: 390 PNEEFEVESLTAVCYGDPNKTKKPGVYFK 418
P EFEV+ L A+CYGDPN+ KPG+YFK
Sbjct: 363 PRGEFEVKKLVAICYGDPNEINKPGLYFK 391
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297739809|emb|CBI29991.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255579031|ref|XP_002530367.1| protein with unknown function [Ricinus communis] gi|223530114|gb|EEF32028.1| protein with unknown function [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356540854|ref|XP_003538899.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356495335|ref|XP_003516534.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356497585|ref|XP_003517640.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358345790|ref|XP_003636958.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula] gi|355502893|gb|AES84096.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|159461700|gb|ABW96889.1| CMT-type DNA-methyltransferase [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
| >gi|357484051|ref|XP_003612312.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula] gi|355513647|gb|AES95270.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|330370547|gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 433 | ||||||
| TAIR|locus:2025787 | 791 | CMT1 "chromomethylase 1" [Arab | 0.799 | 0.437 | 0.438 | 8.1e-76 | |
| TAIR|locus:2205015 | 839 | CMT3 "chromomethylase 3" [Arab | 0.785 | 0.405 | 0.384 | 1.5e-60 | |
| TAIR|locus:2117104 | 1295 | CMT2 "chromomethylase 2" [Arab | 0.792 | 0.264 | 0.378 | 1.7e-60 | |
| MGI|MGI:94912 | 1620 | Dnmt1 "DNA methyltransferase ( | 0.237 | 0.063 | 0.289 | 4.8e-07 | |
| ZFIN|ZDB-GENE-990714-15 | 1500 | dnmt1 "DNA (cytosine-5-)-methy | 0.198 | 0.057 | 0.315 | 1.2e-06 | |
| TAIR|locus:2140892 | 1404 | MEE57 "maternal effect embryo | 0.436 | 0.134 | 0.276 | 3.9e-06 | |
| UNIPROTKB|D4A0P3 | 1410 | Dnmt1 "DNA (cytosine-5)-methyl | 0.235 | 0.072 | 0.299 | 5.5e-06 | |
| UNIPROTKB|D4A8Z6 | 1616 | Dnmt1 "Cytosine-specific methy | 0.235 | 0.063 | 0.299 | 7.4e-06 | |
| RGD|620979 | 1622 | Dnmt1 "DNA (cytosine-5-)-methy | 0.235 | 0.062 | 0.299 | 7.4e-06 | |
| UNIPROTKB|Q9Z330 | 1622 | Dnmt1 "DNA (cytosine-5)-methyl | 0.235 | 0.062 | 0.299 | 7.4e-06 |
| TAIR|locus:2025787 CMT1 "chromomethylase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 764 (274.0 bits), Expect = 8.1e-76, P = 8.1e-76
Identities = 156/356 (43%), Positives = 216/356 (60%)
Query: 59 KKTQKNKPDSDLFFVGPPVSVDEALKRYPDRXXXXXXXXXXXXXXXXXXXIGALNEEEEV 118
K+ ++ +P+SDL F G P+SV E+ R+P R G E+EE+
Sbjct: 6 KQKKRAEPESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANK--GGKKEDEEI 63
Query: 119 L-QARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRA 177
+ QA+CH+ +A VDG L NL DD YV G + +IA+++ELFE+ DG PY + RW+YR
Sbjct: 64 IKQAKCHFDKALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRP 123
Query: 178 EDTVIKDLAYLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVAA-NMDLEAKQKNIPPCDLY 236
EDT+I+ ++LV KRVFLS+ E+DNPL CI SK IA+V + +Q+ IPPCD Y
Sbjct: 124 EDTLIERFSHLVQPKRVFLSNDENDNPLTCIWSKVNIAKVPLPKITSRIEQRVIPPCDYY 183
Query: 237 YDMKYTLPHLTFSNINNESNRRDXXXXXXXXXXXXXXXPIGEPEMSLLDLYSGCGAMSTG 296
YDMKY +P+L F++ ++ S D + + E LLDLYSGCGAMSTG
Sbjct: 184 YDMKYEVPYLNFTSADDGS---DASSSLSSDSALNCFENLHKDEKFLLDLYSGCGAMSTG 240
Query: 297 LCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSLLKEWAKLCQYFS 356
C+GAS+SGVKL+T+W++DIN AC SLK NHPET+VRNEAA+DFL+LLKEW +LC+ FS
Sbjct: 241 FCMGASISGVKLITKWSVDINKFACDSLKLNHPETEVRNEAAEDFLALLKEWKRLCEKFS 300
Query: 357 IYDTDKVPEQSLNFMSXXXXXXXXXXXXXXXXXXXX--XFEVESLTAVCYGDPNKT 410
+ + + P +S++ + FEVE + +GDP T
Sbjct: 301 LVSSTE-PVESISELEDEEVEENDDIDEASTGAELEPGEFEVEKFLGIMFGDPQGT 355
|
|
| TAIR|locus:2205015 CMT3 "chromomethylase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117104 CMT2 "chromomethylase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:94912 Dnmt1 "DNA methyltransferase (cytosine-5) 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990714-15 dnmt1 "DNA (cytosine-5-)-methyltransferase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140892 MEE57 "maternal effect embryo arrest 57" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A0P3 Dnmt1 "DNA (cytosine-5)-methyltransferase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A8Z6 Dnmt1 "Cytosine-specific methyltransferase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|620979 Dnmt1 "DNA (cytosine-5-)-methyltransferase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Z330 Dnmt1 "DNA (cytosine-5)-methyltransferase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 433 | |||
| cd04716 | 122 | cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Ho | 5e-53 | |
| smart00439 | 121 | smart00439, BAH, Bromo adjacent homology domain | 2e-18 | |
| cd04370 | 123 | cd04370, BAH, BAH, or Bromo Adjacent Homology doma | 6e-18 | |
| pfam01426 | 120 | pfam01426, BAH, BAH domain | 3e-16 | |
| cd04717 | 121 | cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom | 1e-09 | |
| COG0270 | 328 | COG0270, Dcm, Site-specific DNA methylase [DNA rep | 9e-09 | |
| cd04713 | 146 | cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol | 2e-07 | |
| cd00315 | 275 | cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi | 7e-07 | |
| cd04760 | 124 | cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homol | 2e-05 | |
| cd04714 | 121 | cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo | 1e-04 | |
| pfam00145 | 320 | pfam00145, DNA_methylase, C-5 cytosine-specific DN | 2e-04 | |
| cd04721 | 130 | cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homol | 0.001 | |
| cd04715 | 159 | cd04715, BAH_Orc1p_like, BAH, or Bromo Adjacent Ho | 0.004 |
| >gnl|CDD|240067 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
Score = 173 bits (439), Expect = 5e-53
Identities = 63/122 (51%), Positives = 85/122 (69%)
Query: 132 GCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDLAYLVDR 191
G YNLGDDAYV+ EG +I +I E FE DG+ YF A+WFYRAEDTVI+ A D+
Sbjct: 1 GITYNLGDDAYVQGGEGEEPFICKITEFFEGTDGKTYFTAQWFYRAEDTVIERQATNHDK 60
Query: 192 KRVFLSDVEDDNPLNCIVSKAKIAEVAANMDLEAKQKNIPPCDLYYDMKYTLPHLTFSNI 251
KRVF S++++DNPL+C++SK KI +V N+ + K+ N CD YYDM+Y +P+ TF +
Sbjct: 61 KRVFYSEIKNDNPLDCLISKVKILQVPPNVGTKRKKPNSEKCDYYYDMEYCVPYSTFQTL 120
Query: 252 NN 253
N
Sbjct: 121 RN 122
|
DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the genome. These effects include transcriptional repression via inhibition of transcription factor binding, the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting, and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 122 |
| >gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >gnl|CDD|216495 pfam01426, BAH, BAH domain | Back alignment and domain information |
|---|
| >gnl|CDD|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >gnl|CDD|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >gnl|CDD|240107 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase | Back alignment and domain information |
|---|
| >gnl|CDD|240072 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240066 cd04715, BAH_Orc1p_like, BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 433 | |||
| cd04716 | 122 | BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom | 100.0 | |
| cd04708 | 202 | BAH_plantDCM_II BAH, or Bromo Adjacent Homology do | 100.0 | |
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 99.95 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 99.95 | |
| cd04713 | 146 | BAH_plant_3 BAH, or Bromo Adjacent Homology domain | 99.95 | |
| cd04760 | 124 | BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain | 99.94 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 99.94 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 99.93 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 99.93 | |
| cd04710 | 135 | BAH_fungalPHD BAH, or Bromo Adjacent Homology doma | 99.93 | |
| cd04709 | 164 | BAH_MTA BAH, or Bromo Adjacent Homology domain, as | 99.92 | |
| PF01426 | 119 | BAH: BAH domain; InterPro: IPR001025 The BAH (brom | 99.92 | |
| cd04370 | 123 | BAH BAH, or Bromo Adjacent Homology domain (also c | 99.91 | |
| smart00439 | 120 | BAH Bromo adjacent homology domain. | 99.91 | |
| cd04714 | 121 | BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, | 99.91 | |
| cd04717 | 121 | BAH_polybromo BAH, or Bromo Adjacent Homology doma | 99.91 | |
| cd04715 | 159 | BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom | 99.9 | |
| cd04712 | 130 | BAH_DCM_I BAH, or Bromo Adjacent Homology domain, | 99.89 | |
| cd04711 | 137 | BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai | 99.86 | |
| cd04721 | 130 | BAH_plant_1 BAH, or Bromo Adjacent Homology domain | 99.84 | |
| cd04719 | 128 | BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d | 99.76 | |
| cd04720 | 179 | BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do | 99.7 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 99.67 | |
| KOG1886 | 464 | consensus BAH domain proteins [Transcription] | 99.49 | |
| KOG0919 | 338 | consensus C-5 cytosine-specific DNA methylase [Tra | 99.44 | |
| KOG1827 | 629 | consensus Chromatin remodeling complex RSC, subuni | 99.08 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 98.88 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 96.89 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 96.76 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 96.75 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 96.46 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 96.43 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 96.41 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 96.4 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 96.36 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 96.35 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 96.11 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 96.09 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 96.05 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 96.03 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 96.02 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 96.0 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 95.97 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 95.88 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 95.75 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 95.61 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 95.51 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 95.43 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 95.37 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 95.15 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 95.12 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 94.98 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 94.89 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 94.44 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 94.18 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 93.94 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 93.72 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 93.68 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 93.27 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 93.21 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 93.16 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 93.12 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 92.93 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 92.93 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 92.89 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 92.84 | |
| KOG1227 | 351 | consensus Putative methyltransferase [General func | 92.73 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 92.32 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 92.02 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 91.98 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 91.69 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 91.3 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 91.22 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 90.99 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 90.99 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 90.82 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 90.77 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 90.75 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 90.73 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 90.5 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 90.27 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 90.27 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 90.19 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 90.06 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 89.7 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 89.31 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 89.23 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 89.02 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 89.01 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 89.01 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 88.91 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 88.86 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 88.81 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 88.67 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 88.65 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 88.04 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 87.91 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 87.6 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 87.59 | |
| PRK04266 | 226 | fibrillarin; Provisional | 87.34 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 86.88 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 86.62 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 86.62 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 86.22 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 86.08 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 85.99 | |
| KOG2187 | 534 | consensus tRNA uracil-5-methyltransferase and rela | 85.9 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 85.82 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 85.74 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 85.62 | |
| PF02086 | 260 | MethyltransfD12: D12 class N6 adenine-specific DNA | 85.59 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 85.41 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 84.97 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 84.35 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 84.16 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 84.1 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 84.07 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 83.93 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 83.93 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 82.87 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 82.75 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 82.39 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 82.15 | |
| KOG2078 | 495 | consensus tRNA modification enzyme [RNA processing | 82.07 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 81.85 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 81.63 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 81.37 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 81.07 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 80.77 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 80.76 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 80.5 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 80.37 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 80.27 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 80.19 |
| >cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-33 Score=242.92 Aligned_cols=122 Identities=52% Similarity=0.947 Sum_probs=115.1
Q ss_pred CEEEeeCCEEEEEeCCCCccEEEEEEEEeecCCCceEEEEEEeeeccccccccccCCCCCceeEeeCCcccccccceeee
Q 013949 132 GCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDLAYLVDRKRVFLSDVEDDNPLNCIVSK 211 (433)
Q Consensus 132 G~~Y~vGD~VyV~~~~~~p~yIgrI~ei~e~~dg~~~v~VrWFyRpeDtv~~~~~~~~d~rELF~S~~~d~~pl~~I~gK 211 (433)
|++|++||+|||.+++++|+|||||++||++.+|..+|+|+|||||+||++++....++++|||+|+++|+||++||.||
T Consensus 1 g~~~~lgD~V~v~~~~~~~~yi~rI~~i~e~~~g~~~~~v~WyyRpeet~~~r~~~~~~~rEvFlS~~~D~~pl~~I~~K 80 (122)
T cd04716 1 GITYNLGDDAYVQGGEGEEPFICKITEFFEGTDGKTYFTAQWFYRAEDTVIERQATNHDKKRVFYSEIKNDNPLDCLISK 80 (122)
T ss_pred CcEEEcCCEEEEECCCCCCCEEEEEEEEEEcCCCceEEEEEEEEcHHHhccccccccCCCceEEEecccCccchhheeee
Confidence 78999999999999988999999999999999999999999999999998887677899999999999999999999999
Q ss_pred eEEEeeCcccchhhhccCCCCceEEEeeeccCCCceeEcCCC
Q 013949 212 AKIAEVAANMDLEAKQKNIPPCDLYYDMKYTLPHLTFSNINN 253 (433)
Q Consensus 212 C~V~~~~~~~~~~~~~~~~~~~~ffy~~~Y~~~~~tF~~lp~ 253 (433)
|+|+++++...++.+...+.+|+|||+|.|++.+++|.+||+
T Consensus 81 c~V~~~~~~~~~~~~~~~~~~~df~c~~~Y~~~~~tF~~~~~ 122 (122)
T cd04716 81 VKILQVPPNVGTKRKKPNSEKCDYYYDMEYCVPYSTFQTLRN 122 (122)
T ss_pred eEEEEeCCCCCcccccccCCCceEEEeeEeccchhheEeCCC
Confidence 999999998888767777889999999999999999999974
|
DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the genome. These effects include transcriptional repression via inhibition of transcription factor binding, the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting, and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. |
| >cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains | Back alignment and domain information |
|---|
| >cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins | Back alignment and domain information |
|---|
| >PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation | Back alignment and domain information |
|---|
| >cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >smart00439 BAH Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
| >cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins | Back alignment and domain information |
|---|
| >cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 | Back alignment and domain information |
|---|
| >cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p | Back alignment and domain information |
|---|
| >cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG1886 consensus BAH domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0919 consensus C-5 cytosine-specific DNA methylase [Transcription] | Back alignment and domain information |
|---|
| >KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >KOG1227 consensus Putative methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >KOG2078 consensus tRNA modification enzyme [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 433 | ||||
| 4ft2_A | 784 | Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 | 2e-74 | ||
| 4fsx_A | 784 | Crystal Structure Of Se-Substituted Zea Mays Zmet2 | 7e-72 | ||
| 3av4_A | 1330 | Crystal Structure Of Mouse Dna Methyltransferase 1 | 6e-05 | ||
| 3pt6_A | 954 | Crystal Structure Of Mouse Dnmt1(650-1602) In Compl | 6e-05 | ||
| 3pt9_A | 873 | Crystal Structure Of Mouse Dnmt1(731-1602) In The F | 7e-05 |
| >pdb|4FT2|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 Peptide And Sah Length = 784 | Back alignment and structure |
|
| >pdb|4FSX|A Chain A, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In Complex With Sah Length = 784 | Back alignment and structure |
| >pdb|3AV4|A Chain A, Crystal Structure Of Mouse Dna Methyltransferase 1 Length = 1330 | Back alignment and structure |
| >pdb|3PT6|A Chain A, Crystal Structure Of Mouse Dnmt1(650-1602) In Complex With Dna Length = 954 | Back alignment and structure |
| >pdb|3PT9|A Chain A, Crystal Structure Of Mouse Dnmt1(731-1602) In The Free State Length = 873 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
Score = 168 bits (426), Expect = 1e-45
Identities = 63/344 (18%), Positives = 114/344 (33%), Gaps = 23/344 (6%)
Query: 9 STQVAAEESNHSKARRRKLKLAEQQHQQQEEQREDEEVKEEPVELVTRVKKKTQKNKPDS 68
+ Q+ ++ + ++ + + QQ E + + K+ V+ + K +
Sbjct: 35 AEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDM-VKFGGSGRSKQACQERRC 93
Query: 69 DLFFVGPPVSVDEALKRYPDRYKYSSKGHKKKKVAAGVSSIGALNEEEEVLQARCHYTQA 128
+ +E P+ K H+ KK + I + E + + +Y +
Sbjct: 94 PNMAMKEADDDEEVDDNIPEMPS-PKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKV 152
Query: 129 SVDGCLYNLGDDAYVKAEE-GAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDLAY 187
+D +GD V ++ Y+AR+ L+E F A WF DTV+ +
Sbjct: 153 CIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATS- 211
Query: 188 LVDRKRVFLSDVEDDNPLNCIVSKAKIAEVA--------ANMDLEAKQKNIPPCDLYYDM 239
D +FL D +D L+ I SK K+ A MD E+ + +Y +
Sbjct: 212 --DPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQL 269
Query: 240 KYTLPHLTFSNINNESNRRDSDA---SSTISSETGSNSPIGEPEMSLLDLYSGCGAMSTG 296
Y + F + D+ S I L DL S
Sbjct: 270 WYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRV------ 323
Query: 297 LCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADD 340
L A+ +G+ + + P A K + D
Sbjct: 324 LYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVD 367
|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 | Back alignment and structure |
|---|
| >1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 433 | |||
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 100.0 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 100.0 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 100.0 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 99.96 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 99.94 | |
| 1w4s_A | 174 | Polybromo, polybromo 1 protein; BAH, bromo-associa | 99.94 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 99.93 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 99.93 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 99.93 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 99.93 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.92 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.92 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 99.92 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 99.91 | |
| 4dkj_A | 403 | Cytosine-specific methyltransferase; CG-specificit | 99.9 | |
| 4dov_A | 163 | ORC1, origin recognition complex subunit 1; DNA re | 99.8 | |
| 2qrv_B | 230 | DNA (cytosine-5)-methyltransferase 3-like; DNA met | 99.62 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 99.53 | |
| 2fl7_A | 232 | Regulatory protein SIR3; ORC, silencing, chromatin | 98.94 | |
| 1m4z_A | 238 | Origin recognition complex subunit 1; DNA replicat | 98.93 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 96.64 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 96.6 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 96.57 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 96.56 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 96.55 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 96.45 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 96.45 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 96.32 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 96.21 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 96.2 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 96.03 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 96.0 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 95.92 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 95.81 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 95.73 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 95.72 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 95.68 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 95.52 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 95.48 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 95.38 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 95.36 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 95.34 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 95.29 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 95.28 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 95.27 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 95.2 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 95.14 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 95.12 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 95.07 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 95.05 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 94.99 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 94.92 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 94.81 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 94.77 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 94.68 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 94.66 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 94.63 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 94.54 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 94.37 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 94.36 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 94.33 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 94.32 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 94.21 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 94.18 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 94.12 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 94.05 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 93.96 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 93.88 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 93.81 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 93.8 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 93.56 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 93.51 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 93.31 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 93.3 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 93.29 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 93.21 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 93.2 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 93.16 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 93.14 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 93.13 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 93.13 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 93.1 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 93.04 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 93.04 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 93.02 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 92.92 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 92.83 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 92.79 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 92.74 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 92.73 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 92.71 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 92.71 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 92.69 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 92.6 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 92.6 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 92.56 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 92.5 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 92.42 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 92.41 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 92.29 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 92.28 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 92.28 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 92.24 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 92.15 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 92.13 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 92.12 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 92.11 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 92.1 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 91.97 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 91.97 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 91.95 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 91.91 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 91.81 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 91.79 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 91.79 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 91.74 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 91.65 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 91.62 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 91.54 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 91.51 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 91.5 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 91.45 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 91.4 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 91.36 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 91.32 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 91.29 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 91.28 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 91.28 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 91.26 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 91.23 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 91.19 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 91.12 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 91.1 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 91.04 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 91.03 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 91.01 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 90.94 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 90.9 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 90.87 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 90.87 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 90.72 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 90.7 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 90.68 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 90.65 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 90.64 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 90.63 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 90.54 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 90.53 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 90.52 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 90.46 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 90.27 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 90.27 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 90.2 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 90.15 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 90.14 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 90.03 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 90.02 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 89.99 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 89.9 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 89.89 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 89.88 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 89.85 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 89.81 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 89.79 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 89.72 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 89.7 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 89.7 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 89.69 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 89.66 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 89.58 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 89.52 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 89.46 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 89.36 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 89.35 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 89.17 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 89.08 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 88.98 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 88.95 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 88.72 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 88.43 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 88.4 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 88.39 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 88.35 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 88.33 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 88.26 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 88.24 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 88.01 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 88.01 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 87.99 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 87.87 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 87.86 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 87.84 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 87.59 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 87.53 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 87.52 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 87.37 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 87.31 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 87.02 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 86.87 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 86.85 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 86.69 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 86.67 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 86.53 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 86.28 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 86.17 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 86.14 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 85.87 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 85.85 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 85.81 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 85.53 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 85.48 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 85.25 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 85.25 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 85.15 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 84.79 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 84.71 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 84.7 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 84.58 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 84.53 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 84.49 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 84.39 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 84.32 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 84.28 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 84.23 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 84.14 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 84.08 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 83.91 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 83.91 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 83.74 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 83.68 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 83.63 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 83.42 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 83.12 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 82.69 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 82.67 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 82.58 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 82.41 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 82.31 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 82.13 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 82.07 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 82.02 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 81.8 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 81.73 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 81.68 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 81.36 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 81.15 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 80.94 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 80.87 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 80.4 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 80.08 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 80.02 |
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=9.3e-75 Score=640.18 Aligned_cols=347 Identities=43% Similarity=0.673 Sum_probs=269.0
Q ss_pred CCCCCCCeeecCCCChhHHHHhCCCCCCCCccccccccccccccccCCCchhHHhhccccceeEEEECCEEEeeCCEEEE
Q 013949 64 NKPDSDLFFVGPPVSVDEALKRYPDRYKYSSKGHKKKKVAAGVSSIGALNEEEEVLQARCHYTQASVDGCLYNLGDDAYV 143 (433)
Q Consensus 64 ~~~~~~~~f~g~p~~~~ear~~wp~ry~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~Y~~~~vdG~~Y~vGD~VyV 143 (433)
+.+|++++|||+|||++|||++|||||+.+... ...++++++++||||.++.+||++|+|||||||
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~v 66 (784)
T 4ft4_B 1 SAGDHEPEFIGSPVAADEARSNWPKRYGRSTAA--------------KKPDEEEELKARCHYRSAKVDNVVYCLGDDVYV 66 (784)
T ss_dssp ----CCCEECSSCCCHHHHHHHCGGGCC--------------------------CCCEEEECSEEEETTEEEETTCEEEE
T ss_pred CCCCCCccccCCcCChHHHhhcCcccccccccC--------------CCccchhccccceeeeeeeECCEEEeCCCeEEE
Confidence 357899999999999999999999999887321 134667899999999999999999999999999
Q ss_pred EeCCCCccEEEEEEEEeecCCCceEEEEEEeeecccccccc------ccCCCCCceeEeeCCcccccccceeeeeEEEee
Q 013949 144 KAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKD------LAYLVDRKRVFLSDVEDDNPLNCIVSKAKIAEV 217 (433)
Q Consensus 144 ~~~~~~p~yIgrI~ei~e~~dg~~~v~VrWFyRpeDtv~~~------~~~~~d~rELF~S~~~d~~pl~~I~gKC~V~~~ 217 (433)
++++++|+|||+|++||++.+|..||+|+||||++||+++. .++.+|+||||+|+++++||++||.|||+|+++
T Consensus 67 ~~~~~~~~~i~~i~~~~~~~~~~~~~~~~~~~r~~d~~~~~~~~~~~~~~~~d~~~~~~s~~~~~~~~~~i~~k~~v~~~ 146 (784)
T 4ft4_B 67 KAGENEADYIGRITEFFEGTDQCHYFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHV 146 (784)
T ss_dssp CCSTTSCCEEEEEEEEEEETTSCEEEEEEEEEEGGGSTTGGGGGCCBTTBCCCTTBEEEEEEEEEEEGGGEEEECCEEEC
T ss_pred eCCCCCCCEEEEEEEEEEcCCCCEEEEEEEeeChhhhcccccccccccccccccceEEEeCcEEEechHHeeeeEEEEee
Confidence 99988899999999999999999999999999999998764 356789999999999999999999999999999
Q ss_pred CcccchhhhccCCCCceEEEeeeccCCCceeEcCCCCCCcCCCCCCCccccCC-CCC--CCCCCCCCcEEecccchhHHH
Q 013949 218 AANMDLEAKQKNIPPCDLYYDMKYTLPHLTFSNINNESNRRDSDASSTISSET-GSN--SPIGEPEMSLLDLYSGCGAMS 294 (433)
Q Consensus 218 ~~~~~~~~~~~~~~~~~ffy~~~Y~~~~~tF~~lp~e~~~~~s~~~~~i~~~~-~~~--~~~~~~~l~~lDLFsG~GG~s 294 (433)
++..+.+......+.|+|||+|.|...+++|++++.++....++.....+.+. ..+ ...++.+|++|||||||||||
T Consensus 147 ~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~ltvIDLFAG~GGls 226 (784)
T 4ft4_B 147 DPNMDPKAKAQLIESCDLYYDMSYSVAYSTFANISSENGQSGSDTASGISSDDVDLETSSSMPTRTATLLDLYSGCGGMS 226 (784)
T ss_dssp CTTSCHHHHHHHHHHCSEEESEEEETGGGEEEEC-----------------------------CEEEEEEEETCTTSHHH
T ss_pred CccccchhhhhccCCcceEeccccCccccCccCCCcccccccccccccccccccccccccccCCCCCeEEEeCcCccHHH
Confidence 99888877667777899999999999999999999887644333222222211 111 124457899999999999999
Q ss_pred HhHhhhhhcCCCeEeeEEEeecCHhhHHHHHHcCCCCceeecChhhHHHhc-----------------------------
Q 013949 295 TGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSLL----------------------------- 345 (433)
Q Consensus 295 ~Gl~~ga~~aG~~~~t~~avD~d~~A~~t~~~N~p~~~v~~~di~d~~~ll----------------------------- 345 (433)
+||+.+...+|..+.++||+|+|+.|++||++|||++.++++||++++...
T Consensus 227 ~Gfe~AG~~~~~~f~vv~AvE~d~~A~~Ty~~Nhp~~~~~~~di~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 306 (784)
T 4ft4_B 227 TGLCLGAALSGLKLETRWAVDFNSFACQSLKYNHPQTEVRNEKADEFLALLKEWAVLCKKYVQDVDSNLASSEDQADEDS 306 (784)
T ss_dssp HHHHHHHHHHTEEEEEEEEEESCHHHHHHHHHHCTTSEEEESCHHHHHHHHHHHHHHHHHTC------------------
T ss_pred HHHHHhCcccCCceeEEEEEeCCHHHHHHHHHHCCCCceecCcHHHhhhhhhhccccccccccccccccccccccccccc
Confidence 999543322332333489999999999999999999999999998874311
Q ss_pred ----------------------------------------------------------------------------CcCC
Q 013949 346 ----------------------------------------------------------------------------KEWA 349 (433)
Q Consensus 346 ----------------------------------------------------------------------------~~~~ 349 (433)
-..+
T Consensus 307 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~i~~~~~~~~~~~~~~~~G~VDvl~GG 386 (784)
T 4ft4_B 307 PLDKDEFVVEKLVGICYGGSDRENGIYFKVQWEGYGPEEDTWEPIDNLSDCPQKIREFVQEGHKRKILPLPGDVDVICGG 386 (784)
T ss_dssp -----CCCEEEEEEEEESCSSSCSSEEEEEEETTCCTTSCEEEESGGGTTCHHHHHHHHHHHHHHTSSCCTTSCSEEEEC
T ss_pred ccccccchhhhhcccccccccccccccchhhhcccccccccccccccccccchhccccccccchhhccCCCCCeEEEEec
Confidence 0125
Q ss_pred CCCchhhcccCCCC----CCcccCchHHHHHhcccccCCCCCCCCCcEEEEeccccccccCCCCC------CCCCceEEE
Q 013949 350 KLCQYFSIYDTDKV----PEQSLNFMSEDEEEEEEEENDDDSNVPNEEFEVESLTAVCYGDPNKT------KKPGVYFKE 419 (433)
Q Consensus 350 ~PCQ~fS~ag~~~~----~~d~r~~L~~~~~~~~~~~~~~i~~~~P~~fvvENV~gi~~~~p~~~------~~~gl~~~v 419 (433)
+|||+||.||++++ .+|+|+.||.+++++ ++.++|++|+||||+||+..+.+.. ...++||.|
T Consensus 387 pPCQ~FS~aG~~kg~~~~~~D~R~~L~~~~~ri-------v~~~rPk~fvlENV~glls~~~g~~~~~il~~l~~lGY~v 459 (784)
T 4ft4_B 387 PPCQGISGFNRYRNRDEPLKDEKNKQMVTFMDI-------VAYLKPKYVLMENVVDILKFADGYLGKYALSCLVAMKYQA 459 (784)
T ss_dssp CCCCSSSGGGGGSCTTSTTTSTTCHHHHHHHHH-------HHHHCCSEEEEEEEGGGGTGGGGHHHHHHHHHHHHTTCEE
T ss_pred CCCcchhhhhcccCcCccccCchhHHHHHHHHH-------HHHHCCCEEEEEecCCccccccchHHHHHHHHHHhCCCee
Confidence 79999999998776 568999999999999 8999999999999999986544431 235789999
Q ss_pred EEEEee-eeecee
Q 013949 420 CCLIIC-YLTFVP 431 (433)
Q Consensus 420 ~w~~~~-~~~~~p 431 (433)
+|+.|+ .+|+||
T Consensus 460 ~~~vLnA~dyGVP 472 (784)
T 4ft4_B 460 RLGMMVAGCYGLP 472 (784)
T ss_dssp EEEEEEGGGGTCS
T ss_pred eeeecCHHHcCCC
Confidence 999994 456687
|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* | Back alignment and structure |
|---|
| >1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 433 | ||||
| d1g55a_ | 343 | c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: | 3e-10 | |
| d2c7pa1 | 327 | c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu | 2e-08 | |
| d1dcta_ | 324 | c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a | 2e-08 | |
| d1m4za_ | 217 | b.34.12.1 (A:) Origin-recognition complex protein | 8e-08 |
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNMT2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 59.3 bits (142), Expect = 3e-10
Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 5/59 (8%)
Query: 278 EPEMSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNE 336
EP + +L+LYSG G M L S + AID+N A + K+N P T++ +
Sbjct: 1 EP-LRVLELYSGVGGMHHAL----RESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAK 54
|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324 | Back information, alignment and structure |
|---|
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 433 | |||
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 99.95 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 99.95 | |
| d1m4za_ | 217 | Origin-recognition complex protein 120kDa subunit, | 99.54 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 97.63 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 97.5 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 97.3 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 97.14 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 97.02 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 96.68 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 96.6 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 96.58 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 96.58 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 96.52 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 96.49 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 96.29 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 96.06 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 95.95 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 94.96 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 94.41 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 93.1 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 92.88 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 92.5 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 92.34 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 92.22 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 92.11 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 92.05 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 91.75 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 91.46 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 90.72 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 90.44 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 90.33 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 89.24 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 88.72 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 88.0 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 87.88 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 87.63 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 87.38 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 87.29 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 87.17 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 86.98 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 86.83 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 86.7 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 86.66 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 86.2 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 85.48 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 85.26 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 85.08 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 85.04 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 84.78 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 83.51 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 83.5 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 82.92 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 82.32 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 80.28 |
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNMT2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=3.7e-30 Score=251.99 Aligned_cols=141 Identities=18% Similarity=0.159 Sum_probs=99.9
Q ss_pred CCcEEecccchhHHHHhHhhhhhcCCCeEeeEEEeecCHhhHHHHHHcCCCCceeecChhhHHHh--------cCcCCCC
Q 013949 280 EMSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADDFLSL--------LKEWAKL 351 (433)
Q Consensus 280 ~l~~lDLFsG~GG~s~Gl~~ga~~aG~~~~t~~avD~d~~A~~t~~~N~p~~~v~~~di~d~~~l--------l~~~~~P 351 (433)
+|+++||||||||+++|| +.+|++...+||+|+|++|++||++|||++.++++||+++... +-..++|
T Consensus 2 p~kv~~lF~G~Gg~~~gl----~~aG~~~~~~~a~E~~~~a~~~~~~n~~~~~~~~~di~~~~~~~~~~~~~Dll~ggpP 77 (343)
T d1g55a_ 2 PLRVLELYSGVGGMHHAL----RESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPP 77 (343)
T ss_dssp CEEEEEETCTTCHHHHHH----HHHTCSEEEEEEECCCHHHHHHHHHHCTTSCEECSCGGGCCHHHHHHHCCSEEEECCC
T ss_pred CCEEEEcCcCccHHHHHH----HHcCCCCeEEEEEECCHHHHHHHHHHCCCCCcccCchhhCCHhHcCCCCccEEEeecc
Confidence 689999999999999999 8899966568999999999999999999999999999865321 1124689
Q ss_pred CchhhcccCCCCCCcccCchHHHHHhcccccCCCCCCC--CCcEEEEeccccccccCCCC---CCCCCceEEEEEEEe-e
Q 013949 352 CQYFSIYDTDKVPEQSLNFMSEDEEEEEEEENDDDSNV--PNEEFEVESLTAVCYGDPNK---TKKPGVYFKECCLII-C 425 (433)
Q Consensus 352 CQ~fS~ag~~~~~~d~r~~L~~~~~~~~~~~~~~i~~~--~P~~fvvENV~gi~~~~p~~---~~~~gl~~~v~w~~~-~ 425 (433)
||+||.||++++..|+|+.|+..++++ +..+ +|++|++|||+||+...... .....+||.|.|+.| .
T Consensus 78 Cq~fS~ag~~~~~~d~r~~l~~~~~~~-------i~~~~~kPk~~i~ENV~~l~~~~~~~~i~~~l~~~GY~v~~~vlna 150 (343)
T d1g55a_ 78 CQPFTRIGRQGDMTDSRTNSFLHILDI-------LPRLQKLPKYILLENVKGFEVSSTRDLLIQTIENCGFQYQEFLLSP 150 (343)
T ss_dssp ------------------CHHHHHHHH-------GGGCSSCCSEEEEEEETTGGGSHHHHHHHHHHHHTTEEEEEEEECG
T ss_pred cccccccccccccccccccccchhhhh-------HhhhcCCCceeeeeccCCcccchhhHHHHhhhhccccccceeeeec
Confidence 999999999999999999999999999 6554 79999999999998532111 122568999999999 4
Q ss_pred eeecee
Q 013949 426 YLTFVP 431 (433)
Q Consensus 426 ~~~~~p 431 (433)
.++++|
T Consensus 151 ~dyGvP 156 (343)
T d1g55a_ 151 TSLGIP 156 (343)
T ss_dssp GGGTCS
T ss_pred cccCCc
Confidence 466688
|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|