Citrus Sinensis ID: 014006


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--
MANLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDEGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGRTMAGTSFFALP
cccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccEEEccHHHHHHHHccccccccccEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHccccccccEEEccccccccEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHcccccccccccEEEEEEcccccccccccEEEEEcccccccccccccccccEEEEEEcHHHHHHcccccccccccccEEEcccHHHHHHHccccccccEEccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccc
ccccccHHHHHHHHHHHHHccEEEEEEcccccccccHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEcccHHHHHHHHccccHHccEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHccccEEEcccccccEEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEccccccccccEEEEEEccHHHHHHccccccccccccEEEEEEHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccc
MANLPILQYEETIVETVEQNPVVVVIGEtgsgkstqlSQILHrhgytksgiigvtqpRRVAAVSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREilsnpdlspysviiLDEAHERSLNTDILLGLVKRLVNLRASKLKILITSatldgekvskffsncptlnvpgklypveilhskerptSYLESALKTAIDihvrepegdvliFMTGQDDIEKLVSKLEDKIrsldegscmdavilplhgslppemqvrvfsppppncrrfivstniaetsltvdGVVYVIDCGyvkqrqynpssgmysldVVQISKVQAnqrvgragrtrpgkcyrlypstvyhdefldvtvpeiqrsslaGSVLYLKsldlsdinvlkfdfldppssesLEDALKQLYLIDaidengsitsigrtmagtsffalp
MANLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQElgvrlgeevgyairfedrtserTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILitsatldgekvskffsncptlnvpGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDEGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTniaetsltvDGVVYVIDCGYVKQRQYNPSSGMYSLDVVQISKVQanqrvgragrtrpgkcyrlYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGRTMAGTSFFALP
MANLPILQYEETIvetveqnpvvvvIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPrrvaavsvarrvaQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDEGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGRTMAGTSFFALP
****PILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDEGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLD********DALKQLYLIDAIDENGSITSIGRTMAG*******
*ANLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLE**********C**AVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGRTMAGTSFFALP
MANLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDEGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGRTMAGTSFFALP
**NLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDEGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYSLDVVQISKVQ**********TRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGRTMAGTSF****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDEGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGRTMAGTSFFALP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query432 2.2.26 [Sep-21-2011]
Q38953 1168 Probable pre-mRNA-splicin no no 0.967 0.357 0.526 1e-130
A2A4P0 1244 ATP-dependent RNA helicas yes no 0.967 0.336 0.523 1e-129
Q14562 1220 ATP-dependent RNA helicas yes no 0.967 0.342 0.523 1e-129
Q54F05 1160 ATP-dependent RNA helicas yes no 0.965 0.359 0.517 1e-127
Q767K6 1045 Putative pre-mRNA-splicin no no 0.967 0.4 0.508 1e-127
Q7YR39 1044 Putative pre-mRNA-splicin no no 0.967 0.400 0.505 1e-126
O60231 1041 Putative pre-mRNA-splicin no no 0.967 0.401 0.505 1e-126
Q92620 1227 Pre-mRNA-splicing factor no no 0.960 0.338 0.514 1e-125
Q17R09 1227 Pre-mRNA-splicing factor no no 0.960 0.338 0.514 1e-125
Q54MH3 1106 Putative pre-mRNA-splicin no no 0.967 0.377 0.478 1e-125
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function desciption
 Score =  466 bits (1200), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/422 (52%), Positives = 313/422 (74%), Gaps = 4/422 (0%)

Query: 3   NLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAA 62
           +LPI + ++ +++ V  N V+VVIGETGSGK+TQ++Q L   GYT  G IG TQPRRVAA
Sbjct: 514 SLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTKGKIGCTQPRRVAA 573

Query: 63  VSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVII 122
           +SVA+RVA+E G RLGEEVGYAIRFED T   T+IKY+TDG+LLREIL + +LS YSVI+
Sbjct: 574 MSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVIM 633

Query: 123 LDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLY 182
           LDEAHER+++TD+L GL+K+L+  R   L++++TSATLD EK S +F NC    +PG+ +
Sbjct: 634 LDEAHERTIHTDVLFGLLKKLMKRRLD-LRLIVTSATLDAEKFSGYFFNCNIFTIPGRTF 692

Query: 183 PVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDE 242
           PVEIL++K+  T YL++AL T + IH+ EPEGD+L+F+TGQ++I+     L ++++ L +
Sbjct: 693 PVEILYTKQPETDYLDAALITVLQIHLTEPEGDILVFLTGQEEIDSACQSLYERMKGLGK 752

Query: 243 GSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVK 302
            +  + +ILP++ +LP EMQ R+F PPPP  R+ +V+TNIAE SLT+DG+ YV+D G+ K
Sbjct: 753 -NVPELIILPVYSALPSEMQSRIFDPPPPGKRKVVVATNIAEASLTIDGIYYVVDPGFAK 811

Query: 303 QRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQ 362
           Q  YNP  G+ SL +  IS+  A QR GRAGRT PGKCYRLY  + Y +E    ++PEIQ
Sbjct: 812 QNVYNPKQGLESLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMPPTSIPEIQ 871

Query: 363 RSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGRT 422
           R +L  + L +K++ ++D+  L FDF+DPP  ++L  A++QLY + A+DE G +T +GR 
Sbjct: 872 RINLGMTTLTMKAMGINDL--LSFDFMDPPQPQALISAMEQLYSLGALDEEGLLTKLGRK 929

Query: 423 MA 424
           MA
Sbjct: 930 MA 931




Could act late in the splicing of pre-mRNA and mediate the release of the spliced mRNA from spliceosomes.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 Back     alignment and function description
>sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 Back     alignment and function description
>sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 Back     alignment and function description
>sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
255547802 702 ATP-dependent RNA helicase, putative [Ri 0.981 0.603 0.879 0.0
225425836 700 PREDICTED: ATP-dependent RNA helicase dh 0.981 0.605 0.870 0.0
12323006 708 ATP-dependent RNA helicase, putative [Ar 0.981 0.598 0.863 0.0
18396548 700 helicase associated domain-containing pr 0.981 0.605 0.863 0.0
297738378 704 unnamed protein product [Vitis vinifera] 0.981 0.602 0.862 0.0
356512355 696 PREDICTED: ATP-dependent RNA helicase dh 0.974 0.604 0.853 0.0
449450588 702 PREDICTED: ATP-dependent RNA helicase dh 0.981 0.603 0.846 0.0
224107639 699 predicted protein [Populus trichocarpa] 0.979 0.605 0.832 0.0
242092188 705 hypothetical protein SORBIDRAFT_10g00513 0.974 0.597 0.807 0.0
297611701 708 Os11g0310800 [Oryza sativa Japonica Grou 0.974 0.594 0.800 0.0
>gi|255547802|ref|XP_002514958.1| ATP-dependent RNA helicase, putative [Ricinus communis] gi|223546009|gb|EEF47512.1| ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/424 (87%), Positives = 404/424 (95%)

Query: 1   MANLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRV 60
           MANLPI+Q+E+ I++TVE+NPVVV+IGETGSGKSTQLSQ+LHR GYTKSGIIG+TQPRRV
Sbjct: 1   MANLPIIQFEDKIIKTVEENPVVVIIGETGSGKSTQLSQMLHRRGYTKSGIIGITQPRRV 60

Query: 61  AAVSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSV 120
           AAVSVARRVAQELGV LGEEVGYAIRFEDRTSE T IKYLTDGVLLRE LS P+L+ YSV
Sbjct: 61  AAVSVARRVAQELGVTLGEEVGYAIRFEDRTSELTRIKYLTDGVLLRESLSGPELNQYSV 120

Query: 121 IILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGK 180
           IILDEAHERSLNTD+LLGLVKRLV LRAS LK+LITSATLDGEKVS+FFS CP LNVPGK
Sbjct: 121 IILDEAHERSLNTDVLLGLVKRLVKLRASNLKVLITSATLDGEKVSEFFSGCPILNVPGK 180

Query: 181 LYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSL 240
           LYPVEI++SKERPTSY+ESALKTAIDIH REPEGD+LIFMTGQDDIEKLV KLED+IRSL
Sbjct: 181 LYPVEIMYSKERPTSYIESALKTAIDIHTREPEGDILIFMTGQDDIEKLVMKLEDRIRSL 240

Query: 241 DEGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGY 300
           +EGSCMDA+ILPLHGSLPP++QVRVF+PPPPNCRRFIV+TNIAETSLTVDGVVYV+D GY
Sbjct: 241 EEGSCMDAIILPLHGSLPPDLQVRVFAPPPPNCRRFIVATNIAETSLTVDGVVYVVDSGY 300

Query: 301 VKQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPE 360
           VKQRQYNPS+GMYSLDVVQISKVQANQR GRAGRTRPGKCYRLYPS VY D+FLDVTVPE
Sbjct: 301 VKQRQYNPSTGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSMVYEDDFLDVTVPE 360

Query: 361 IQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIG 420
           IQRSSLAGSVLYLKSLDL DI++LKFDFLDPPS ESLEDALKQLYLIDAIDENGSITS+G
Sbjct: 361 IQRSSLAGSVLYLKSLDLPDIDILKFDFLDPPSYESLEDALKQLYLIDAIDENGSITSVG 420

Query: 421 RTMA 424
           RTMA
Sbjct: 421 RTMA 424




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225425836|ref|XP_002266642.1| PREDICTED: ATP-dependent RNA helicase dhx8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|12323006|gb|AAG51496.1|AC069471_27 ATP-dependent RNA helicase, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18396548|ref|NP_564296.1| helicase associated domain-containing protein [Arabidopsis thaliana] gi|15451224|gb|AAK96883.1| ATP-dependent RNA helicase, putative [Arabidopsis thaliana] gi|22136080|gb|AAM91118.1| ATP-dependent RNA helicase, putative [Arabidopsis thaliana] gi|332192768|gb|AEE30889.1| helicase associated domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297738378|emb|CBI27579.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356512355|ref|XP_003524885.1| PREDICTED: ATP-dependent RNA helicase dhx8-like [Glycine max] Back     alignment and taxonomy information
>gi|449450588|ref|XP_004143044.1| PREDICTED: ATP-dependent RNA helicase dhx8-like [Cucumis sativus] gi|449494554|ref|XP_004159579.1| PREDICTED: ATP-dependent RNA helicase dhx8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224107639|ref|XP_002314547.1| predicted protein [Populus trichocarpa] gi|222863587|gb|EEF00718.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|242092188|ref|XP_002436584.1| hypothetical protein SORBIDRAFT_10g005130 [Sorghum bicolor] gi|241914807|gb|EER87951.1| hypothetical protein SORBIDRAFT_10g005130 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|297611701|ref|NP_001067756.2| Os11g0310800 [Oryza sativa Japonica Group] gi|108864297|gb|ABA92900.2| Helicase associated domain family protein, expressed [Oryza sativa Japonica Group] gi|222615892|gb|EEE52024.1| hypothetical protein OsJ_33742 [Oryza sativa Japonica Group] gi|255680028|dbj|BAF28119.2| Os11g0310800 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
TAIR|locus:2010549 700 AT1G27900 [Arabidopsis thalian 0.981 0.605 0.811 1.1e-181
TAIR|locus:2088847 1168 AT3G26560 [Arabidopsis thalian 0.967 0.357 0.488 1e-109
UNIPROTKB|F1P306 1168 LOC100858239 "Uncharacterized 0.967 0.357 0.490 2.6e-109
UNIPROTKB|F1MEM4 1230 DHX8 "Uncharacterized protein" 0.967 0.339 0.490 3.4e-109
UNIPROTKB|E2R9R9 1216 DHX8 "Uncharacterized protein" 0.967 0.343 0.490 3.4e-109
UNIPROTKB|F5H658 1181 DHX8 "ATP-dependent RNA helica 0.967 0.353 0.490 3.4e-109
UNIPROTKB|Q14562 1220 DHX8 "ATP-dependent RNA helica 0.967 0.342 0.490 3.4e-109
UNIPROTKB|F1S1H3 1212 DHX8 "Uncharacterized protein" 0.967 0.344 0.490 3.4e-109
MGI|MGI:1306823 1244 Dhx8 "DEAH (Asp-Glu-Ala-His) b 0.967 0.336 0.490 3.4e-109
RGD|1310723 1210 Dhx8 "DEAH (Asp-Glu-Ala-His) b 0.967 0.345 0.490 3.4e-109
TAIR|locus:2010549 AT1G27900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1763 (625.7 bits), Expect = 1.1e-181, P = 1.1e-181
 Identities = 344/424 (81%), Positives = 370/424 (87%)

Query:     1 MANLPILQYEETIXXXXXXXXXXXXIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPXXX 60
             MANLPILQ+EE I            IGETGSGKSTQLSQILHRHGYTKSG+I +TQP   
Sbjct:     1 MANLPILQFEEKIVETVEKNSVVVIIGETGSGKSTQLSQILHRHGYTKSGVIAITQPRRV 60

Query:    61 XXXXXXXXXXQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSV 120
                       QEL V LGE+VGYAIRFEDRT+ +T IKYLTDGVLLRE LSNP L  YSV
Sbjct:    61 AAVSVARRVAQELDVPLGEDVGYAIRFEDRTTSKTRIKYLTDGVLLRESLSNPMLDDYSV 120

Query:   121 IILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGK 180
             IILDEAHERSLNTDILLGLVKRLV +RAS  K+LITSATLDGEKVS+FFS CP LNVPGK
Sbjct:   121 IILDEAHERSLNTDILLGLVKRLVRIRASNFKVLITSATLDGEKVSEFFSGCPVLNVPGK 180

Query:   181 LYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSL 240
             LYPVEIL+SKERP SY+ES+LK AIDIHVREPEGD+LIFMTGQDDIEKLVS+LE+K+RSL
Sbjct:   181 LYPVEILYSKERPVSYIESSLKVAIDIHVREPEGDILIFMTGQDDIEKLVSRLEEKVRSL 240

Query:   241 DEGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGY 300
              EGSCMDA+I PLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVID GY
Sbjct:   241 AEGSCMDAIIYPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDSGY 300

Query:   301 VKQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPE 360
             VKQRQYNPSSGM+SLDV+QISKVQANQR GRAGRTRPGKCYRLYP  VY D+FLD T+PE
Sbjct:   301 VKQRQYNPSSGMFSLDVIQISKVQANQRAGRAGRTRPGKCYRLYPLAVYRDDFLDATIPE 360

Query:   361 IQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIG 420
             IQR+SLAGSVLYLKSLDL DI++LKFDFLD PSSESLEDALKQLY IDAIDENG+IT IG
Sbjct:   361 IQRTSLAGSVLYLKSLDLPDIDILKFDFLDAPSSESLEDALKQLYFIDAIDENGAITRIG 420

Query:   421 RTMA 424
             RTM+
Sbjct:   421 RTMS 424




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0006310 "DNA recombination" evidence=RCA
GO:0007062 "sister chromatid cohesion" evidence=RCA
GO:0007126 "meiosis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0010332 "response to gamma radiation" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0032204 "regulation of telomere maintenance" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0042138 "meiotic DNA double-strand break formation" evidence=RCA
GO:0043247 "telomere maintenance in response to DNA damage" evidence=RCA
GO:0045132 "meiotic chromosome segregation" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2088847 AT3G26560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1P306 LOC100858239 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEM4 DHX8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9R9 DHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F5H658 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q14562 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1H3 DHX8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1306823 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310723 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.13LOW CONFIDENCE prediction!
3rd Layer3.6.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT1G27900
RNA helicase, putative; RNA helicase, putative; FUNCTIONS IN- in 7 functions; INVOLVED IN- biological_process unknown; LOCATED IN- cellular_component unknown; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Helicase-associated region (InterPro-IPR007502), ATPase, AAA+ type, core (InterPro-IPR003593), Region of unknown function DUF1605 (InterPro-IPR011709), DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site (InterPro-IPR002464), DEAD-like helicase, N-terminal (InterPro-IPR014001), DNA/RNA helicase, C-terminal (InterPro-IPR00 [...] (700 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT1G19070
F-box family protein; F-box family protein; FUNCTIONS IN- molecular_function unknown; INVOLVED [...] (83 aa)
       0.780
AT1G64370
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (178 aa)
       0.748
AT4G31910
transferase family protein; transferase family protein; FUNCTIONS IN- transferase activity, tra [...] (458 aa)
       0.718
AT2G27830
unknown protein; FUNCTIONS IN- molecular_function unknown; EXPRESSED IN- 22 plant structures; E [...] (190 aa)
       0.718
AT1G49000
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (156 aa)
       0.718
AT3G27025
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; Has 8 Blast hits to [...] (299 aa)
       0.716
AT3G15160
unknown protein; unknown protein; INVOLVED IN- biological_process unknown; LOCATED IN- cellular [...] (562 aa)
       0.679
AT1G52060
unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biological_process unkn [...] (314 aa)
       0.677
AT1G68200
zinc finger (CCCH-type) family protein; zinc finger (CCCH-type) family protein; FUNCTIONS IN- t [...] (308 aa)
       0.659
AtbZIP3
AtbZIP3 (Arabidopsis thaliana basic leucine-zipper 3); DNA binding / transcription factor; Arab [...] (186 aa)
       0.625

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 0.0
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-111
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-103
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 4e-98
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 3e-81
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 6e-26
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-20
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 6e-12
smart0049082 smart00490, HELICc, helicase superfamily c-termina 7e-12
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-11
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 5e-10
COG1203733 COG1203, COG1203, CRISPR-associated helicase Cas3 4e-05
pfam13401124 pfam13401, AAA_22, AAA domain 5e-05
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 8e-05
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 2e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-04
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 7e-04
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 0.002
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
 Score =  563 bits (1452), Expect = 0.0
 Identities = 211/423 (49%), Positives = 285/423 (67%), Gaps = 9/423 (2%)

Query: 3   NLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAA 62
            LP+    + I++ +EQN VV+++GETGSGK+TQL Q L   G   +G IG TQPRR+AA
Sbjct: 48  GLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEGLGIAGKIGCTQPRRLAA 107

Query: 63  VSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVII 122
            SVA RVA+ELG +LGE VGY+IRFE + S RT IK +TDG+LLREI ++P LS YSV+I
Sbjct: 108 RSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIKVMTDGILLREIQNDPLLSGYSVVI 167

Query: 123 LDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLY 182
           +DEAHERSLNTDILLGL+K L+  R   LK++I SATLD E+ S +F N P + + G+ Y
Sbjct: 168 IDEAHERSLNTDILLGLLKDLLARRRDDLKLIIMSATLDAERFSAYFGNAPVIEIEGRTY 227

Query: 183 PVEILHSKERPTSY-LESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLD 241
           PVEI +  E    Y L  A+  A+DIH+RE  G +L+F+ GQ +IE+    LE       
Sbjct: 228 PVEIRYLPEAEADYILLDAIVAAVDIHLREGSGSILVFLPGQREIERTAEWLEKAEL--- 284

Query: 242 EGSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYV 301
                D  ILPL+G+L  E QVRVF P P   R+ +++TNIAETSLT+ G+ YVID G  
Sbjct: 285 ---GDDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLATNIAETSLTIPGIRYVIDSGLA 341

Query: 302 KQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEI 361
           K+++Y+P +G+  L+   ISK  A+QR GRAGRT PG CYRLY    +   F + T+PEI
Sbjct: 342 KEKRYDPRTGLTRLETEPISKASADQRAGRAGRTGPGICYRLYSEEDF-LAFPEFTLPEI 400

Query: 362 QRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGR 421
            R+ L+G VL LKSL +   ++  F FLDPP   +++ AL  L  + A+D++G +T +G+
Sbjct: 401 LRTDLSGLVLQLKSLGI-GQDIAPFPFLDPPPEAAIQAALTLLQELGALDDSGKLTPLGK 459

Query: 422 TMA 424
            M+
Sbjct: 460 QMS 462


Length = 845

>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 432
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0354 746 consensus DEAD-box like helicase [General function 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 100.0
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 100.0
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 100.0
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.97
PRK14701 1638 reverse gyrase; Provisional 99.97
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.97
PRK09694 878 helicase Cas3; Provisional 99.97
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.97
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.97
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.97
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.97
PRK05580679 primosome assembly protein PriA; Validated 99.97
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.96
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.96
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.96
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.96
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.95
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.95
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.95
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.95
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.94
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.94
PRK04914 956 ATP-dependent helicase HepA; Validated 99.93
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.93
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.91
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.91
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.9
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.9
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.89
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.85
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.85
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.83
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.82
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.82
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.81
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.81
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.8
COG4096 875 HsdR Type I site-specific restriction-modification 99.79
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.79
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.78
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.75
PRK05298652 excinuclease ABC subunit B; Provisional 99.74
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.72
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.71
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.67
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.65
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.64
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.63
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.62
smart00487201 DEXDc DEAD-like helicases superfamily. 99.61
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.61
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.6
KOG1123776 consensus RNA polymerase II transcription initiati 99.57
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.57
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.55
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.54
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.53
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.49
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.48
smart0049082 HELICc helicase superfamily c-terminal domain. 99.45
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.45
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.43
PRK14873665 primosome assembly protein PriA; Provisional 99.42
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.39
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.35
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.29
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.23
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.23
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.15
COG4889 1518 Predicted helicase [General function prediction on 99.15
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.09
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.08
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.0
KOG0387 923 consensus Transcription-coupled repair protein CSB 98.99
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.96
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.88
COG0610 962 Type I site-specific restriction-modification syst 98.68
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.65
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.56
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.5
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.5
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.49
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 98.46
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.43
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.43
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.42
PRK10536262 hypothetical protein; Provisional 98.36
KOG1002791 consensus Nucleotide excision repair protein RAD16 98.35
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.35
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 98.35
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.29
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 98.29
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.29
PF1324576 AAA_19: Part of AAA domain 98.28
cd03246173 ABCC_Protease_Secretion This family represents the 98.25
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.25
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.24
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.23
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 98.23
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.21
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.21
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.19
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 98.19
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 98.19
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.19
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 98.18
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 98.17
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.16
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 98.15
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.14
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 98.14
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.13
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.1
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.1
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 98.1
PRK10875615 recD exonuclease V subunit alpha; Provisional 98.09
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 98.09
PRK14974336 cell division protein FtsY; Provisional 98.06
smart00382148 AAA ATPases associated with a variety of cellular 98.05
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.05
COG1119257 ModF ABC-type molybdenum transport system, ATPase 98.02
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.01
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.0
KOG1803649 consensus DNA helicase [Replication, recombination 97.97
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.96
PRK04296190 thymidine kinase; Provisional 97.96
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.95
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.95
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.94
PRK15483 986 type III restriction-modification system StyLTI en 97.94
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.94
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.93
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.93
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.93
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.93
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 97.93
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.92
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.92
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.9
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 97.9
PRK08181269 transposase; Validated 97.87
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 97.86
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.86
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 97.86
PRK06526254 transposase; Provisional 97.86
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.85
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.84
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 97.84
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 97.84
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.83
COG1127263 Ttg2A ABC-type transport system involved in resist 97.83
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.82
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.81
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.81
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 97.81
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.81
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 97.8
PRK13537306 nodulation ABC transporter NodI; Provisional 97.8
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.79
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 97.79
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 97.79
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.79
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 97.78
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 97.78
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 97.77
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.76
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.76
PRK07952244 DNA replication protein DnaC; Validated 97.76
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.76
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 97.75
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.75
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.75
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.75
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.75
PRK13536340 nodulation factor exporter subunit NodI; Provision 97.74
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.73
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.73
PRK10908222 cell division protein FtsE; Provisional 97.72
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.72
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.72
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.72
PRK10416318 signal recognition particle-docking protein FtsY; 97.72
COG4987573 CydC ABC-type transport system involved in cytochr 97.71
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.7
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.7
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 97.7
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 97.7
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.69
PRK13546264 teichoic acids export protein ATP-binding subunit; 97.69
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.69
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.67
COG4988559 CydD ABC-type transport system involved in cytochr 97.67
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.67
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.67
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 97.67
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.67
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.66
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 97.65
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 97.65
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 97.65
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.64
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 97.64
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 97.64
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.64
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.64
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.63
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 97.63
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 97.63
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 97.63
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 97.62
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.61
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 97.61
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.61
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 97.61
PRK08116268 hypothetical protein; Validated 97.61
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.61
PRK06893229 DNA replication initiation factor; Validated 97.61
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.6
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.6
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.6
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.6
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.6
TIGR00064272 ftsY signal recognition particle-docking protein F 97.59
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 97.59
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 97.59
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 97.58
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 97.58
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 97.58
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 97.58
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.58
PRK08727233 hypothetical protein; Validated 97.58
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.58
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 97.58
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.57
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 97.57
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.56
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.56
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.56
KOG2340698 consensus Uncharacterized conserved protein [Funct 97.56
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.56
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 97.56
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 97.55
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 97.54
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 97.54
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 97.54
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 97.54
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 97.54
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.53
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.53
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.53
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 97.53
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 97.53
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 97.52
PRK06921266 hypothetical protein; Provisional 97.52
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 97.52
PRK10789569 putative multidrug transporter membrane\ATP-bindin 97.52
COG4133209 CcmA ABC-type transport system involved in cytochr 97.52
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 97.51
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.51
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 97.51
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 97.5
PRK11153343 metN DL-methionine transporter ATP-binding subunit 97.5
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 97.5
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 97.5
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 97.5
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 97.49
COG4152300 ABC-type uncharacterized transport system, ATPase 97.49
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 97.49
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.49
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 97.49
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 97.49
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 97.48
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 97.48
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.48
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 97.48
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.48
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 97.47
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 97.47
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 97.47
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 97.47
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.47
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.47
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 97.46
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 97.46
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 97.46
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.46
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.45
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 97.45
PRK10619257 histidine/lysine/arginine/ornithine transporter su 97.45
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.45
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.45
cd03239178 ABC_SMC_head The structural maintenance of chromos 97.45
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 97.45
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 97.45
PRK13545549 tagH teichoic acids export protein ATP-binding sub 97.44
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.44
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 97.44
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 97.44
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 97.44
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 97.44
PRK10790592 putative multidrug transporter membrane\ATP-bindin 97.44
cd03234226 ABCG_White The White subfamily represents ABC tran 97.44
PF13173128 AAA_14: AAA domain 97.43
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.43
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 97.43
PRK10070400 glycine betaine transporter ATP-binding subunit; P 97.43
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 97.42
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 97.42
PRK08084235 DNA replication initiation factor; Provisional 97.42
PRK08939306 primosomal protein DnaI; Reviewed 97.42
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 97.42
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 97.41
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 97.41
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.41
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 97.41
PRK12377248 putative replication protein; Provisional 97.41
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 97.41
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.4
PRK09112351 DNA polymerase III subunit delta'; Validated 97.4
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 97.4
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 97.4
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 97.39
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 97.39
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 97.39
cd03299235 ABC_ModC_like Archeal protein closely related to M 97.39
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 97.38
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.38
PRK09183259 transposase/IS protein; Provisional 97.38
PRK06835329 DNA replication protein DnaC; Validated 97.38
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 97.38
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 97.38
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 97.38
PRK10522547 multidrug transporter membrane component/ATP-bindi 97.38
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 97.37
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 97.37
COG4525259 TauB ABC-type taurine transport system, ATPase com 97.37
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.36
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.36
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 97.36
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 97.36
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 97.36
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.35
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 97.35
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.35
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 97.35
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 97.35
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 97.35
PRK05642234 DNA replication initiation factor; Validated 97.35
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 97.35
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 97.34
PF05729166 NACHT: NACHT domain 97.34
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.34
PRK00771437 signal recognition particle protein Srp54; Provisi 97.34
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.34
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.34
COG0552340 FtsY Signal recognition particle GTPase [Intracell 97.33
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 97.33
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 97.33
PRK10253265 iron-enterobactin transporter ATP-binding protein; 97.33
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 97.33
PRK12402337 replication factor C small subunit 2; Reviewed 97.33
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 97.32
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.32
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.32
COG4178604 ABC-type uncharacterized transport system, permeas 97.3
COG4619223 ABC-type uncharacterized transport system, ATPase 97.3
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.3
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 97.3
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 97.3
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 97.29
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 97.29
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 97.29
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 97.29
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.28
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 97.28
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 97.27
PRK10867433 signal recognition particle protein; Provisional 97.27
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 97.26
COG3910233 Predicted ATPase [General function prediction only 97.26
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.25
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 97.25
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 97.25
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.24
TIGR00376637 DNA helicase, putative. The gene product may repre 97.24
COG2256436 MGS1 ATPase related to the helicase subunit of the 97.23
PRK13833323 conjugal transfer protein TrbB; Provisional 97.23
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 97.23
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 97.22
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 97.22
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.22
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 97.21
PLN032321495 ABC transporter C family member; Provisional 97.21
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.21
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 97.2
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 97.19
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 97.19
COG3842352 PotA ABC-type spermidine/putrescine transport syst 97.19
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 97.19
PRK14087450 dnaA chromosomal replication initiation protein; P 97.18
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 97.18
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.17
PF00004132 AAA: ATPase family associated with various cellula 97.17
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.17
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.17
PLN031301622 ABC transporter C family member; Provisional 97.17
PHA02544316 44 clamp loader, small subunit; Provisional 97.17
PRK06067234 flagellar accessory protein FlaH; Validated 97.17
PRK10938490 putative molybdenum transport ATP-binding protein 97.16
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 97.16
PRK09580248 sufC cysteine desulfurase ATPase component; Review 97.16
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.16
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 97.16
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.15
PRK00149450 dnaA chromosomal replication initiation protein; R 97.15
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.15
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.15
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.14
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.14
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 97.14
PRK09984262 phosphonate/organophosphate ester transporter subu 97.14
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 97.14
PRK13851344 type IV secretion system protein VirB11; Provision 97.14
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=1.2e-87  Score=636.83  Aligned_cols=423  Identities=58%  Similarity=0.945  Sum_probs=410.3

Q ss_pred             CCchhhhHHHHHHHHhcCCEEEEEcCCCCCHHHHHHHHHhhcCCCCCcEEEecccchhhhHHHHHHHHHHhCCccCCeee
Q 014006            3 NLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQELGVRLGEEVG   82 (432)
Q Consensus         3 ~lp~~~~q~~i~~~i~~~~~~ii~apTGsGKT~~~~~~~~~~~~~~~~~vl~~~P~~~l~~q~~~~~~~~~~~~~~~~~g   82 (432)
                      .||++++..+++..+.+++.+||.|+|||||||++|+++....+...+++.|++|+|..|..++++++.+.+...|..+|
T Consensus        49 ~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~~g~I~~TQPRRVAavslA~RVAeE~~~~lG~~VG  128 (674)
T KOG0922|consen   49 SLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFASSGKIACTQPRRVAAVSLAKRVAEEMGCQLGEEVG  128 (674)
T ss_pred             cCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhcccccCCcEEeecCchHHHHHHHHHHHHHhCCCcCceee
Confidence            69999999999999999999999999999999999999999988888889999999999999999999999999999999


Q ss_pred             eeeeecccCCCCceEEEcCHHHHHHHHhcCCCCCCCcEEEEeCCCcCCCCHHHHHHHHHHHHhhhcCCcEEEEEecccCh
Q 014006           83 YAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDG  162 (432)
Q Consensus        83 ~~~~~~~~~~~~~~i~v~T~~~l~~~l~~~~~l~~~~~vViDE~h~~~~~~~~~~~~l~~~~~~~~~~~~ii~~SAT~~~  162 (432)
                      |.+++++....++.|.|+|.|+|++.++.++.++++++||+||||+|.+.+|.++.+++.+++.++. .++|+||||++.
T Consensus       129 Y~IRFed~ts~~TrikymTDG~LLRE~l~Dp~LskYsvIIlDEAHERsl~TDiLlGlLKki~~~R~~-LklIimSATlda  207 (674)
T KOG0922|consen  129 YTIRFEDSTSKDTRIKYMTDGMLLREILKDPLLSKYSVIILDEAHERSLHTDILLGLLKKILKKRPD-LKLIIMSATLDA  207 (674)
T ss_pred             eEEEecccCCCceeEEEecchHHHHHHhcCCccccccEEEEechhhhhhHHHHHHHHHHHHHhcCCC-ceEEEEeeeecH
Confidence            9999999999999999999999999999999999999999999999999999999999999999886 999999999999


Q ss_pred             HHHHhhccCCCeeecCCCCCceeEEeCCCCCcchHHHHHHHHHHHHhcCCCCCEEEEeCCHHHHHHHHHHHHHHHhhccC
Q 014006          163 EKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDE  242 (432)
Q Consensus       163 ~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lvF~~t~~~~~~~~~~L~~~~~~~~~  242 (432)
                      +.+++||.+++++.++|+.+|+++.|...+..+|+++.+..+.+++.++++|.+|||++++++++.++..|.+....+..
T Consensus       208 ~kfS~yF~~a~i~~i~GR~fPVei~y~~~p~~dYv~a~~~tv~~Ih~~E~~GDILvFLtGqeEIe~~~~~l~e~~~~~~~  287 (674)
T KOG0922|consen  208 EKFSEYFNNAPILTIPGRTFPVEILYLKEPTADYVDAALITVIQIHLTEPPGDILVFLTGQEEIEAACELLRERAKSLPE  287 (674)
T ss_pred             HHHHHHhcCCceEeecCCCCceeEEeccCCchhhHHHHHHHHHHHHccCCCCCEEEEeCCHHHHHHHHHHHHHHhhhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998776665


Q ss_pred             CCCCCeEEEEecCCCCHHHHhccCCCCCCCccEEEEeecCcccccccCCeEEEEeCCcccceeecCCCCCccceEeeecH
Q 014006          243 GSCMDAVILPLHGSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYSLDVVQISK  322 (432)
Q Consensus       243 ~~~~~~~~~~~h~~l~~~~r~~~~~~f~~g~~~ilvaT~~~~~Gidi~~v~~VI~~~~~~~~~~~~~~~~~~~~~~~~s~  322 (432)
                      . ++. .+.++||.|+.+++.++++..+.|.++|++|||++|.+++||+|.+|||+|+.|...|++.+|+..+...|+|+
T Consensus       288 ~-~~~-~~lply~aL~~e~Q~rvF~p~p~g~RKvIlsTNIAETSlTI~GI~YVVDsG~vK~~~y~p~~g~~~L~v~~ISk  365 (674)
T KOG0922|consen  288 D-CPE-LILPLYGALPSEEQSRVFDPAPPGKRKVILSTNIAETSLTIDGIRYVVDSGFVKQKKYNPRTGLDSLIVVPISK  365 (674)
T ss_pred             c-Ccc-eeeeecccCCHHHhhccccCCCCCcceEEEEcceeeeeEEecceEEEEcCCceEEEeeccccCccceeEEechH
Confidence            4 222 78899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHhhcccCCCCCCeEEEecCccchhhcCCCCCCCccccCCchHHHHHHhhCCCCCCccccccCCCCCCHHHHHHHHH
Q 014006          323 VQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALK  402 (432)
Q Consensus       323 ~~~~qr~GRaGR~~~G~~~~l~~~~~~~~~~~~~~~~~i~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~p~~~~l~~~~~  402 (432)
                      ++..||+|||||.+||+||+||++++|+. |+..+.|||+|++|...+|+++++|+.+  +..|+|+|||+.+++..|++
T Consensus       366 asA~QRaGRAGRt~pGkcyRLYte~~~~~-~~~~~~PEI~R~~Ls~~vL~Lkalgi~d--~l~F~f~d~P~~~~l~~AL~  442 (674)
T KOG0922|consen  366 ASANQRAGRAGRTGPGKCYRLYTESAYDK-MPLQTVPEIQRVNLSSAVLQLKALGIND--PLRFPFIDPPPPEALEEALE  442 (674)
T ss_pred             HHHhhhcccCCCCCCceEEEeeeHHHHhh-cccCCCCceeeechHHHHHHHHhcCCCC--cccCCCCCCCChHHHHHHHH
Confidence            99999999999999999999999999977 9999999999999999999999999999  99999999999999999999


Q ss_pred             HHHHccCCCCCCCCCH-HHHHhhcCCCCCC
Q 014006          403 QLYLIDAIDENGSITS-IGRTMAGTSFFAL  431 (432)
Q Consensus       403 ~L~~~g~i~~~~~~t~-lG~~~~~l~~~~~  431 (432)
                      .|..+|++|++|.+|. +|+.|+.+|++|.
T Consensus       443 ~L~~lgald~~g~lt~p~G~~ma~~Pl~p~  472 (674)
T KOG0922|consen  443 ELYSLGALDDRGKLTSPLGRQMAELPLEPH  472 (674)
T ss_pred             HHHhcCcccCcCCcCchHHhhhhhcCCCcc
Confidence            9999999999999999 9999999999984



>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 1e-105
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 1e-105
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 3e-15
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure

Iteration: 1

Score = 378 bits (970), Expect = e-105, Method: Compositional matrix adjust. Identities = 191/404 (47%), Positives = 275/404 (68%), Gaps = 11/404 (2%) Query: 26 IGETGSGKSTQLSQ--ILHRHGYTKSGIIGVTQPXXXXXXXXXXXXXQELGVRLGEEVGY 83 +GETGSGK+TQ+ Q + + ++ + TQP +E+ V+LGEEVGY Sbjct: 115 VGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGY 174 Query: 84 AIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRL 143 +IRFE++TS +T++KY+TDG+LLRE + + DLS YS IILDEAHER+L TDIL+GL+K++ Sbjct: 175 SIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQV 234 Query: 144 VNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKT 203 V R LKI+I SATLD EK ++F++ P L VPG+ YPVE+ ++ E YL+SA++T Sbjct: 235 VKRRPD-LKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRT 293 Query: 204 AIDIHVREPEGDVLIFMTGQDDIEKLVSKLE-DKIRSLDEGSCMDAVILPLHGSLPPEMQ 262 + IH E GD+L+F+TG+D+IE V K+ + + + E C + PL+GSLPP Q Sbjct: 294 VLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQ 353 Query: 263 VRVFSPPPPNC-----RRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYSLDV 317 R+F P P + R+ ++STNIAETSLT+DG+VYV+D G+ KQ+ YNP + SL V Sbjct: 354 QRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLV 413 Query: 318 VQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLD 377 ISK A QR GRAGRTRPGKC+RLY + E ++ + PEI RS+L+ +VL LK L Sbjct: 414 SPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLG 473 Query: 378 LSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENGSITSIGR 421 + D+ + FDF+DPP+ E++ AL++L + +D+ G++T +GR Sbjct: 474 IDDL--VHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGR 515
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 0.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 5e-99
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-97
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 2e-95
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 5e-91
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 2e-88
1yks_A440 Genome polyprotein [contains: flavivirin protease 8e-85
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-84
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 2e-83
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3i4u_A 270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 6e-13
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  670 bits (1732), Expect = 0.0
 Identities = 207/430 (48%), Positives = 299/430 (69%), Gaps = 11/430 (2%)

Query: 3   NLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRH--GYTKSGIIGVTQPRRV 60
            LP+    +  ++  + N ++V +GETGSGK+TQ+ Q +      + ++  +  TQPRRV
Sbjct: 92  ELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRV 151

Query: 61  AAVSVARRVAQELGVRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSV 120
           AA+SVA+RVA+E+ V+LGEEVGY+IRFE++TS +T++KY+TDG+LLRE + + DLS YS 
Sbjct: 152 AAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSC 211

Query: 121 IILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGK 180
           IILDEAHER+L TDIL+GL+K++V  R   LKI+I SATLD EK  ++F++ P L VPG+
Sbjct: 212 IILDEAHERTLATDILMGLLKQVVKRRPD-LKIIIMSATLDAEKFQRYFNDAPLLAVPGR 270

Query: 181 LYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSL 240
            YPVE+ ++ E    YL+SA++T + IH  E  GD+L+F+TG+D+IE  V K+  +   L
Sbjct: 271 TYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQL 330

Query: 241 -DEGSCMDAVILPLHGSLPPEMQVRVFSPPPPN-----CRRFIVSTNIAETSLTVDGVVY 294
             E  C    + PL+GSLPP  Q R+F P P +      R+ ++STNIAETSLT+DG+VY
Sbjct: 331 VREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVY 390

Query: 295 VIDCGYVKQRQYNPSSGMYSLDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFL 354
           V+D G+ KQ+ YNP   + SL V  ISK  A QR GRAGRTRPGKC+RLY    +  E +
Sbjct: 391 VVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELI 450

Query: 355 DVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSSESLEDALKQLYLIDAIDENG 414
           + + PEI RS+L+ +VL LK L + D+  + FDF+DPP+ E++  AL++L  +  +D+ G
Sbjct: 451 EQSYPEILRSNLSSTVLELKKLGIDDL--VHFDFMDPPAPETMMRALEELNYLACLDDEG 508

Query: 415 SITSIGRTMA 424
           ++T +GR  +
Sbjct: 509 NLTPLGRLAS 518


>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.96
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.96
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.95
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.95
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.95
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.94
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.94
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.93
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.91
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.91
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.9
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.9
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.9
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.9
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.9
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.9
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.89
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.89
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.89
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.89
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.89
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.89
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.89
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.88
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.88
3bor_A237 Human initiation factor 4A-II; translation initiat 99.88
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.88
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.88
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.88
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.88
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.87
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.77
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.85
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.82
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.8
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.79
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.72
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.69
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.67
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.56
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.35
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.73
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.35
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.24
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.19
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.97
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.91
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 97.83
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.82
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.78
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.74
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.74
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 97.74
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.68
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 97.67
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.67
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.65
1sgw_A214 Putative ABC transporter; structural genomics, P p 97.64
3co5_A143 Putative two-component system transcriptional RES 97.62
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.61
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.61
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.6
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.59
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 97.58
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.58
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.57
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 97.56
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.54
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.53
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.52
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 97.51
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.47
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 97.47
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.47
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 97.46
1g6h_A257 High-affinity branched-chain amino acid transport 97.45
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.45
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.42
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.4
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.4
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 97.39
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.39
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.38
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.38
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.37
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 97.34
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.33
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.32
1b0u_A262 Histidine permease; ABC transporter, transport pro 97.32
3bos_A242 Putative DNA replication factor; P-loop containing 97.32
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 97.31
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 97.31
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 97.31
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.29
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.29
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 97.26
1ojl_A304 Transcriptional regulatory protein ZRAR; response 97.25
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.25
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.25
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.25
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.24
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 97.23
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.22
2qgz_A308 Helicase loader, putative primosome component; str 97.21
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.2
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 97.2
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.2
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.19
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.18
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 97.18
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.17
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.16
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 97.16
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 97.16
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.16
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.15
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 97.11
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.1
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.1
2ghi_A260 Transport protein; multidrug resistance protein, M 97.1
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 97.09
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 97.08
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 97.08
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 97.08
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 97.07
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 97.07
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.06
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.05
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.04
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.0
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 96.99
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.98
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.98
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.97
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 96.97
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 96.95
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 96.93
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 96.93
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 96.93
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 96.92
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 96.91
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 96.9
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.88
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.86
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.85
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.85
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.81
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.79
4aby_A415 DNA repair protein RECN; hydrolase, double strand 96.79
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.79
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 96.77
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 96.77
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 96.75
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.75
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 96.74
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.74
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.73
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.73
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.73
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.71
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 96.71
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 96.7
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.7
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 96.68
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.67
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.65
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.65
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 96.64
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 96.61
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 96.6
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.6
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.6
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.6
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 96.58
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.57
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 96.56
1p9r_A418 General secretion pathway protein E; bacterial typ 96.53
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.52
3pvs_A447 Replication-associated recombination protein A; ma 96.49
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.48
2oap_1511 GSPE-2, type II secretion system protein; hexameri 96.46
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.42
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.4
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.4
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.38
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.35
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.29
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.26
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.24
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.17
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.15
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.1
2chq_A319 Replication factor C small subunit; DNA-binding pr 96.07
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.05
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.04
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.02
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 95.99
2ewv_A372 Twitching motility protein PILT; pilus retraction 95.98
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 95.97
2fna_A357 Conserved hypothetical protein; structural genomic 95.96
2og2_A359 Putative signal recognition particle receptor; nuc 95.96
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.96
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.94
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.94
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 95.93
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 95.92
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.9
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.86
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.85
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.84
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.8
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 95.79
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.77
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 95.77
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 95.75
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.65
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 95.64
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.58
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.52
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.51
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.49
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 95.49
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.48
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.45
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 95.41
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 95.39
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 95.38
2xxa_A433 Signal recognition particle protein; protein trans 95.34
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.33
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 95.29
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.27
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.23
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 95.19
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.11
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.04
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.04
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.03
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 95.01
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.99
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 94.88
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.85
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.83
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.78
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 94.63
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.59
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 94.57
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 94.56
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.52
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 94.52
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 94.45
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 94.43
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 94.41
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.41
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.37
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.35
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 94.33
3kta_A182 Chromosome segregation protein SMC; structural mai 94.28
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 94.26
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.19
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.19
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.17
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.12
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.11
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.1
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 94.02
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.01
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 93.98
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 93.93
2z43_A324 DNA repair and recombination protein RADA; archaea 93.92
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 93.91
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 93.91
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.86
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 93.8
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 93.79
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.78
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.78
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 93.76
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 93.73
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 93.72
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.71
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 93.68
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 93.68
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 93.65
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 93.63
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 93.62
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.61
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 93.58
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.52
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 93.49
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.48
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 93.48
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.46
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 93.45
1xjc_A169 MOBB protein homolog; structural genomics, midwest 93.41
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.4
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 93.4
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 93.38
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 93.31
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.3
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 93.3
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.29
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.27
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.26
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 93.24
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.19
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.13
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.1
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 93.03
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.03
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.01
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 92.99
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 92.93
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 92.93
1tue_A212 Replication protein E1; helicase, replication, E1E 92.82
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 92.81
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 92.79
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 92.78
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 92.77
2r44_A331 Uncharacterized protein; putative ATPase, structur 92.76
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 92.74
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 92.73
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 92.65
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 92.61
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.59
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 92.57
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 92.56
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 92.5
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 92.47
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.45
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 92.39
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 92.34
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 92.33
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 92.32
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.25
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.21
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.21
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 92.15
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 92.13
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 92.1
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 92.08
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 92.06
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 92.04
1u94_A356 RECA protein, recombinase A; homologous recombinat 92.0
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 91.99
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 91.99
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.93
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 91.91
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 91.9
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 91.9
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 91.72
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 91.71
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 91.71
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 91.64
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 91.64
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 91.64
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.63
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.63
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 91.61
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 91.58
1via_A175 Shikimate kinase; structural genomics, transferase 91.53
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.52
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 91.45
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 91.42
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 91.36
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 91.32
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.25
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 91.23
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 91.15
3io5_A333 Recombination and repair protein; storage dimer, i 91.03
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 91.01
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 91.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 90.95
2vli_A183 Antibiotic resistance protein; transferase, tunica 90.94
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 90.89
2www_A349 Methylmalonic aciduria type A protein, mitochondri 90.88
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 90.78
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 90.7
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 90.68
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 90.64
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 90.62
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 90.59
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.58
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 90.54
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.52
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 90.51
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 90.46
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 90.43
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 90.43
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 90.37
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 90.34
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 90.24
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 90.19
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 90.15
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 90.03
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 89.98
2r62_A268 Cell division protease FTSH homolog; ATPase domain 89.94
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 89.93
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 89.91
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 89.88
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 89.85
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 89.82
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 89.71
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 89.68
3r20_A233 Cytidylate kinase; structural genomics, seattle st 89.67
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 89.52
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 89.39
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 89.32
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 89.31
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 89.25
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 89.23
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 88.77
1e69_A322 Chromosome segregation SMC protein; structural mai 88.73
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 88.71
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 88.55
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 88.41
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 88.37
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 88.32
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 88.27
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 88.25
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 88.02
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 88.02
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 87.99
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 87.93
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 87.86
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 87.85
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 87.81
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 87.78
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 87.77
3bor_A237 Human initiation factor 4A-II; translation initiat 87.75
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 87.7
2ged_A193 SR-beta, signal recognition particle receptor beta 87.66
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 87.65
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 87.6
2wji_A165 Ferrous iron transport protein B homolog; membrane 87.55
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 87.42
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 87.4
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 87.37
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 87.35
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 87.33
3lxx_A239 GTPase IMAP family member 4; structural genomics c 87.25
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 87.19
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 87.16
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 87.1
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 87.06
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 87.05
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 87.04
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 87.01
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 86.97
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=1.1e-71  Score=575.52  Aligned_cols=425  Identities=49%  Similarity=0.829  Sum_probs=389.1

Q ss_pred             CCchhhhHHHHHHHHhcCCEEEEEcCCCCCHHHHHHHHHhhcCCCC--CcEEEecccchhhhHHHHHHHHHHhCCccCCe
Q 014006            3 NLPILQYEETIVETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTK--SGIIGVTQPRRVAAVSVARRVAQELGVRLGEE   80 (432)
Q Consensus         3 ~lp~~~~q~~i~~~i~~~~~~ii~apTGsGKT~~~~~~~~~~~~~~--~~~vl~~~P~~~l~~q~~~~~~~~~~~~~~~~   80 (432)
                      .+|++.+++++...+..+++++++||||||||++++.++.......  +.++++++|+++++.|+++++++.++..++..
T Consensus        92 ~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~La~q~~~~l~~~~~~~v~~~  171 (773)
T 2xau_A           92 ELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEE  171 (773)
T ss_dssp             TSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHHHHHHHHHHHHHTTCCBTTT
T ss_pred             cCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHHHHHHHHHHHHHhCCchhhe
Confidence            5899999999999999999999999999999998888876543332  56899999999999999999999999999999


Q ss_pred             eeeeeeecccCCCCceEEEcCHHHHHHHHhcCCCCCCCcEEEEeCCCcCCCCHHHHHHHHHHHHhhhcCCcEEEEEeccc
Q 014006           81 VGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATL  160 (432)
Q Consensus        81 ~g~~~~~~~~~~~~~~i~v~T~~~l~~~l~~~~~l~~~~~vViDE~h~~~~~~~~~~~~l~~~~~~~~~~~~ii~~SAT~  160 (432)
                      +|+....+.......+|+++|||++.+.+..+..+.++++||+||+|+|+++.+.+..+++.+....+. .|+|+||||+
T Consensus       172 vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~~~~-~~iIl~SAT~  250 (773)
T 2xau_A          172 VGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPD-LKIIIMSATL  250 (773)
T ss_dssp             EEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHHCTT-CEEEEEESCS
T ss_pred             ecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHHHHHHhCCC-ceEEEEeccc
Confidence            998887777777889999999999999998888999999999999998899999988888888877654 8999999999


Q ss_pred             ChHHHHhhccCCCeeecCCCCCceeEEeCCCCCcchHHHHHHHHHHHHhcCCCCCEEEEeCCHHHHHHHHHHHHHHHhhc
Q 014006          161 DGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSL  240 (432)
Q Consensus       161 ~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lvF~~t~~~~~~~~~~L~~~~~~~  240 (432)
                      +.+.+++|+++.+++.+.++.+|++..|......++....+..+..++....++++||||+++++++.+++.|.+....+
T Consensus       251 ~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~~L~~~~~~l  330 (773)
T 2xau_A          251 DAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQL  330 (773)
T ss_dssp             CCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHHHHHHHHHHHHHSCSCEEEEECSCHHHHHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHHHHHHHHHHHHhcCCCCEEEECCCHHHHHHHHHHHHHHHHhh
Confidence            98999999999999999999999999998888888888888888887777778999999999999999999998643222


Q ss_pred             c-CCCCCCeEEEEecCCCCHHHHhccCCCCC-----CCccEEEEeecCcccccccCCeEEEEeCCcccceeecCCCCCcc
Q 014006          241 D-EGSCMDAVILPLHGSLPPEMQVRVFSPPP-----PNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQRQYNPSSGMYS  314 (432)
Q Consensus       241 ~-~~~~~~~~~~~~h~~l~~~~r~~~~~~f~-----~g~~~ilvaT~~~~~Gidi~~v~~VI~~~~~~~~~~~~~~~~~~  314 (432)
                      . .....++.+.++||+|++++|.++++.|+     +|.++|||||+++++|||+|+|++|||+|+++...||+..|+..
T Consensus       331 ~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~~~yd~~~g~~~  410 (773)
T 2xau_A          331 VREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVES  410 (773)
T ss_dssp             HHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEEEEEETTTTEEE
T ss_pred             cccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCccceeeccccCccc
Confidence            0 00125788999999999999999999999     99999999999999999999999999999999999999999999


Q ss_pred             ceEeeecHhhHHHhhcccCCCCCCeEEEecCccchhhcCCCCCCCccccCCchHHHHHHhhCCCCCCccccccCCCCCCH
Q 014006          315 LDVVQISKVQANQRVGRAGRTRPGKCYRLYPSTVYHDEFLDVTVPEIQRSSLAGSVLYLKSLDLSDINVLKFDFLDPPSS  394 (432)
Q Consensus       315 ~~~~~~s~~~~~qr~GRaGR~~~G~~~~l~~~~~~~~~~~~~~~~~i~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~p~~  394 (432)
                      +...|+|.++|+||+|||||.++|.||+||++.++...+.++..|||.+.+|...+|+++.+++.+  +..|+|++||+.
T Consensus       411 L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~~L~~~~L~l~~~gi~~--~~~f~~~~~p~~  488 (773)
T 2xau_A          411 LLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDD--LVHFDFMDPPAP  488 (773)
T ss_dssp             EEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCSSCCCGGGGSCCHHHHHHHHHTTCCC--GGGCCCSSCCCH
T ss_pred             cccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccccCCCccccCcHHHHHHHHHHcCCCC--hhhccccCCCcH
Confidence            999999999999999999999999999999999995559999999999999999999999999988  889999999999


Q ss_pred             HHHHHHHHHHHHccCCCCCCCCCHHHHHhhcCCCCC
Q 014006          395 ESLEDALKQLYLIDAIDENGSITSIGRTMAGTSFFA  430 (432)
Q Consensus       395 ~~l~~~~~~L~~~g~i~~~~~~t~lG~~~~~l~~~~  430 (432)
                      +.+.+|++.|.++|+||++|++|++|+.|+++|++|
T Consensus       489 ~~i~~a~~~L~~lgald~~~~lT~lG~~~a~~pl~p  524 (773)
T 2xau_A          489 ETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDP  524 (773)
T ss_dssp             HHHHHHHHHHHHTTSBCTTSCBCHHHHHHTTSSSCH
T ss_pred             HHHHHHHHHHHHcCCcccCCCcChhhhhhccccCCH
Confidence            999999999999999999999999999999999986



>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 432
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-51
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 1e-37
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-24
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 3e-13
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-04
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 6e-04
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]
 Score =  173 bits (438), Expect = 3e-51
 Identities = 48/341 (14%), Positives = 106/341 (31%), Gaps = 42/341 (12%)

Query: 15  ETVEQNPVVVVIGETGSGKSTQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQELG 74
           +   +  + ++    G+GK+ +    + R    +     +  P RV A  +   +     
Sbjct: 4   DIFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPI 63

Query: 75  VRLGEEVGYAIRFEDRTSERTLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTD 134
                            + R ++  +        +LS   +  Y++II+DEAH     + 
Sbjct: 64  RYQT------PAIRAEHTGREIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASI 117

Query: 135 ILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPTLNVPGKLYPVEILHSKERPT 194
              G +   V +   +   +  +AT  G +     SN P ++                  
Sbjct: 118 AARGYISTRVEMG--EAAGIFMTATPPGSRDPFPQSNAPIMDEE---------------- 159

Query: 195 SYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDEGSCMDAVILPLH 254
             +      +    V + +G  + F+        + + L                ++ L 
Sbjct: 160 REIPERSWNSGHEWVTDFKGKTVWFVPSIKAGNDIAACLRKN----------GKKVIQLS 209

Query: 255 GSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQR--QYNPSSGM 312
                   ++       N   F+V+T+I+E          VID     +     +    +
Sbjct: 210 RKTFDSEYIK----TRTNDWDFVVTTDISEMGANFK-AERVIDPRRCMKPVILTDGEERV 264

Query: 313 YSLDVVQISKVQANQRVGRAGRTRPGKCYR-LYPSTVYHDE 352
                + ++   A QR GR GR    +  + +Y      ++
Sbjct: 265 ILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGEPLEND 305


>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.92
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.92
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.92
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.92
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.92
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.92
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.92
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.92
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.92
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.91
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.91
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.91
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.91
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.9
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.9
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.9
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.89
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.88
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.86
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.86
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.85
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.85
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.81
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.81
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.79
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.79
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.78
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.77
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.76
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.76
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.75
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.68
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.65
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.63
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.62
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.53
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.52
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.03
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.98
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.92
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.59
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.57
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.24
d1okkd2207 GTPase domain of the signal recognition particle r 98.23
d2qy9a2211 GTPase domain of the signal recognition particle r 98.22
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.17
d1vmaa2213 GTPase domain of the signal recognition particle r 98.12
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.1
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.1
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.04
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.95
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.94
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.89
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.86
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.85
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.83
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.82
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.8
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.77
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.77
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.76
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.73
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.67
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.67
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.65
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.64
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.63
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.61
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.53
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.45
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.44
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.4
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.4
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.31
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.24
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.17
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.16
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.08
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.08
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.06
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.99
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 96.95
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.9
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.87
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.86
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.78
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.68
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.63
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.53
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.48
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.43
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.4
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.37
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 96.35
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.22
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.17
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 96.1
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.02
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.85
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.83
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.65
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.64
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.63
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.62
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.59
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.58
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.55
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.54
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.47
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.39
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.38
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.35
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.31
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.3
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.15
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.14
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.14
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.03
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.84
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 94.78
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.78
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.7
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.63
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.61
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 94.55
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.46
d2p6ra185 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 94.37
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.24
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.24
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.15
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.13
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.11
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.07
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.07
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.07
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.04
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.99
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.89
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.88
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.87
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.83
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.81
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.78
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.75
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.72
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.71
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.6
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.34
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.32
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.24
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.23
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 93.22
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.12
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.87
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.81
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.81
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.68
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.6
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.53
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.5
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 92.49
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.25
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.16
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 92.07
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 91.92
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 91.88
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.88
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.85
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.78
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.73
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 91.66
d1svma_362 Papillomavirus large T antigen helicase domain {Si 91.6
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.53
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 91.15
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 90.77
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.43
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 90.43
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.43
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.38
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 90.33
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 90.25
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 89.91
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.85
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 89.22
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.05
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 89.02
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.01
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 88.69
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.49
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 88.25
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 88.24
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.2
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 88.09
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.05
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 88.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.88
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 87.66
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 87.47
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 86.99
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 86.75
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 86.74
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 86.66
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 86.59
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 86.57
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.45
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 86.43
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 86.28
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 86.27
d1nrjb_209 Signal recognition particle receptor beta-subunit 86.26
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.21
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 86.05
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 85.98
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.96
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.76
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.6
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 85.53
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 85.38
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 85.25
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.18
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 85.14
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 85.13
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 85.09
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 84.76
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 84.72
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 84.55
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 84.4
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.31
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 84.24
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 84.09
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 83.84
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 83.76
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 83.74
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 83.63
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 83.61
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 83.52
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 83.48
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 83.21
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 83.13
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 82.79
d1xpua3289 Transcription termination factor Rho, ATPase domai 82.79
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 82.51
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 82.41
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 82.21
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 82.13
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 82.12
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 81.99
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 81.85
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 81.84
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 81.83
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 81.83
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 81.83
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 81.79
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 81.7
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 81.63
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 81.48
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 81.25
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 81.16
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 81.06
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 81.0
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 80.98
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 80.9
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 80.9
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 80.88
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 80.83
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 80.8
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 80.48
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 80.46
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 80.37
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 80.16
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 80.02
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]
Probab=100.00  E-value=3.4e-39  Score=299.11  Aligned_cols=294  Identities=17%  Similarity=0.179  Sum_probs=200.8

Q ss_pred             HHhcCCEEEEEcCCCCCHH-HHHHHHHhhcCCCCCcEEEecccchhhhHHHHHHHHHHhCCccCCeeeeeeeecccCCCC
Q 014006           16 TVEQNPVVVVIGETGSGKS-TQLSQILHRHGYTKSGIIGVTQPRRVAAVSVARRVAQELGVRLGEEVGYAIRFEDRTSER   94 (432)
Q Consensus        16 ~i~~~~~~ii~apTGsGKT-~~~~~~~~~~~~~~~~~vl~~~P~~~l~~q~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~   94 (432)
                      .+.+++++++.|||||||| .++++++.... ..+.++++++|+++|+.|+++++.+... ..   .+  ..........
T Consensus         5 ~~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~-~~~~~~lvi~Ptr~La~q~~~~l~~~~~-~~---~~--~~~~~~~~~~   77 (305)
T d2bmfa2           5 IFRKKRLTIMDLHPGAGKTKRYLPAIVREAI-KRGLRTLILAPTRVVAAEMEEALRGLPI-RY---QT--PAIRAEHTGR   77 (305)
T ss_dssp             SSSTTCEEEECCCTTSSTTTTHHHHHHHHHH-HHTCCEEEEESSHHHHHHHHHHTTTSCC-BC---CC----------CC
T ss_pred             HhhcCCcEEEEECCCCCHHHHHHHHHHHHHH-hcCCEEEEEccHHHHHHHHHHHHhcCCc-ce---ee--eEEeecccCc
Confidence            4678999999999999999 45555554332 2356899999999999999887643211 11   11  1112334466


Q ss_pred             ceEEEcCHHHHHHHHhcCCCCCCCcEEEEeCCCcCCCCHHHHHHHHHHHHhhhcCCcEEEEEecccChHHHHhhccCCCe
Q 014006           95 TLIKYLTDGVLLREILSNPDLSPYSVIILDEAHERSLNTDILLGLVKRLVNLRASKLKILITSATLDGEKVSKFFSNCPT  174 (432)
Q Consensus        95 ~~i~v~T~~~l~~~l~~~~~l~~~~~vViDE~h~~~~~~~~~~~~l~~~~~~~~~~~~ii~~SAT~~~~~~~~~~~~~~~  174 (432)
                      ..++++|++.+.........+.+++++|+||+|+...+......+++.+.. . .+.+++++|||++.......      
T Consensus        78 ~~i~~~t~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~~-~-~~~~~v~~SAT~~~~~~~~~------  149 (305)
T d2bmfa2          78 EIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVE-M-GEAAGIFMTATPPGSRDPFP------  149 (305)
T ss_dssp             CSEEEEEHHHHHHHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHHH-H-TSCEEEEECSSCTTCCCSSC------
T ss_pred             cccccCCcHHHHHHHhcCccccceeEEEeeeeeecchhhHHHHHHHHHhhc-c-ccceEEEeecCCCcceeeec------
Confidence            789999999998888777788999999999999432223234444444332 2 34899999999875321111      


Q ss_pred             eecCCCCCceeEEeCCCCCcchHHHHHHHHHHHHhcCCCCCEEEEeCCHHHHHHHHHHHHHHHhhccCCCCCCeEEEEec
Q 014006          175 LNVPGKLYPVEILHSKERPTSYLESALKTAIDIHVREPEGDVLIFMTGQDDIEKLVSKLEDKIRSLDEGSCMDAVILPLH  254 (432)
Q Consensus       175 i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lvF~~t~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~~h  254 (432)
                          ....++.............. ..     ......+++++|||+++++++.+++.|.+.          +..+..+|
T Consensus       150 ----~~~~~~~~~~~~~~~~~~~~-~~-----~~~~~~~~~~lvf~~~~~~~~~l~~~L~~~----------~~~~~~l~  209 (305)
T d2bmfa2         150 ----QSNAPIMDEEREIPERSWNS-GH-----EWVTDFKGKTVWFVPSIKAGNDIAACLRKN----------GKKVIQLS  209 (305)
T ss_dssp             ----CCSSCEEEEECCCCCSCCSS-CC-----HHHHSSCSCEEEECSCHHHHHHHHHHHHHH----------TCCCEECC
T ss_pred             ----ccCCcceEEEEeccHHHHHH-HH-----HHHHhhCCCEEEEeccHHHHHHHHHHHHhC----------CCCEEEeC
Confidence                11112211111111100000 00     011245689999999999999999999885          56688899


Q ss_pred             CCCCHHHHhccCCCCCCCccEEEEeecCcccccccCCeEEEEeCCcccce--eecCCCCCccceEeeecHhhHHHhhccc
Q 014006          255 GSLPPEMQVRVFSPPPPNCRRFIVSTNIAETSLTVDGVVYVIDCGYVKQR--QYNPSSGMYSLDVVQISKVQANQRVGRA  332 (432)
Q Consensus       255 ~~l~~~~r~~~~~~f~~g~~~ilvaT~~~~~Gidi~~v~~VI~~~~~~~~--~~~~~~~~~~~~~~~~s~~~~~qr~GRa  332 (432)
                      |++..+++..    |++|..+++|||+++++|+|++ ++.||++|.....  .||+.++...+...|+|.++|+||+||+
T Consensus       210 ~~~~~~~~~~----~~~~~~~~lvaT~~~~~G~~~~-~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~  284 (305)
T d2bmfa2         210 RKTFDSEYIK----TRTNDWDFVVTTDISEMGANFK-AERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRV  284 (305)
T ss_dssp             TTCHHHHGGG----GGTSCCSEEEECGGGGTTCCCC-CSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTS
T ss_pred             CcChHHHHhh----hhccchhhhhhhHHHHhcCCCC-ccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhhhhcCc
Confidence            9997776654    5788999999999999999995 8899999876543  4677777777778899999999999999


Q ss_pred             CCCCC-CeEEEecCccch
Q 014006          333 GRTRP-GKCYRLYPSTVY  349 (432)
Q Consensus       333 GR~~~-G~~~~l~~~~~~  349 (432)
                      ||.++ |....+|..+..
T Consensus       285 GR~~~~~~~~~~~~~~~~  302 (305)
T d2bmfa2         285 GRNPKNENDQYIYMGEPL  302 (305)
T ss_dssp             SCSSSCCCEEEEECSCCC
T ss_pred             CcCCCCceEEEEECCCCC
Confidence            99954 545566655544



>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure