Citrus Sinensis ID: 014327

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MDKDKSLSHGGIPPPSGRYSSFSPPGNNNFNVKPELPSSSSFPPLAPGGSSSDGSHFGHQSDSNRFSHDLSRMHDNPPKNVGHRRAHSEILTLPDDISFDSDLGVVGGADGPSLSDETEEDLLSMYLDMDKFNASTATSGFQVGEPSAAAAPAPTSAAAAGSGISSVENVGVGSTERPRIRHQHSQSMDGSTSIKPEMLMSASDEAPSADSKKAMSAAKLAELALIDPKRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTMEQQVHLQDALNDALKEEIQHLKVLTGQAMPNGGPMMNYPSFGAGQQFYPNNQAMHTLLTAQQFQQLQIHSQKQQQQFQQHQLHQMQQQQLQQQQQEQQQQTGEIKMRGSVPSPNQKENTSDVNPSISKD
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccHHHccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccc
mdkdkslshggipppsgryssfsppgnnnfnvkpelpssssfpplapggsssdgshfghqsdsnrfshdlsrmhdnppknvghrrahseiltlpddisfdsdlgvvggadgpslsdetEEDLLSMYLDmdkfnastatsgfqvgepsaaaapaptsaaaagsgissvenvgvgsterprirhqhsqsmdgstsikpemlmsasdeapsadsKKAMSAAKLAELALIDPKRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRdtngltaeNSELKLRLQTMEQQVHLQDALNDALKEEIQHLKVLtgqampnggpmmnypsfgagqqfypnnqAMHTLLTAQQFQQLQIHSQKQQQQFQQHQLHQMQQQQLQQQQQEQQQQTgeikmrgsvpspnqkentsdvnpsiskd
mdkdkslshggipppsgryssFSPPGNNNFNVKPELPSSSSFPPLAPGGSSSDGSHFGHQSDSNRFSHDLSRMHDNPPKNVGHRRAHSEILTLPDDISFDSDLGVVGGADGPSLSDETEEDLLSMYLDMDKFNASTATSGFQVGEPSAAAAPAPTSAAAAGSGISSVENVGVGSterprirhqhsqsmdgstsIKPEMLMSASDEAPSADSKKAMSAAKLAElalidpkrakriwanrqsaarskerkMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTMEQQVHLQDALNDALKEEIQHLKVLTGQAMPNGGPMMNYPSFGAGQQFYPNNQAMHTLLTAQQFQQLQIHSQKQQQQFQQHQLHQMQQQQLQQQQQEQQQQTGEIKmrgsvpspnqkentsdvnpsiskd
MDKDKSLSHGGIPPPSGRYssfsppgnnnfnVKpelpssssfpplapggsssdgshfghqsdsNRFSHDLSRMHDNPPKNVGHRRAHSEILTLPDDISFDSDLGVVGGADGPSLSDETEEDLLSMYLDMDKFNASTATSGFQVgepsaaaapaptsaaaagsgissVENVGVGSTERPRIRHQHSQSMDGSTSIKPEMLMSASDEapsadskkamsaaklaelalIDPKRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTMEQQVHLQDALNDALKEEIQHLKVLTGQAMPNGGPMMNYPSFGAGQQFYPNNQAMHtlltaqqfqqlqihsqkqqqqfqqhqlhqmqqqqlqqqqqeqqqqTGEIKMRGSVPSPNQKENTSDVNPSISKD
*****************************************************************************************************************************************************************************************************************************************************************************************************************ALNDALKEEIQHLKVLT***************FGAGQQFYPNNQAMHTLLT**********************************************************************
********************************************************************************************LPDD**********************************************************************************************************************************************************YIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTME*********NDALKEEIQH*************************************************************************************************************
***********IPPPSGRYSSFSPPGNNNFNVKPEL*************************DSNRFSHDLSRMHDNPPKNVGHRRAHSEILTLPDDISFDSDLGVVGGADGPSLSDETEEDLLSMYLDMDKFNASTATSGFQVG******************GISSVENVGVGSTER***************SIKPEMLM****************AAKLAELALIDPKRAKRIW***********RKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTMEQQVHLQDALNDALKEEIQHLKVLTGQAMPNGGPMMNYPSFGAGQQFYPNNQAMHTLLTAQQFQ*****************************************************************
**********************************************************************************************DDISFDS**************************************************************************************************************KKAMSAAKLAELALIDPKRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTMEQQVHLQDALNDALKEEIQHLKVLTGQAMPNGGP**********Q******QAMHTLLTAQQFQQLQIH************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKDKSLSHGGIPPPSGRYSSFSPPGNNNFNVKPELPSSSSFPPLAPGGSSSDGSHFGHQSDSNRFSHDLSRMHDNPPKNVGHRRAHSEILTLPDDISFDSDLGVVGGADGPSLSDETEEDLLSMYLDMDKFNASTATSGFQVGEPSAAAAPAPTSAAAAGSGISSVENVGVGSTERPRIRHQHSQSMDGSTSIKPEMLMSASDEAPSADSKKAMSAAKLAELALIDPKRAKRIWANRQSAARSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIQHLKVLTGQAMPNGGPMMNYPSFGAGQQFYPNNQAMHTLLTAQQFQQLQIHSQKQQQQFQQxxxxxxxxxxxxxxxxxxxxxxxxIKMRGSVPSPNQKENTSDVNPSISKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query426 2.2.26 [Sep-21-2011]
Q04088398 Probable transcription fa no no 0.781 0.836 0.670 1e-128
Q69IL4380 Transcription factor RF2a yes no 0.636 0.713 0.605 7e-82
Q6S4P4329 Transcription factor RF2b no no 0.575 0.744 0.447 1e-48
Q9MA75341 Transcription factor VIP1 no no 0.448 0.560 0.492 2e-41
>sp|Q04088|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1 Back     alignment and function desciption
 Score =  459 bits (1180), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 250/373 (67%), Positives = 278/373 (74%), Gaps = 40/373 (10%)

Query: 1   MDKDKSLS--HGGIPPPS--GRYSSFSPPGNNNFNVKPELPSSSSFPPLAPGGSSSDGSH 56
           MDK+KS +   GG+PPPS  GR S+FS  G                 P+           
Sbjct: 1   MDKEKSPAPPCGGLPPPSPSGRCSAFSEAG-----------------PI----------- 32

Query: 57  FGHQSDSNRFSHDLSRMHDNPPKNVGHRRAHSEILTLPDDISFDSDLGVVG-GADGPSLS 115
            GH SD+NR SHD+SRM DNPPK +GHRRAHSEILTLPDD+SFDSDLGVVG  ADG S S
Sbjct: 33  -GHGSDANRMSHDISRMLDNPPKKIGHRRAHSEILTLPDDLSFDSDLGVVGNAADGASFS 91

Query: 116 DETEEDLLSMYLDMDKFNASTATSGFQVGEPSAAAAPAPTSAAAAGSGISSVENVGVGST 175
           DETEEDLLSMYLDMDKFN S+ATS  QVGEPS  A    T         S+ +N      
Sbjct: 92  DETEEDLLSMYLDMDKFN-SSATSSAQVGEPSGTAWKNETMMQTGTGSTSNPQNTVNSLG 150

Query: 176 ERPRIRHQHSQSMDGSTSIKPEMLMSASDEAPSADSKKAMSAAKLAELALIDPKRAKRIW 235
           ERPRIRHQHSQSMDGS +I  EMLMS +++  + D+KK+MSA KLAELALIDPKRAKRIW
Sbjct: 151 ERPRIRHQHSQSMDGSMNIN-EMLMSGNEDDSAIDAKKSMSATKLAELALIDPKRAKRIW 209

Query: 236 ANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQ 295
           ANRQSAARSKERK RYI ELERKVQTLQTEAT+LSAQLTLLQRDTNGLT EN+ELKLRLQ
Sbjct: 210 ANRQSAARSKERKTRYIFELERKVQTLQTEATTLSAQLTLLQRDTNGLTVENNELKLRLQ 269

Query: 296 TMEQQVHLQDALNDALKEEIQHLKVLTGQAMPNGGPMMNYPSFGAG-QQFYPNNQAMHTL 354
           TMEQQVHLQD LN+ALKEEIQHLKVLTGQ  P+    +NY SFG+  QQFY NNQ+M T+
Sbjct: 270 TMEQQVHLQDELNEALKEEIQHLKVLTGQVAPSA---LNYGSFGSNQQQFYSNNQSMQTI 326

Query: 355 LTAQQFQQLQIHS 367
           L A+QFQQLQIHS
Sbjct: 327 LAAKQFQQLQIHS 339
Putative transcription factor with an activatory role.
Arabidopsis thaliana (taxid: 3702)
>sp|Q69IL4|RF2A_ORYSJ Transcription factor RF2a OS=Oryza sativa subsp. japonica GN=RF2a PE=1 SV=1 Back     alignment and function description
>sp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b OS=Oryza sativa subsp. japonica GN=RF2b PE=1 SV=1 Back     alignment and function description
>sp|Q9MA75|VIP1_ARATH Transcription factor VIP1 OS=Arabidopsis thaliana GN=VIP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
255577193425 Transcription factor RF2a, putative [Ric 0.971 0.974 0.788 1e-165
225433978425 PREDICTED: probable transcription factor 0.974 0.976 0.756 1e-161
449459834416 PREDICTED: probable transcription factor 0.957 0.980 0.721 1e-154
356550384428 PREDICTED: probable transcription factor 0.978 0.974 0.733 1e-152
356557140420 PREDICTED: probable transcription factor 0.967 0.980 0.752 1e-149
357454497429 BZIP transcription factor [Medicago trun 0.967 0.960 0.735 1e-146
297743837354 unnamed protein product [Vitis vinifera] 0.812 0.977 0.784 1e-144
449459848412 PREDICTED: probable transcription factor 0.941 0.973 0.710 1e-144
224133218363 predicted protein [Populus trichocarpa] 0.835 0.980 0.771 1e-143
224093075408 predicted protein [Populus trichocarpa] 0.950 0.992 0.729 1e-135
>gi|255577193|ref|XP_002529479.1| Transcription factor RF2a, putative [Ricinus communis] gi|223531037|gb|EEF32889.1| Transcription factor RF2a, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  588 bits (1517), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 335/425 (78%), Positives = 367/425 (86%), Gaps = 11/425 (2%)

Query: 1   MDKDKSLSHGGIPPPSGRYSSFSPPGNNNFNVKPELPSSSSFPPLAPGGSSSDGSHFGHQ 60
           MDKDK  S GG+PPPSGR+SSFSP G++ FNVKPE  S+++ PP+APG SSSD SHFGH 
Sbjct: 1   MDKDKGHS-GGLPPPSGRFSSFSPTGSS-FNVKPEPSSAAALPPIAPG-SSSDPSHFGHG 57

Query: 61  SDSNRFSHDLSRMHDNPPKNVGHRRAHSEILTLPDDISFDSDLGVVGGADGPSLSDETEE 120
           SDS+RFSHD+SRM DNPPK +GHRRAHSEILTLPDDISFDSDLGVVGGADGPS SDETEE
Sbjct: 58  SDSSRFSHDISRMPDNPPKKLGHRRAHSEILTLPDDISFDSDLGVVGGADGPSFSDETEE 117

Query: 121 DLLSMYLDMDKFNASTATSGFQVGEPSAAAAPAPTSAAAAGSGISSVENVGVGSTERPRI 180
           DL SMYLDMDKFN+S+ATS FQ+GE S    P P + A+A +   +  +VG G +ERPRI
Sbjct: 118 DLFSMYLDMDKFNSSSATSAFQLGESSI---PTPAALASASAQAPATVDVGAGPSERPRI 174

Query: 181 RHQHSQSMDGSTSIKPEMLMSASDEAPSADSKKAMSAAKLAELALIDPKRAKRIWANRQS 240
           RHQHSQSMDGST+IKPEML+S ++E   AD+KKAMSAAKLAELALIDPKRAKRIWANRQS
Sbjct: 175 RHQHSQSMDGSTTIKPEMLISGAEEVSPADTKKAMSAAKLAELALIDPKRAKRIWANRQS 234

Query: 241 AARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTMEQQ 300
           AARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTMEQQ
Sbjct: 235 AARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTMEQQ 294

Query: 301 VHLQDALNDALKEEIQHLKVLTGQAMPNGGPMMNYPSFGAGQQFYPNNQAMHTLLTAQQF 360
           VHLQDALNDALKEEIQHLKVLTGQAM NGGPMMNY SFG GQQFYPNN AMHTLLT QQF
Sbjct: 295 VHLQDALNDALKEEIQHLKVLTGQAMANGGPMMNYNSFGTGQQFYPNNHAMHTLLTTQQF 354

Query: 361 QQLQIHS-----QKQQQQFQQHQLHQMQQQQLQQQQQEQQQQTGEIKMRGSVPSPNQKEN 415
           QQLQIHS     Q QQ Q  Q Q  Q  QQQ Q QQQEQQQQ+G++KMRG++ SPNQK+N
Sbjct: 355 QQLQIHSQKQQHQFQQHQLHQLQQQQQLQQQQQHQQQEQQQQSGDLKMRGTMSSPNQKDN 414

Query: 416 TSDVN 420
           +SDVN
Sbjct: 415 SSDVN 419

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225433978|ref|XP_002270784.1| PREDICTED: probable transcription factor PosF21 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449459834|ref|XP_004147651.1| PREDICTED: probable transcription factor PosF21-like [Cucumis sativus] gi|449498815|ref|XP_004160642.1| PREDICTED: probable transcription factor PosF21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356550384|ref|XP_003543567.1| PREDICTED: probable transcription factor PosF21 [Glycine max] Back     alignment and taxonomy information
>gi|356557140|ref|XP_003546876.1| PREDICTED: probable transcription factor PosF21-like [Glycine max] Back     alignment and taxonomy information
>gi|357454497|ref|XP_003597529.1| BZIP transcription factor [Medicago truncatula] gi|355486577|gb|AES67780.1| BZIP transcription factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|297743837|emb|CBI36720.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449459848|ref|XP_004147658.1| PREDICTED: probable transcription factor PosF21-like [Cucumis sativus] gi|449498835|ref|XP_004160648.1| PREDICTED: probable transcription factor PosF21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224133218|ref|XP_002327989.1| predicted protein [Populus trichocarpa] gi|222837398|gb|EEE75777.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224093075|ref|XP_002309791.1| predicted protein [Populus trichocarpa] gi|222852694|gb|EEE90241.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
TAIR|locus:2198856423 AT1G06070 "AT1G06070" [Arabido 0.659 0.664 0.702 8.3e-104
TAIR|locus:2061340398 AT2G31370 [Arabidopsis thalian 0.664 0.711 0.675 4.2e-96
TAIR|locus:2061908367 AT2G40620 "AT2G40620" [Arabido 0.342 0.397 0.565 6.7e-43
TAIR|locus:2033123337 bZIP52 "AT1G06850" [Arabidopsi 0.330 0.418 0.566 1.9e-39
TAIR|locus:2031123341 VIP1 "VIRE2-interacting protei 0.406 0.507 0.471 1.3e-34
TAIR|locus:2141826553 AT4G38900 "AT4G38900" [Arabido 0.267 0.206 0.641 3.5e-33
TAIR|locus:2047082525 AT2G21230 "AT2G21230" [Arabido 0.234 0.190 0.666 1.6e-30
TAIR|locus:2053761321 BZIP34 "AT2G42380" [Arabidopsi 0.272 0.361 0.435 5.8e-18
TAIR|locus:2057030264 AT2G12900 "AT2G12900" [Arabido 0.225 0.363 0.385 6e-16
TAIR|locus:2085425329 BZIP61 [Arabidopsis thaliana ( 0.218 0.282 0.483 8.5e-16
TAIR|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 998 (356.4 bits), Expect = 8.3e-104, Sum P(2) = 8.3e-104
 Identities = 203/289 (70%), Positives = 225/289 (77%)

Query:    64 NRFSHDLSRMHDNPPKNVGHRRAHSEILTLPDDISFDSDLGVVGGADGPSLSDETEEDLL 123
             NRFSHD+SRM DNPPKN+GHRRAHSEILTLPDD+SFDSDLGVVG ADGPS SD+T+EDLL
Sbjct:    54 NRFSHDISRMPDNPPKNLGHRRAHSEILTLPDDLSFDSDLGVVGAADGPSFSDDTDEDLL 113

Query:   124 SMYLDMDKFNASTATSGFQVXXXXXXXXXXXXXXXXXXXXXXXVENVGVGSTERPRIRHQ 183
              MYLDM+KFN+S ATS  Q+                       +++    S+ERPRIRHQ
Sbjct:   114 YMYLDMEKFNSS-ATSTSQMGEPSEPTWRNELASTSN------LQSTPGSSSERPRIRHQ 166

Query:   184 HSQSMDGSTSIKPEMLMSASDEXXXXXXXXXXXXXXXXXXXXIDPKRAKRIWANRQSAAR 243
             HSQSMDGST+IKPEMLMS +++                    IDPKRAKRIWANRQSAAR
Sbjct:   167 HSQSMDGSTTIKPEMLMSGNEDVSGVDSKKAISAAKLSELALIDPKRAKRIWANRQSAAR 226

Query:   244 SKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAENSELKLRLQTMEQQVHL 303
             SKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGL  EN+ELKLR+QTMEQQVHL
Sbjct:   227 SKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLGVENNELKLRVQTMEQQVHL 286

Query:   304 QDALNDALKEEIQHLKVLTGQAMPNGGPMMNYPSFGAGQQFYPNNQAMH 352
             QDALNDALKEE+QHLKVLTGQ  P+ G  MNY SFG+ QQFYPNNQ+MH
Sbjct:   287 QDALNDALKEEVQHLKVLTGQG-PSNGTSMNYGSFGSNQQFYPNNQSMH 334
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2061340 AT2G31370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141826 AT4G38900 "AT4G38900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047082 AT2G21230 "AT2G21230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053761 BZIP34 "AT2G42380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057030 AT2G12900 "AT2G12900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085425 BZIP61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q69IL4RF2A_ORYSJNo assigned EC number0.60540.63610.7131yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
smart0033865 smart00338, BRLZ, basic region leucin zipper 3e-15
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 4e-07
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 2e-05
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 1e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-04
TIGR03789239 TIGR03789, pdsO, proteobacterial sortase system Om 8e-04
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 8e-04
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
pfam08614194 pfam08614, ATG16, Autophagy protein 16 (ATG16) 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 69.5 bits (171), Expect = 3e-15
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 227 DPKRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAE 286
           D KR +R   NR++A RS+ERK   I ELERKV+ L+ E   L  ++  L+R+   L +E
Sbjct: 3   DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62

Query: 287 NSE 289
             E
Sbjct: 63  LEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|234354 TIGR03789, pdsO, proteobacterial sortase system OmpA family protein Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|219934 pfam08614, ATG16, Autophagy protein 16 (ATG16) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 426
smart0033865 BRLZ basic region leucin zipper. 99.31
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.22
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 98.95
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 98.93
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 98.92
KOG3584348 consensus cAMP response element binding protein an 98.84
KOG0709472 consensus CREB/ATF family transcription factor [Tr 98.74
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.1
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 98.06
KOG0837279 consensus Transcriptional activator of the JUN fam 97.97
KOG4571294 consensus Activating transcription factor 4 [Trans 96.92
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.67
KOG3119269 consensus Basic region leucine zipper transcriptio 96.43
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 95.52
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 95.08
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 94.34
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 94.17
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.98
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.9
PRK10884206 SH3 domain-containing protein; Provisional 93.84
PRK13169110 DNA replication intiation control protein YabA; Re 93.68
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.47
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 93.36
PRK11637 428 AmiB activator; Provisional 93.21
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 93.21
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 92.54
PRK0029568 hypothetical protein; Provisional 92.34
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 92.31
PRK0073668 hypothetical protein; Provisional 92.26
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.17
PRK0432574 hypothetical protein; Provisional 92.06
PRK0279372 phi X174 lysis protein; Provisional 91.81
COG307479 Uncharacterized protein conserved in bacteria [Fun 91.66
PRK0211973 hypothetical protein; Provisional 91.49
TIGR0244965 conserved hypothetical protein TIGR02449. Members 91.45
PF14662193 CCDC155: Coiled-coil region of CCDC155 91.32
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 91.14
PRK0440675 hypothetical protein; Provisional 91.13
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 90.66
PF1374789 DUF4164: Domain of unknown function (DUF4164) 90.57
PRK1542279 septal ring assembly protein ZapB; Provisional 90.44
TIGR0244965 conserved hypothetical protein TIGR02449. Members 90.39
PRK11637428 AmiB activator; Provisional 90.29
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 90.29
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 90.2
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 90.18
PRK0084677 hypothetical protein; Provisional 90.1
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 90.03
COG307479 Uncharacterized protein conserved in bacteria [Fun 89.76
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 89.4
PF10186302 Atg14: UV radiation resistance protein and autopha 89.3
PRK09039343 hypothetical protein; Validated 89.28
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 89.13
PRK1542279 septal ring assembly protein ZapB; Provisional 89.03
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 88.94
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 88.77
PF14662193 CCDC155: Coiled-coil region of CCDC155 88.31
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 88.15
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 87.92
COG4467114 Regulator of replication initiation timing [Replic 87.91
COG2433652 Uncharacterized conserved protein [Function unknow 87.67
COG4942 420 Membrane-bound metallopeptidase [Cell division and 87.16
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 87.13
PRK10884206 SH3 domain-containing protein; Provisional 87.13
PF10226195 DUF2216: Uncharacterized conserved proteins (DUF22 86.77
PRK13169110 DNA replication intiation control protein YabA; Re 86.51
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 86.41
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 86.34
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 86.31
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 86.08
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 85.95
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 85.93
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 85.62
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 85.51
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 85.5
PRK09039343 hypothetical protein; Validated 84.8
KOG3227231 consensus Calcium-responsive transcription coactiv 84.64
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 84.57
KOG4807593 consensus F-actin binding protein, regulates actin 84.05
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 84.05
PRK04863 1486 mukB cell division protein MukB; Provisional 83.83
COG2433652 Uncharacterized conserved protein [Function unknow 83.71
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 83.63
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 83.29
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 83.14
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 82.71
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 82.58
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 82.56
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 82.54
PF00038312 Filament: Intermediate filament protein; InterPro: 82.48
COG4026290 Uncharacterized protein containing TOPRIM domain, 82.17
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 82.05
PF15030277 DUF4527: Protein of unknown function (DUF4527) 81.98
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 81.97
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 81.87
KOG0933 1174 consensus Structural maintenance of chromosome pro 81.8
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 81.78
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 81.63
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 81.56
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 81.38
PF13851201 GAS: Growth-arrest specific micro-tubule binding 81.36
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 81.01
COG4467114 Regulator of replication initiation timing [Replic 80.4
PF13851201 GAS: Growth-arrest specific micro-tubule binding 80.24
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.31  E-value=1.4e-11  Score=96.71  Aligned_cols=62  Identities=42%  Similarity=0.533  Sum_probs=56.3

Q ss_pred             cChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhHHHHH
Q 014327          226 IDPKRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAEN  287 (426)
Q Consensus       226 ~DpKR~KRil~NReSA~RSReRKkqyieeLE~kVq~Lq~ENs~Ls~ql~~Lqrq~~~L~sEN  287 (426)
                      .|+|+.+|+++||+||++||+||+.|+.+||.+|..|+.+|..|..++..|..++..|..++
T Consensus         2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            47899999999999999999999999999999999999999999999998877766666554

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG3227 consensus Calcium-responsive transcription coactivator [Transcription] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF15030 DUF4527: Protein of unknown function (DUF4527) Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 4e-11
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 2e-10
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 1e-09
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 1e-07
2wt7_B90 Transcription factor MAFB; transcription, transcri 3e-07
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 5e-07
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 9e-07
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 5e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 3e-05
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 2e-04
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 2e-04
1yvl_A 683 Signal transducer and activator of transcription 1 9e-04
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 57.0 bits (138), Expect = 4e-11
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 229 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQ 277
           KR  R+  NR++A  S+ +K  Y+  LE +V  L+ +  +L  +L  L+
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALK 49
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.38
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.17
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.17
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.06
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 98.91
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.91
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.75
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.3
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.26
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.13
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.05
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 97.15
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 96.81
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 96.14
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 96.14
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.8
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 94.51
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 92.6
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 92.32
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 92.14
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 90.97
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 90.93
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 90.59
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.29
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 89.68
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 89.56
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 89.41
1deb_A54 APC protein, adenomatous polyposis coli protein; c 89.37
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 89.27
3cve_A72 Homer protein homolog 1; coiled coil, alternative 88.98
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 88.26
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 88.03
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 87.96
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 87.07
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 86.79
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 86.57
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 86.45
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 85.82
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 84.63
2ve7_C250 Kinetochore protein NUF2, kinetochore protein SPC; 83.25
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 82.63
3m48_A33 General control protein GCN4; leucine zipper, synt 82.63
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 81.81
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 81.81
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 81.67
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 81.51
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 81.26
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 81.06
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 80.58
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 80.31
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.38  E-value=6.4e-13  Score=101.03  Aligned_cols=52  Identities=31%  Similarity=0.487  Sum_probs=48.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Q 014327          229 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDT  280 (426)
Q Consensus       229 KR~KRil~NReSA~RSReRKkqyieeLE~kVq~Lq~ENs~Ls~ql~~Lqrq~  280 (426)
                      ||.+|+++||+||++||+||+.|+.+||.+|..|+.||..|..++..|+..+
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6899999999999999999999999999999999999999999998887654
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 95.94
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=95.94  E-value=0.00077  Score=51.81  Aligned_cols=48  Identities=13%  Similarity=0.171  Sum_probs=38.8

Q ss_pred             CchhHhhhccHHHHhhhhhcChHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 014327          207 PSADSKKAMSAAKLAELALIDPKRAKRIWANRQSAARSKERKMRYIAE  254 (426)
Q Consensus       207 ~~~~~kk~~~~~~l~ela~~DpKR~KRil~NReSA~RSReRKkqyiee  254 (426)
                      +-++++..++...|.|..++-.+.+||.-+||.+|+++|.||...+.+
T Consensus        26 pv~eFne~l~~~~Lte~Ql~lirDIRRRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          26 SLSELQQVLKNESLSEYQRQLIRKIRRRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             CHHHHHHHHHHSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             CHHHHHHHHHhCCCCHHHHHHHHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence            456667777777777776666899999999999999999999986654