Citrus Sinensis ID: 014507


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MAPCDCNMLPRSYSAYQVFDEITAPKPGLRLSWRNLSLHRKPAKWSRSLRSGPALEAIKAEDMGKTQVKDDTSMFTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIICVSPETGNLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREYGLRETYSKIPGSRSIAL
cccccccccccccHHHHHHHHHccccccccccccHHHHHcccHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccEEEEc
cccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHcccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEEEEc
mapcdcnmlprsysayqvfdeitapkpglrlswrnlslhrkpakwsrslrsgpaleaikaedmgktqvkddtsmftwiqigpnitEEQKQAISQFPRKMTKRCKAFVKQIICvspetgnlSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGepldkrsygSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYsmngnsegAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNmrkaglepsDKCVALILSACEKENQLNRALEFLIDLErdgfmvgkeASCTLAAWFKRLGVVEEVEHVLREYglretyskipgsrsial
MAPCDCNMLPRSYSAYQVFDEITAPKPGLRLSWRNLSlhrkpakwsrslrsgpaleaikaedmgktqvkddTSMFTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIIcvspetgnLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLgepldkrsygSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVlreyglretyskipgsrsial
MAPCDCNMLPRSYSAYQVFDEITAPKPGLRLSWRNLSLHRKPAKWSRSLRSGPALEAIKAEDMGKTQVKDDTSMFTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIICVSPETGNLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVaelalleesfeaNIRDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREYGLRETYSKIPGSRSIAL
*****CNMLPRSYSAYQVFDEITAPKPGLRLSWRNLSLH********************************TSMFTWIQIGPNITEE**QAISQFPRKMTKRCKAFVKQIICVSPETGNLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREYGLRETY***********
*APCDCNMLPRSYSAYQVFDEITAPKPGLRLSWRNLSLHRKPAKWSRSLRSGPALEAIKAEDMGKTQVKDDTSMFTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIICVSPETGNLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREYGLRETYSKIPGSRSIAL
MAPCDCNMLPRSYSAYQVFDEITAPKPGLRLSWRNLSLHRKPAKWSRSLRSGPALEAIKAEDMGKTQVKDDTSMFTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIICVSPETGNLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREYGLRETYSKI********
*APCDCNMLPRSYSAYQVFDEITAPKPGLRLSWRNLSLHRKPAKWSRSLRSGPALEAIKAEDMGKTQVKDDTSMFTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIICVSPETGNLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREYGLRETYSKIPGSRSIAL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPCDCNMLPRSYSAYQVFDEITAPKPGLRLSWRNLSLHRKPAKWSRSLRSGPALEAIKAEDMGKTQVKDDTSMFTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIICVSPETGNLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREYGLRETYSKIPGSRSIAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query423 2.2.26 [Sep-21-2011]
Q9LPC4409 Pentatricopeptide repeat- yes no 0.813 0.841 0.631 1e-130
Q940Z1316 Pentatricopeptide repeat- no no 0.491 0.658 0.401 2e-37
Q0WMY5 952 Pentatricopeptide repeat- no no 0.588 0.261 0.245 3e-19
Q9FLD8678 Pentatricopeptide repeat- no no 0.600 0.374 0.238 3e-17
O64624 822 Pentatricopeptide repeat- no no 0.453 0.233 0.261 7e-15
Q9SF38 778 Pentatricopeptide repeat- no no 0.423 0.230 0.291 3e-14
O04504606 Pentatricopeptide repeat- no no 0.576 0.402 0.252 3e-14
Q9FIX3 747 Pentatricopeptide repeat- no no 0.475 0.269 0.247 3e-14
Q9LYT2 583 Pentatricopeptide repeat- no no 0.475 0.344 0.265 9e-14
Q9LR67 660 Pentatricopeptide repeat- no no 0.567 0.363 0.226 9e-14
>sp|Q9LPC4|PPR1_ARATH Pentatricopeptide repeat-containing protein At1g01970 OS=Arabidopsis thaliana GN=At1g01970 PE=2 SV=1 Back     alignment and function desciption
 Score =  465 bits (1196), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 219/347 (63%), Positives = 281/347 (80%), Gaps = 3/347 (0%)

Query: 63  MGKTQVKDD---TSMFTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIICVSPETGN 119
           +G+   K+D   +  F W  +G N+TEEQ +AI++ P KM+KRC+A ++QIIC SPE G+
Sbjct: 55  IGEVVEKEDAEQSRSFNWADVGLNLTEEQDEAITRIPIKMSKRCQALMRQIICFSPEKGS 114

Query: 120 LSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHG 179
             DLL AW+R M P RADWL++LK+LK ++ P Y++VAE +LL++SFEAN RDYTKIIH 
Sbjct: 115 FCDLLGAWLRRMNPIRADWLSILKELKNLDSPFYIKVAEFSLLQDSFEANARDYTKIIHY 174

Query: 180 YGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLD 239
           YGK  Q+++AE TLL+MK RGF+ DQVTLT MV +YSKAG  K+AEETF EIKLLGEPLD
Sbjct: 175 YGKLNQVEDAERTLLSMKNRGFLIDQVTLTAMVQLYSKAGCHKLAEETFNEIKLLGEPLD 234

Query: 240 KRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFE 299
            RSYGSM+MAY+RAG+ ++GE LLREMD+QE+  G EVYKALLR YSM G++EGA+RVF+
Sbjct: 235 YRSYGSMIMAYIRAGVPEKGESLLREMDSQEICAGREVYKALLRDYSMGGDAEGAKRVFD 294

Query: 300 AIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKEN 359
           A+Q AGITPD ++C LLINAY ++GQSQ A  AF+NMRKAG++ +DKCVAL+L+A EKE 
Sbjct: 295 AVQIAGITPDVKLCGLLINAYSVSGQSQNARLAFENMRKAGIKATDKCVALVLAAYEKEE 354

Query: 360 QLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREY 406
           +LN AL FL++LE+D  M+GKEAS  LA WFK+LGVVEEVE +LRE+
Sbjct: 355 KLNEALGFLVELEKDSIMLGKEASAVLAQWFKKLGVVEEVELLLREF 401





Arabidopsis thaliana (taxid: 3702)
>sp|Q940Z1|PPR51_ARATH Pentatricopeptide repeat-containing protein At1g19525 OS=Arabidopsis thaliana GN=At1g19525 PE=2 SV=2 Back     alignment and function description
>sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLD8|PP408_ARATH Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 Back     alignment and function description
>sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940 OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 Back     alignment and function description
>sp|Q9SF38|PP222_ARATH Pentatricopeptide repeat-containing protein At3g09650, chloroplastic OS=Arabidopsis thaliana GN=HCF152 PE=2 SV=1 Back     alignment and function description
>sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYT2|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 Back     alignment and function description
>sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
224130012407 predicted protein [Populus trichocarpa] 0.952 0.990 0.608 1e-140
225453925352 PREDICTED: pentatricopeptide repeat-cont 0.813 0.977 0.718 1e-139
296089159353 unnamed protein product [Vitis vinifera] 0.796 0.954 0.729 1e-139
388518405414 unknown [Lotus japonicus] 0.952 0.973 0.613 1e-138
449433119404 PREDICTED: pentatricopeptide repeat-cont 0.829 0.868 0.663 1e-138
357506869426 Pentatricopeptide repeat-containing prot 0.799 0.793 0.674 1e-132
356530135356 PREDICTED: pentatricopeptide repeat-cont 0.829 0.985 0.642 1e-131
356568284414 PREDICTED: pentatricopeptide repeat-cont 0.796 0.814 0.661 1e-130
15217583409 pentatricopeptide repeat-containing prot 0.813 0.841 0.631 1e-128
297848306409 pentatricopeptide repeat-containing prot 0.813 0.841 0.628 1e-128
>gi|224130012|ref|XP_002320730.1| predicted protein [Populus trichocarpa] gi|222861503|gb|EEE99045.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 249/409 (60%), Positives = 313/409 (76%), Gaps = 6/409 (1%)

Query: 1   MAPCDCNMLPRSYSAYQVFDEITAPKPGLRLSWRNLSLHRKPAKWSRSLRSG--PALEAI 58
           MA    N+LP S     +  E   PK    L +   SL ++P   + S +S   P L AI
Sbjct: 1   MATYVINILPFSSPTCPLHSE---PKKTSNLHFLGNSLCQQPVTLT-SCKSQIQPVLAAI 56

Query: 59  KAEDMGKTQVKDDTSMFTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIICVSPETG 118
             E+  + ++  +   F W++IGPNI EEQKQAISQ P KMTKRCKA ++QIIC + + G
Sbjct: 57  NVEEKVEGEIGKEKPKFRWVEIGPNIPEEQKQAISQLPFKMTKRCKALMRQIICFNDKKG 116

Query: 119 NLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIH 178
           +L  LL+AWV+ MKPRR DWL++LK+L  MEHPLYL+V E+ALLEESFEAN+RDYTKIIH
Sbjct: 117 SLRGLLSAWVKIMKPRRKDWLSILKELNKMEHPLYLEVVEIALLEESFEANVRDYTKIIH 176

Query: 179 GYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPL 238
            YG   Q++ AE T LAM+ RGF+ DQVTLT M+ MYSK GNL +AEETFEE+KLLG+PL
Sbjct: 177 FYGMNNQLEEAERTRLAMEERGFVSDQVTLTAMIHMYSKGGNLTLAEETFEELKLLGQPL 236

Query: 239 DKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVF 298
           D+RSYGSM+MAY+RAGM ++GE++LREMDAQE+  GSEVYKALLR YS+ G+++GAQRVF
Sbjct: 237 DRRSYGSMIMAYIRAGMPEKGEMILREMDAQEIRAGSEVYKALLRAYSIIGDADGAQRVF 296

Query: 299 EAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKE 358
           +AIQ AGI PD R CA+L+NAY MAGQSQ AY  F+NM +AG+EP+D+CVAL+L+A EKE
Sbjct: 297 DAIQLAGIPPDDRTCAVLLNAYGMAGQSQNAYATFENMWRAGIEPTDRCVALVLAAYEKE 356

Query: 359 NQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREYG 407
           N+LN+AL+FLI LER+  ++GKEAS  LA WF RLGVV+EVE VLREY 
Sbjct: 357 NKLNQALDFLIGLEREKLIIGKEASEVLAEWFGRLGVVKEVELVLREYA 405




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225453925|ref|XP_002273719.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089159|emb|CBI38862.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388518405|gb|AFK47264.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449433119|ref|XP_004134345.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Cucumis sativus] gi|449480346|ref|XP_004155867.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357506869|ref|XP_003623723.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498738|gb|AES79941.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356530135|ref|XP_003533639.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Glycine max] Back     alignment and taxonomy information
>gi|356568284|ref|XP_003552343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Glycine max] Back     alignment and taxonomy information
>gi|15217583|ref|NP_171699.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75264110|sp|Q9LPC4.1|PPR1_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g01970 gi|8570448|gb|AAF76475.1|AC020622_9 Contains similarity to an unknown protein gi|AAD26479 from Arabidopsis thaliana BAC gb|AC007169 and contains multiple PPR PF|01535 repeats [Arabidopsis thaliana] gi|34098825|gb|AAQ56795.1| At1g01970 [Arabidopsis thaliana] gi|110735700|dbj|BAE99830.1| hypothetical protein [Arabidopsis thaliana] gi|332189240|gb|AEE27361.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297848306|ref|XP_002892034.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297337876|gb|EFH68293.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
TAIR|locus:2025442409 AT1G01970 "AT1G01970" [Arabido 0.813 0.841 0.608 1.8e-112
TAIR|locus:2016402316 NFD5 "NUCLEAR FUSION DEFECTIVE 0.491 0.658 0.401 2.4e-37
TAIR|locus:2175443 952 AT5G04810 [Arabidopsis thalian 0.737 0.327 0.216 2.6e-17
TAIR|locus:2024301606 AT1G09820 "AT1G09820" [Arabido 0.557 0.389 0.256 3e-14
TAIR|locus:2044430 822 AT2G18940 [Arabidopsis thalian 0.550 0.283 0.256 3e-14
TAIR|locus:2077637871 AT3G06920 "AT3G06920" [Arabido 0.536 0.260 0.222 4.2e-13
TAIR|locus:2077735 590 AT3G59040 "AT3G59040" [Arabido 0.475 0.340 0.265 6.3e-13
TAIR|locus:2151281 819 AT5G02860 [Arabidopsis thalian 0.513 0.264 0.278 3e-12
TAIR|locus:2174008 974 AT5G61990 "AT5G61990" [Arabido 0.541 0.235 0.243 3.9e-12
TAIR|locus:2164910 747 EMB2745 "EMBRYO DEFECTIVE 2745 0.489 0.277 0.241 5.6e-12
TAIR|locus:2025442 AT1G01970 "AT1G01970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1110 (395.8 bits), Expect = 1.8e-112, P = 1.8e-112
 Identities = 211/347 (60%), Positives = 269/347 (77%)

Query:    63 MGKTQVKDDTSM---FTWIQIGPNITEEQKQAISQFPRKMTKRCKAFVKQIICVSPETGN 119
             +G+   K+D      F W  +G N+TEEQ +AI++ P KM+KRC+A ++QIIC SPE G+
Sbjct:    55 IGEVVEKEDAEQSRSFNWADVGLNLTEEQDEAITRIPIKMSKRCQALMRQIICFSPEKGS 114

Query:   120 LSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVXXXXXXXXXXXXNIRDYTKIIHG 179
               DLL AW+R M P RADWL++LK+LK ++ P Y++V            N RDYTKIIH 
Sbjct:   115 FCDLLGAWLRRMNPIRADWLSILKELKNLDSPFYIKVAEFSLLQDSFEANARDYTKIIHY 174

Query:   180 YGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLD 239
             YGK  Q+++AE TLL+MK RGF+ DQVTLT MV +YSKAG  K+AEETF EIKLLGEPLD
Sbjct:   175 YGKLNQVEDAERTLLSMKNRGFLIDQVTLTAMVQLYSKAGCHKLAEETFNEIKLLGEPLD 234

Query:   240 KRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFE 299
              RSYGSM+MAY+RAG+ ++GE LLREMD+QE+  G EVYKALLR YSM G++EGA+RVF+
Sbjct:   235 YRSYGSMIMAYIRAGVPEKGESLLREMDSQEICAGREVYKALLRDYSMGGDAEGAKRVFD 294

Query:   300 AIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKEN 359
             A+Q AGITPD ++C LLINAY ++GQSQ A  AF+NMRKAG++ +DKCVAL+L+A EKE 
Sbjct:   295 AVQIAGITPDVKLCGLLINAYSVSGQSQNARLAFENMRKAGIKATDKCVALVLAAYEKEE 354

Query:   360 QLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREY 406
             +LN AL FL++LE+D  M+GKEAS  LA WFK+LGVVEEVE +LRE+
Sbjct:   355 KLNEALGFLVELEKDSIMLGKEASAVLAQWFKKLGVVEEVELLLREF 401




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2016402 NFD5 "NUCLEAR FUSION DEFECTIVE 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175443 AT5G04810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024301 AT1G09820 "AT1G09820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044430 AT2G18940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077637 AT3G06920 "AT3G06920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077735 AT3G59040 "AT3G59040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174008 AT5G61990 "AT5G61990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LPC4PPR1_ARATHNo assigned EC number0.63110.81320.8410yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XIV.814.1
hypothetical protein (337 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-11
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-06
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.003
pfam06239229 pfam06239, ECSIT, Evolutionarily conserved signall 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 65.3 bits (159), Expect = 3e-11
 Identities = 41/167 (24%), Positives = 78/167 (46%)

Query: 209 TVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDA 268
           T+ V   S+ G+   A   ++++K  G   D+  + ++V     AG LD+   +L++   
Sbjct: 618 TIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARK 677

Query: 269 QEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQK 328
           Q + +G+  Y +L+   S   N + A  ++E I+   + P       LI A     Q  K
Sbjct: 678 QGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPK 737

Query: 329 AYTAFQNMRKAGLEPSDKCVALILSACEKENQLNRALEFLIDLERDG 375
           A      M++ GL P+    +++L A E+++  +  L+ L   + DG
Sbjct: 738 ALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDG 784


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|148068 pfam06239, ECSIT, Evolutionarily conserved signalling intermediate in Toll pathway Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 423
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.91
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.8
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.79
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.77
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.74
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.73
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.73
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.72
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.72
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.68
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.67
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.66
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.65
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.64
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.61
PRK14574 822 hmsH outer membrane protein; Provisional 99.58
PRK14574 822 hmsH outer membrane protein; Provisional 99.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.54
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.54
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.5
KOG2076 895 consensus RNA polymerase III transcription factor 99.49
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.49
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.48
KOG1126638 consensus DNA-binding cell division cycle control 99.47
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.46
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.45
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.44
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.44
KOG1126638 consensus DNA-binding cell division cycle control 99.43
PF1304150 PPR_2: PPR repeat family 99.41
KOG2003 840 consensus TPR repeat-containing protein [General f 99.41
PF1304150 PPR_2: PPR repeat family 99.4
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.37
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.37
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.36
PRK12370553 invasion protein regulator; Provisional 99.35
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.33
PRK12370553 invasion protein regulator; Provisional 99.31
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.3
KOG2003 840 consensus TPR repeat-containing protein [General f 99.28
KOG2076 895 consensus RNA polymerase III transcription factor 99.27
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.24
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.23
KOG1129478 consensus TPR repeat-containing protein [General f 99.23
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.18
KOG0547606 consensus Translocase of outer mitochondrial membr 99.18
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.15
KOG1129478 consensus TPR repeat-containing protein [General f 99.14
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.14
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.11
PRK11189296 lipoprotein NlpI; Provisional 99.07
PRK11189296 lipoprotein NlpI; Provisional 99.06
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.06
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.05
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.05
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.02
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.0
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.94
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.94
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.86
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.85
PF1285434 PPR_1: PPR repeat 98.83
PF1285434 PPR_1: PPR repeat 98.83
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.82
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.79
KOG0547606 consensus Translocase of outer mitochondrial membr 98.79
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.77
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.77
PLN02789320 farnesyltranstransferase 98.74
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.74
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.7
KOG1125579 consensus TPR repeat-containing protein [General f 98.65
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.6
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.59
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.57
KOG1128777 consensus Uncharacterized conserved protein, conta 98.56
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.56
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.51
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.5
PLN02789320 farnesyltranstransferase 98.5
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.49
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.49
PRK10370198 formate-dependent nitrite reductase complex subuni 98.49
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.48
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.48
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.47
PRK04841 903 transcriptional regulator MalT; Provisional 98.46
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.45
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.44
PRK10370198 formate-dependent nitrite reductase complex subuni 98.44
KOG1125579 consensus TPR repeat-containing protein [General f 98.43
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.41
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.4
PRK15359144 type III secretion system chaperone protein SscB; 98.39
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.38
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.36
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.36
PRK15359144 type III secretion system chaperone protein SscB; 98.33
PRK04841 903 transcriptional regulator MalT; Provisional 98.31
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.3
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.3
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.29
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.28
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.26
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.26
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.25
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.24
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.24
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.22
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.22
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.22
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.21
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.2
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.19
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.18
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.16
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.16
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.14
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.14
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.12
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.1
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.09
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.08
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.07
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 98.05
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.02
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.02
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.01
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.96
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.94
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.92
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.91
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.9
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.89
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.88
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.87
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.86
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.84
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.78
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.72
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.71
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.7
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.7
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.68
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.66
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.63
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.62
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.62
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.61
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.6
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.56
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.56
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.5
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.49
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.48
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.47
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.46
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.45
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.44
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.44
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.41
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.38
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.35
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.34
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.25
PF12688120 TPR_5: Tetratrico peptide repeat 97.19
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.17
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.12
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.1
PF12688120 TPR_5: Tetratrico peptide repeat 97.09
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.08
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.03
KOG0553304 consensus TPR repeat-containing protein [General f 97.03
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.02
KOG0553304 consensus TPR repeat-containing protein [General f 97.01
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.0
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.96
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.94
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.89
COG4700251 Uncharacterized protein conserved in bacteria cont 96.86
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.86
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.83
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.8
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.71
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.7
COG4700251 Uncharacterized protein conserved in bacteria cont 96.7
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.69
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.67
PRK10803263 tol-pal system protein YbgF; Provisional 96.66
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.64
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.6
KOG3941406 consensus Intermediate in Toll signal transduction 96.57
PRK10803263 tol-pal system protein YbgF; Provisional 96.53
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.46
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.43
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.32
PF1337173 TPR_9: Tetratricopeptide repeat 96.21
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.19
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.18
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.15
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.14
PF1337173 TPR_9: Tetratricopeptide repeat 95.98
KOG3941 406 consensus Intermediate in Toll signal transduction 95.97
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.96
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.94
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.92
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.9
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.73
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.71
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.7
smart00299140 CLH Clathrin heavy chain repeat homology. 95.57
KOG20411189 consensus WD40 repeat protein [General function pr 95.56
PRK15331165 chaperone protein SicA; Provisional 95.54
smart00299140 CLH Clathrin heavy chain repeat homology. 95.49
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.47
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.47
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.45
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.42
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.37
PRK15331165 chaperone protein SicA; Provisional 95.34
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.29
KOG20411189 consensus WD40 repeat protein [General function pr 95.28
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.21
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.16
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 94.92
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.88
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.72
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 94.7
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 94.69
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.45
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.42
KOG1585308 consensus Protein required for fusion of vesicles 94.37
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.35
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.26
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.25
COG3629280 DnrI DNA-binding transcriptional activator of the 94.17
COG3898531 Uncharacterized membrane-bound protein [Function u 94.14
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.0
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.89
COG3629280 DnrI DNA-binding transcriptional activator of the 93.75
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.74
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.5
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.45
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.44
KOG4555175 consensus TPR repeat-containing protein [Function 93.4
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.32
KOG4555175 consensus TPR repeat-containing protein [Function 92.94
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.8
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.7
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.69
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.67
COG0457291 NrfG FOG: TPR repeat [General function prediction 92.65
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.64
PF13929292 mRNA_stabil: mRNA stabilisation 92.47
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.42
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.36
COG0457291 NrfG FOG: TPR repeat [General function prediction 92.3
PF1342844 TPR_14: Tetratricopeptide repeat 92.16
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.15
PF1342844 TPR_14: Tetratricopeptide repeat 92.0
KOG1550552 consensus Extracellular protein SEL-1 and related 91.92
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.82
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 91.69
PF13512142 TPR_18: Tetratricopeptide repeat 91.46
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.91
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.89
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.87
PRK11906458 transcriptional regulator; Provisional 90.69
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 90.65
KOG4570 418 consensus Uncharacterized conserved protein [Funct 90.62
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.52
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.14
KOG4570418 consensus Uncharacterized conserved protein [Funct 89.78
COG3118304 Thioredoxin domain-containing protein [Posttransla 89.4
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.39
PRK11619 644 lytic murein transglycosylase; Provisional 89.16
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.46
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 88.44
PF13929292 mRNA_stabil: mRNA stabilisation 88.37
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.14
PRK11906458 transcriptional regulator; Provisional 88.0
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 87.97
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 87.95
PHA02875 413 ankyrin repeat protein; Provisional 87.38
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.06
PF13512142 TPR_18: Tetratricopeptide repeat 86.89
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.87
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.54
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.47
KOG1550552 consensus Extracellular protein SEL-1 and related 86.24
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.11
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 86.08
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 85.81
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.56
PF1343134 TPR_17: Tetratricopeptide repeat 85.41
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 85.41
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.26
PHA02875 413 ankyrin repeat protein; Provisional 85.01
PF1343134 TPR_17: Tetratricopeptide repeat 84.71
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 84.53
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.63
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 82.76
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 82.72
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 82.45
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 81.83
PRK09687280 putative lyase; Provisional 80.87
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 80.56
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 80.24
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.3e-58  Score=466.70  Aligned_cols=367  Identities=17%  Similarity=0.184  Sum_probs=306.3

Q ss_pred             hhhcCchhhHhhhhhcccccccccCCCcceeeeeeccccchHH-HHHHhcCChhhhh----hhHHHHHHHHhccCCCCCH
Q 014507           46 SRSLRSGPALEAIKAEDMGKTQVKDDTSMFTWIQIGPNITEEQ-KQAISQFPRKMTK----RCKAFVKQIICVSPETGNL  120 (423)
Q Consensus        46 ~~~~~~~~a~~~~~~~~m~~~g~~~~~~~~~~~~l~~~~~~~~-~~~a~~~~~~m~~----~~~~~~~~ll~~~~~~g~~  120 (423)
                      ++.|+++.|..+  |++|.+.|+.|+.  .+||+++.+|++.+ .+.|.++|++|.+    +|..+|+.+|.+|++.|++
T Consensus       448 ~k~g~~e~A~~l--f~~M~~~Gl~pD~--~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~  523 (1060)
T PLN03218        448 ASSQDIDGALRV--LRLVQEAGLKADC--KLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQV  523 (1060)
T ss_pred             HhCcCHHHHHHH--HHHHHHcCCCCCH--HHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCH
Confidence            667788888777  8888888888876  88888888888644 4888888888874    6888888888888888888


Q ss_pred             HHHHHHHHHh----cCCChhhHHHHHHHHHhcCCchHHHHHHHHHhh--cccCCCHHHHHHHHHHHHccCCHHHHHHHHH
Q 014507          121 SDLLAAWVRF----MKPRRADWLAVLKQLKLMEHPLYLQVAELALLE--ESFEANIRDYTKIIHGYGKKMQIQNAENTLL  194 (423)
Q Consensus       121 ~~a~~~~~~~----~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~--~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~  194 (423)
                      ++|+++|++|    +.||..+|+.++.+|++.|+.+.|..++..|..  .|+.||..+|+++|.+|++.|++++|.++|+
T Consensus       524 eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~  603 (1060)
T PLN03218        524 AKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQ  603 (1060)
T ss_pred             HHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHH
Confidence            8888888887    568888888888888888888888888888865  5678888888888888888888888888888


Q ss_pred             HHHHcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHhCCCCCC
Q 014507          195 AMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVG  274 (423)
Q Consensus       195 ~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~  274 (423)
                      .|.+.|+.|+..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.++.+|++.|++++|.++|++|.+.|+.||
T Consensus       604 ~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd  683 (1060)
T PLN03218        604 MIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLG  683 (1060)
T ss_pred             HHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCC
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             HHHHHHHHHHHHhCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q 014507          275 SEVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSA  354 (423)
Q Consensus       275 ~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~  354 (423)
                      ..+|+.||.+|++.|++++|.++|++|.+.|+.||..+||.||.+|++.|++++|.++|++|.+.|+.||..||+.++.+
T Consensus       684 ~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a  763 (1060)
T PLN03218        684 TVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVA  763 (1060)
T ss_pred             HHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHH
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             HHHcCCHHHHHHHHHHHHHCCCCcCHHHHHHHHHHHH----HcC-------------------CHHHHHHHHHHhcccCC
Q 014507          355 CEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFK----RLG-------------------VVEEVEHVLREYGLRET  411 (423)
Q Consensus       355 ~~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~l~~~~~----~~g-------------------~~~~A~~~~~~m~~~~~  411 (423)
                      |++.|++++|.+++++|.+.|+.||..+|++++..|.    +++                   ..++|..+|++|.+.++
T Consensus       764 ~~k~G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l~~~v~~f~~g~~~~~n~w~~~Al~lf~eM~~~Gi  843 (1060)
T PLN03218        764 SERKDDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLRRFEKACALGEPVVSFDSGRPQIENKWTSWALMVYRETISAGT  843 (1060)
T ss_pred             HHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccccccccchHHHHHHHHHHHHHCCC
Confidence            8888888888888888888888888888888876543    221                   23568888888888888


Q ss_pred             cCCCC
Q 014507          412 YSKIP  416 (423)
Q Consensus       412 ~~~~~  416 (423)
                      .|+..
T Consensus       844 ~Pd~~  848 (1060)
T PLN03218        844 LPTME  848 (1060)
T ss_pred             CCCHH
Confidence            77643



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 79.1 bits (193), Expect = 6e-16
 Identities = 36/281 (12%), Positives = 83/281 (29%), Gaps = 16/281 (5%)

Query: 116 ETGNLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTK 175
                      W + ++  +      +++LK     +  Q  E   L    +   R  +K
Sbjct: 15  AKDATPVPCGRWAKILEKDKRTQQMRMQRLKAK-LQMPFQSGEFKALTRRLQVEPRLLSK 73

Query: 176 IIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLG 235
            + G  +    Q  E+             +  L  ++       +L + +    +     
Sbjct: 74  QMAGCLEDCTRQAPESP-----------WEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQ 122

Query: 236 EPLDKRSYGSMVMAYVRAGMLDRGEVLL---REMDAQEVYVGSEVYKALLRGYSMNGNSE 292
               ++   +     +    L     LL        +   +  ++Y A++ G++  G  +
Sbjct: 123 LSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFK 182

Query: 293 GAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAY-TAFQNMRKAGLEPSDKCVALI 351
               V   ++ AG+TPD    A  +       Q         + M + GL+      A++
Sbjct: 183 ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVL 242

Query: 352 LSACEKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKR 392
           LS  ++   L    +          +     +  L      
Sbjct: 243 LSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYA 283


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.88
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.83
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.82
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.8
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.8
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.78
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.77
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.76
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.76
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.73
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.72
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.68
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.64
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.64
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.64
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.62
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.62
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.61
3u4t_A272 TPR repeat-containing protein; structural genomics 99.6
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.6
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.59
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.57
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.57
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.57
3u4t_A272 TPR repeat-containing protein; structural genomics 99.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.55
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.55
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.54
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.52
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.51
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.5
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.49
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.47
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.47
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.47
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.47
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.46
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.46
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.46
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.46
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.45
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.45
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.42
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.37
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.36
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.32
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.27
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.26
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.26
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.25
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.23
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.23
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.22
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.19
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.1
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.08
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.02
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.99
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.98
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.98
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.97
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.97
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.93
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.91
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.9
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.89
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.86
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.85
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.85
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.85
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.84
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.83
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.83
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.83
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.82
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.8
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.8
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.78
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.73
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.73
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.71
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.68
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.68
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.68
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.66
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.66
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.64
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.64
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.63
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.61
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.59
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.59
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.57
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.57
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.55
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.54
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.54
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.54
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.53
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.53
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.52
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.51
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.51
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.51
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.49
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.47
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.45
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.44
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.43
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.39
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.39
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.38
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.38
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.35
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.35
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.34
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.34
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.31
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.27
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.26
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.26
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.25
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.24
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.23
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.23
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.21
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.2
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.19
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.15
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.15
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.14
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.12
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.1
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.05
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.98
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.97
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.97
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.96
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.94
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.91
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.88
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.87
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.84
3k9i_A117 BH0479 protein; putative protein binding protein, 97.83
3k9i_A117 BH0479 protein; putative protein binding protein, 97.83
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.83
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.73
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.71
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.69
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.69
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.69
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.66
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.65
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.64
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.63
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.57
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.57
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.46
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.42
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.4
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.4
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.15
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.1
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.1
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.02
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.99
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.86
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.74
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.69
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.64
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.63
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.56
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.45
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.34
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.89
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.63
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.55
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.4
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.26
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.11
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.04
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.87
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.64
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.24
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.23
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.15
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.05
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.05
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.69
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.57
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.38
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.87
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.8
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.3
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.15
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.03
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.53
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.41
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.08
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 88.85
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 88.73
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 87.89
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 86.8
2p58_C116 Putative type III secretion protein YSCG; type III 86.23
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 84.78
2uwj_G115 Type III export protein PSCG; virulence, chaperone 84.29
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 84.22
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 83.67
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 83.3
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 81.96
2p58_C116 Putative type III secretion protein YSCG; type III 81.76
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 80.09
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=3e-34  Score=274.23  Aligned_cols=205  Identities=15%  Similarity=0.132  Sum_probs=182.1

Q ss_pred             HHHHHHHHhhcccCCCH-HHHHHHHHHHHccCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCC---------HHH
Q 014507          154 LQVAELALLEESFEANI-RDYTKIIHGYGKKMQIQNAENTLLAMKRRGFICDQVTLTVMVVMYSKAGN---------LKM  223 (423)
Q Consensus       154 a~~~~~~~~~~~~~~~~-~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~---------~~~  223 (423)
                      ++.+.+.+.+.+..+.+ ..++.+|++|++.|++++|+++|++|.+.|+.||..|||+||.+|++.+.         +++
T Consensus         9 ~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~   88 (501)
T 4g26_A            9 SENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSR   88 (501)
T ss_dssp             ---------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHH
T ss_pred             HHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHH
Confidence            34555666666666554 45888999999999999999999999999999999999999999988765         688


Q ss_pred             HHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHH
Q 014507          224 AEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGSEVYKALLRGYSMNGNSEGAQRVFEAIQF  303 (423)
Q Consensus       224 A~~~~~~m~~~g~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~  303 (423)
                      |.++|++|.+.|+.||..||++||.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+
T Consensus        89 A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~  168 (501)
T 4g26_A           89 GFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVE  168 (501)
T ss_dssp             HHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHc
Q 014507          304 AGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSACEKE  358 (423)
Q Consensus       304 ~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~  358 (423)
                      .|+.||..||++||.+|++.|++++|.+++++|++.|..|+..||+.++..|+..
T Consensus       169 ~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~  223 (501)
T 4g26_A          169 SEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSE  223 (501)
T ss_dssp             TTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSH
T ss_pred             cCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999999999999999999998763



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.83
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.74
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.22
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.22
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.19
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.15
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.15
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.13
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.0
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.95
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.82
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.77
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.52
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.52
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.5
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.36
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.35
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.34
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.33
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.3
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.28
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.11
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.06
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.06
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.05
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.97
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.91
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.82
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.81
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.79
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.78
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.74
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.74
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.65
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.65
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.64
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.62
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.51
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.4
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.37
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.31
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.27
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.2
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.99
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.93
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.38
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.26
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.06
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.9
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.58
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.78
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 91.44
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.31
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.72
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 86.82
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=1.2e-17  Score=152.28  Aligned_cols=354  Identities=12%  Similarity=0.031  Sum_probs=232.0

Q ss_pred             hhhhhhcCchhhHhhhhhcccccccccCCCcceeeeeeccccch-HHHHHHhcCChhhhh---hhHHHHHHHHhccCCCC
Q 014507           43 AKWSRSLRSGPALEAIKAEDMGKTQVKDDTSMFTWIQIGPNITE-EQKQAISQFPRKMTK---RCKAFVKQIICVSPETG  118 (423)
Q Consensus        43 ~~~~~~~~~~~a~~~~~~~~m~~~g~~~~~~~~~~~~l~~~~~~-~~~~~a~~~~~~m~~---~~~~~~~~ll~~~~~~g  118 (423)
                      ..+.+.|++++|+..  ++++.+.  .|+. ...+..+..++.+ ++.+.|...|++..+   .+..+|..+...+.+.|
T Consensus         7 ~~~~~~G~~~~A~~~--~~~~l~~--~p~~-~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           7 HREYQAGDFEAAERH--CMQLWRQ--EPDN-TGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             HHHHHHTCHHHHHHH--HHHHHHH--CTTC-HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             HHHHHcCCHHHHHHH--HHHHHHh--CCCC-HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhc
Confidence            334788999999888  8887753  5653 3455556666654 556888888887754   34567888888899999


Q ss_pred             CHHHHHHHHHHhc--CC-ChhhHHHHHHHHHhcCCchHHHHHHHHHhhcccCCCHHHHHHHHHHHHccCCHHHHHHHHHH
Q 014507          119 NLSDLLAAWVRFM--KP-RRADWLAVLKQLKLMEHPLYLQVAELALLEESFEANIRDYTKIIHGYGKKMQIQNAENTLLA  195 (423)
Q Consensus       119 ~~~~a~~~~~~~~--~p-~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~  195 (423)
                      ++++|++.+....  .| +............................... .................+....+...+..
T Consensus        82 ~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN-PDLYCVRSDLGNLLKALGRLEEAKACYLK  160 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-TTCTHHHHHHHHHHHTTSCHHHHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccc-cccccccccccccccccchhhhhHHHHHH
Confidence            9999999998863  22 33333344444444444444444333333222 23334444455555666666676666666


Q ss_pred             HHHcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHhCCCCCCH
Q 014507          196 MKRRGFICDQVTLTVMVVMYSKAGNLKMAEETFEEIKLLGEPLDKRSYGSMVMAYVRAGMLDRGEVLLREMDAQEVYVGS  275 (423)
Q Consensus       196 m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~  275 (423)
                      ....... +...+..+...+...|++++|...+++..+.. +-+..+|..+...+...|++++|...+++..+.+.. +.
T Consensus       161 ~~~~~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~-~~  237 (388)
T d1w3ba_         161 AIETQPN-FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN-HA  237 (388)
T ss_dssp             HHHHCTT-CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT-CH
T ss_pred             hhccCcc-hhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhh-HH
Confidence            6555322 55666667777777777777777777776653 335566777777777777777777777777665443 55


Q ss_pred             HHHHHHHHHHHhCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q 014507          276 EVYKALLRGYSMNGNSEGAQRVFEAIQFAGITPDARMCALLINAYQMAGQSQKAYTAFQNMRKAGLEPSDKCVALILSAC  355 (423)
Q Consensus       276 ~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~  355 (423)
                      ..+..+...+.+.|++++|...|++..+.. +-+..+|..+...+...|++++|.+.++...... +.+...+..+...+
T Consensus       238 ~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~  315 (388)
T d1w3ba_         238 VVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIK  315 (388)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHH
Confidence            666667777777777777777777766542 2256667777777777777777777777766542 34566667777777


Q ss_pred             HHcCCHHHHHHHHHHHHHCCCCcCHHHHHHHHHHHHHcCCHHHHHHHHHHhcc
Q 014507          356 EKENQLNRALEFLIDLERDGFMVGKEASCTLAAWFKRLGVVEEVEHVLREYGL  408 (423)
Q Consensus       356 ~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~  408 (423)
                      ...|++++|.+.+++..+.. +-+..++..+..+|.+.|++++|.+.|++..+
T Consensus       316 ~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         316 REQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             HTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT
T ss_pred             HHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            77777777777777766532 23456677777777777777777777776544



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure