Citrus Sinensis ID: 014560

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--
MSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
ccEEEccccccccccHHHHcccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEcccccccccccccccccHHHHHHHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHcccccccEEEcccccccccHHHHHcccHHHHHHHcccccccc
ccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHccccccccEEEccccccccccHHHcccccccEEEcccccccccccccccccccccccHHHccccccHEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHcccccccEEEccccccccc
mskldvegnkltVLSNNLIASWTMLTELIASKnllngmpetIGSLSRLIRLDLhqnrilsipssisgcCSLAefymgnnalsALPAElgklsklgtldlhSNQLKEYCVEACQLRLSVLDlsnnslsglppeigkMTTLRKLLLtgnplrtlrsslvngptpALLKYLRSrlpenedseasttkEDLITMATRLSVTSKELslegmnlsaipseiweageitkldlsrnsiqelppelsscASLQTLILSRnkikdwpdAILTSLsslsclkldnnplrqvpsdgfkdipmlqiLDLSyniaslpenppfsslphLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKnltslteldlsdnnisalppelgllepslqalrldgnplrsIRRTILDRGTKAVLKYLKDKIPEN
mskldvegnKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRtlrsslvngptPALLKYLRsrlpenedseasttkedlitMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQAlrldgnplrsirrtildrgtkavlkylkdkipen
MSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQlrlsvldlsnnslsglPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAIltslsslsclklDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTdilrlqqlrildlSQNSLQSIPEGFKNLTSLTELDLSDNNISAlppelgllepslQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
*********KLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYL*************************************MNLSAIPSEIWEAGEITKLDL***********LSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPEN*PFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELD************LGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYL*******
MSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPEN************ITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKI***
MSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRL**********TKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
MSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLK******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query422 2.2.26 [Sep-21-2011]
Q5RFE9602 Leucine-rich repeat-conta yes no 0.926 0.649 0.318 1e-39
Q4R3P6602 Leucine-rich repeat-conta N/A no 0.926 0.649 0.320 2e-39
Q5ZLN0603 Leucine-rich repeat-conta yes no 0.919 0.643 0.321 3e-39
Q6GPJ5605 Leucine-rich repeat-conta N/A no 0.924 0.644 0.327 3e-39
Q9H9A6602 Leucine-rich repeat-conta yes no 0.926 0.649 0.318 3e-39
Q7SXW3601 Leucine-rich repeat-conta yes no 0.926 0.650 0.323 2e-36
Q9CRC8602 Leucine-rich repeat-conta yes no 0.881 0.617 0.326 4e-36
B0W6M9628 Leucine-rich repeat prote N/A no 0.834 0.560 0.333 2e-33
Q5M8G4605 Leucine-rich repeat-conta yes no 0.928 0.647 0.298 1e-32
Q5F4C4529 Leucine-rich repeat prote no no 0.819 0.654 0.309 3e-31
>sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 Back     alignment and function desciption
 Score =  164 bits (415), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 145/455 (31%), Positives = 229/455 (50%), Gaps = 64/455 (14%)

Query: 1   MSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILS 60
           +  LD+  N+LT +  +  +S + L  L  S N L  +P  I  + RL  LD + N + +
Sbjct: 176 LEDLDLSNNRLTTVPASF-SSLSSLVRLNLSSNELKSLPAEINRMKRLKHLDCNSNLLET 234

Query: 61  IPSSISG----------------------CCSLAEFYMGNNALSALPAE-LGKLSKLGTL 97
           IP  ++G                      C  L E ++G N +  L AE L  L+ +  L
Sbjct: 235 IPPELAGMESLELLYLRRNKLRFLPEFPSCSLLKELHVGENQIEMLEAEHLKHLNSILVL 294

Query: 98  DLHSNQLKEYCVEACQLR-LSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSL 156
           DL  N+LK    E   L+ L  LDLSNN +S LP  +G +  L+ L L GNPLRT+R  +
Sbjct: 295 DLRDNKLKSVPDEIILLQSLERLDLSNNDISSLPYSLGNLH-LKFLALEGNPLRTIRREI 353

Query: 157 VNGPTPALLKYLRSRLPENEDSEASTTKEDLITMAT------RLSVTSKELSLEGMNLSA 210
           +N  T  +LKYLRS++ ++  S++ +  E  +T+ +      R  +T K L       + 
Sbjct: 354 INKGTQEVLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIRAIITLKILDYSDKQATL 413

Query: 211 IPSEIWEAGE---ITKLDLSRNSIQELPPELSSCASLQTLI-LSRNKIKDWPDAILTSLS 266
           IP E+++A +   IT ++ S+N + E+P  +     + + + LS NK+  +    L  L 
Sbjct: 414 IPDEVFDAVKSNIITSINFSKNQLCEIPKRMVELKEMVSDVNLSFNKLS-FISLELCVLQ 472

Query: 267 SLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQL 326
            L+ L L NN L  +P +  + +  LQ ++LS+N         F  LP +  LY      
Sbjct: 473 KLTFLDLRNNFLNSLPEE-VESLVRLQTINLSFN--------RFKMLPEV--LY------ 515

Query: 327 REAPTDILRLQQLRILDLSQNSLQSI-PEGFKNLTSLTELDLSDNNISALPPELGLLEPS 385
                   R+  L  + +S N + S+ P+  K + +LT LDL +N++  +PPELG    +
Sbjct: 516 --------RIFTLETILISNNQVGSVDPQKMKMMENLTTLDLQNNDLLQIPPELGNC-VN 566

Query: 386 LQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIP 420
           L+ L LDGNP R  R  IL +GT  +L+YL+D+IP
Sbjct: 567 LRTLLLDGNPFRVPRAAILMKGTAGILEYLRDRIP 601

Pongo abelii (taxid: 9601)
>sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=2 SV=2 Back     alignment and function description
>sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query422
359493861 584 PREDICTED: leucine-rich repeat-containin 0.995 0.719 0.807 0.0
225461397 588 PREDICTED: leucine-rich repeat-containin 0.995 0.714 0.790 0.0
224114980 580 predicted protein [Populus trichocarpa] 0.990 0.720 0.782 1e-180
356549743 583 PREDICTED: leucine-rich repeat-containin 0.893 0.646 0.779 1e-177
449431828 583 PREDICTED: leucine-rich repeat-containin 0.997 0.722 0.751 1e-172
255575336 571 leucine-rich repeat-containing protein, 0.940 0.695 0.763 1e-169
356544024 586 PREDICTED: leucine-rich repeat-containin 0.898 0.646 0.776 1e-169
297830120 584 leucine-rich repeat family protein [Arab 0.997 0.720 0.720 1e-167
30683597 584 leucine-rich repeat-containing protein [ 0.997 0.720 0.715 1e-165
334185371 590 leucine-rich repeat-containing protein [ 0.997 0.713 0.715 1e-165
>gi|359493861|ref|XP_003634682.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 2 [Vitis vinifera] gi|302143032|emb|CBI20327.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/421 (80%), Positives = 380/421 (90%), Gaps = 1/421 (0%)

Query: 3   KLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIP 62
           KLDVEGNKLT+LS N+IASW +LTEL AS+NLL G+PE IG LSRLIRLD HQNRI SIP
Sbjct: 164 KLDVEGNKLTMLSENMIASWVLLTELNASRNLLTGLPENIGRLSRLIRLDFHQNRISSIP 223

Query: 63  SSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLS 122
           +SI GCCSLAEFYMGNN LS+L AE+G LS LGTLDLHSNQLKEY VEAC+LRL VLDLS
Sbjct: 224 ASIKGCCSLAEFYMGNNVLSSLTAEIGALSLLGTLDLHSNQLKEYPVEACKLRLQVLDLS 283

Query: 123 NNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEAST 182
           NNSLSGLPPEIG MTTLRKL+LTGNPLRTLRSSLV+GPTPALLK+LRSRL  +EDSEA+T
Sbjct: 284 NNSLSGLPPEIGMMTTLRKLVLTGNPLRTLRSSLVSGPTPALLKFLRSRLSTDEDSEAAT 343

Query: 183 T-KEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSC 241
           T KE+++TMA R+S+TSKELSLEGM LSA+P+++WE+ EI K+DLSRNSIQELPPEL+SC
Sbjct: 344 TAKENVVTMAARISITSKELSLEGMGLSAVPAQVWESSEIVKVDLSRNSIQELPPELTSC 403

Query: 242 ASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNI 301
            SLQ LILSRNKI++WP  IL SL +LSCLKLDNNPLRQ+P+DGF+ +  LQILDLS N 
Sbjct: 404 VSLQALILSRNKIQEWPGVILKSLPNLSCLKLDNNPLRQIPADGFQAVSKLQILDLSGNS 463

Query: 302 ASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTS 361
           ASLP+NP FSSLP LQELYLRRMQL E P+DIL LQQL+ILDLSQNSLQ IPEGFKNLTS
Sbjct: 464 ASLPDNPAFSSLPQLQELYLRRMQLCEVPSDILSLQQLQILDLSQNSLQLIPEGFKNLTS 523

Query: 362 LTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE 421
           LTEL+LSDN+I+ LPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE
Sbjct: 524 LTELNLSDNSIATLPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE 583

Query: 422 N 422
           +
Sbjct: 584 H 584

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225461397|ref|XP_002284846.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114980|ref|XP_002316909.1| predicted protein [Populus trichocarpa] gi|222859974|gb|EEE97521.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356549743|ref|XP_003543250.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Glycine max] Back     alignment and taxonomy information
>gi|449431828|ref|XP_004133702.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] gi|449478165|ref|XP_004155239.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255575336|ref|XP_002528571.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223532015|gb|EEF33826.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356544024|ref|XP_003540456.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Glycine max] Back     alignment and taxonomy information
>gi|297830120|ref|XP_002882942.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297328782|gb|EFH59201.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30683597|ref|NP_188160.2| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|21703129|gb|AAM74505.1| AT3g15410/MJK13_7 [Arabidopsis thaliana] gi|24111377|gb|AAN46812.1| At3g15410/MJK13_7 [Arabidopsis thaliana] gi|332642149|gb|AEE75670.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185371|ref|NP_001189901.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|332642150|gb|AEE75671.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query422
MGI|MGI:1914394602 Lrrc40 "leucine rich repeat co 0.919 0.644 0.280 5.9e-28
ZFIN|ZDB-GENE-030131-6062601 lrrc40 "leucine rich repeat co 0.936 0.657 0.275 2.6e-27
WB|WBGene00004929559 soc-2 [Caenorhabditis elegans 0.952 0.719 0.261 5.3e-25
UNIPROTKB|Q22875559 soc-2 "Leucine-rich repeat pro 0.952 0.719 0.261 5.3e-25
UNIPROTKB|Q5F4C4529 SHOC2 "Leucine-rich repeat pro 0.907 0.724 0.266 1.9e-23
ZFIN|ZDB-GENE-050208-523561 shoc2 "soc-2 suppressor of cle 0.909 0.684 0.262 3e-23
UNIPROTKB|F1NRN7529 SHOC2 "Leucine-rich repeat pro 0.909 0.725 0.264 3.2e-23
UNIPROTKB|E1BU15582 SHOC2 "Leucine-rich repeat pro 0.909 0.659 0.264 4.3e-23
UNIPROTKB|Q8AVI4577 shoc2 "Leucine-rich repeat pro 0.912 0.667 0.261 5.4e-23
UNIPROTKB|E2R260582 SHOC2 "Uncharacterized protein 0.909 0.659 0.264 7.1e-23
MGI|MGI:1914394 Lrrc40 "leucine rich repeat containing 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 319 (117.4 bits), Expect = 5.9e-28, P = 5.9e-28
 Identities = 121/431 (28%), Positives = 194/431 (45%)

Query:     3 KLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIP 62
             +L++  N+L  L    I+    L  L    NLL  +P  +GS+  L  L L +N++  +P
Sbjct:   201 RLNLSSNQLKNLPAE-ISRMKRLKHLDCDANLLETVPPDVGSMESLELLYLRRNKLRVLP 259

Query:    63 SSISGCCSLAEFYMGNNALSALPAE-LGKLSKLGTLDLHSNQLKEYCVE-ACQXXXXXXX 120
                S C  L E ++  N +  L AE L  L  +  LDL  N+L+    E A         
Sbjct:   260 EFPS-CRQLKELHLAENQIEKLGAEHLQHLQAILVLDLRGNKLRSVPEEMALLQSLERLD 318

Query:   121 XXXXXXXXXPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEA 180
                      P  +G +  L+ L L GNPLRT+R  ++   T  +LKYLRS++ ++  ++ 
Sbjct:   319 LSNNDISSLPCSLGNLH-LKFLALEGNPLRTIRREIIAKGTQEVLKYLRSKIKDDRTNQN 377

Query:   181 STTKEDLITMAT--RLSV----TSKELSLEGMNLSAIPSEIWEAGE---ITKLDLSRNSI 231
              +  E  +T+ +  R+++    T K L       + IP ++++A +   IT ++ S+N +
Sbjct:   378 DSVPETAMTLPSEARVNIHAIATLKLLDYSDKQATLIPDDLFDATKTTLITSINFSKNQL 437

Query:   232 QELPPELSSCASLQTLILSRNKIKDWPDAIXXXXXXXXXXXXDNNPLRQVPSDGFKDIPM 291
              E+P  +     L+ ++L  N                       N L  + S     +  
Sbjct:   438 CEIPQRI---VELKEMVLDIN--------------------LSFNKLSFI-SHELCLLQK 473

Query:   292 LQILDLSYN-IASLPENPPFSSLPHLQELYLRRMQLREAPTXXXXXXXXXXXXXSQNSLQ 350
             L  LDL  N ++SLPE    SSL  LQ + L   + +  P              S N + 
Sbjct:   474 LTFLDLRNNFLSSLPEE--MSSLTKLQTINLSFNRFKVFPEVLYRISTLEAVLISNNQVG 531

Query:   351 SI-PEGFKNLTSLTELDLSDNNISAXXXXXXXXXXXXQALRLDGNPLRSIRRTILDRGTK 409
             S+ P+  K + +L  LDL +N++              + L LDGNP R  R  IL +GT 
Sbjct:   532 SVDPQKMKLMENLNTLDLQNNDL-LQIPPELGNCVQLRTLLLDGNPFRVPRAAILMKGTA 590

Query:   410 AVLKYLKDKIP 420
             AVL+YL+D+IP
Sbjct:   591 AVLEYLRDRIP 601
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
ZFIN|ZDB-GENE-030131-6062 lrrc40 "leucine rich repeat containing 40" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00004929 soc-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q22875 soc-2 "Leucine-rich repeat protein soc-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F4C4 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-523 shoc2 "soc-2 suppressor of clear homolog (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRN7 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU15 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8AVI4 shoc2 "Leucine-rich repeat protein SHOC-2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E2R260 SHOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-15
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-11
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  104 bits (261), Expect = 5e-24
 Identities = 117/391 (29%), Positives = 177/391 (45%), Gaps = 34/391 (8%)

Query: 4   LDVEGNKLTVLSNNLIASWTMLTELIASKNLLNG-MPETIGSLSRLIRLDLHQNRIL-SI 61
           LD+  N L+    N I S++ L  L    N+L G +P ++ +L+ L  L L  N+++  I
Sbjct: 145 LDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQI 204

Query: 62  PSSISGCCSLAEFYMGNNALSA-LPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLD 120
           P  +    SL   Y+G N LS  +P E+G L+ L  LDL  N L         +  S+ +
Sbjct: 205 PRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNL------TGPIPSSLGN 258

Query: 121 LSN--------NSLSG-LPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSR 171
           L N        N LSG +PP I  +  L  L L+ N L        +G  P L+  L++ 
Sbjct: 259 LKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSL--------SGEIPELVIQLQNL 310

Query: 172 LPENEDSEASTTK-EDLITMATRLSVTSKELSLEGMNLSA-IPSEIWEAGEITKLDLSRN 229
              +  S   T K    +T   RL V    L L     S  IP  + +   +T LDLS N
Sbjct: 311 EILHLFSNNFTGKIPVALTSLPRLQV----LQLWSNKFSGEIPKNLGKHNNLTVLDLSTN 366

Query: 230 SIQ-ELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKD 288
           ++  E+P  L S  +L  LIL  N ++      L +  SL  ++L +N         F  
Sbjct: 367 NLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTK 426

Query: 289 IPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNS 348
           +P++  LD+S N      N     +P LQ L L R +      D    ++L  LDLS+N 
Sbjct: 427 LPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQ 486

Query: 349 LQ-SIPEGFKNLTSLTELDLSDNNISALPPE 378
              ++P    +L+ L +L LS+N +S   P+
Sbjct: 487 FSGAVPRKLGSLSELMQLKLSENKLSGEIPD 517

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 422
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.61
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.31
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.3
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.27
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.26
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.18
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.15
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.06
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
PLN03150623 hypothetical protein; Provisional 98.6
PLN03150623 hypothetical protein; Provisional 98.59
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.47
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.41
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.4
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.32
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.3
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.28
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.25
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.21
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.19
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.17
KOG4341483 consensus F-box protein containing LRR [General fu 98.17
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.17
PRK15386 426 type III secretion protein GogB; Provisional 98.15
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.08
KOG4341483 consensus F-box protein containing LRR [General fu 98.04
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.89
PRK15386 426 type III secretion protein GogB; Provisional 97.78
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.66
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.2
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.14
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.13
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.3
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.18
KOG0473326 consensus Leucine-rich repeat protein [Function un 96.07
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.27
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.22
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.21
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.12
smart0037026 LRR Leucine-rich repeats, outliers. 94.73
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.73
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.33
smart0037026 LRR Leucine-rich repeats, outliers. 93.94
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.94
KOG4308478 consensus LRR-containing protein [Function unknown 92.52
KOG4308478 consensus LRR-containing protein [Function unknown 92.47
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.29
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.95
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.62
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 85.56
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 81.73
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-39  Score=288.66  Aligned_cols=370  Identities=24%  Similarity=0.321  Sum_probs=310.5

Q ss_pred             ceeeccCCcceecChhHHhhc--ccccceecccccccCC-chhhhccccCCeEeccCCccccCCCCCccCCCCCEEEcCC
Q 014560            2 SKLDVEGNKLTVLSNNLIASW--TMLTELIASKNLLNGM-PETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGN   78 (422)
Q Consensus         2 ~~L~ls~~~i~~i~~~~~~~~--~~L~~L~l~~~~i~~~-~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~~L~~L~l~~   78 (422)
                      +.||++++.+..+....+.+.  +.-++|++++|.+..+ ++.|.++++|+.+++.+|.++.+|.......+|+.|+|.+
T Consensus        55 ~lldcs~~~lea~~~~~l~g~lp~~t~~LdlsnNkl~~id~~~f~nl~nLq~v~l~~N~Lt~IP~f~~~sghl~~L~L~~  134 (873)
T KOG4194|consen   55 RLLDCSDRELEAIDKSRLKGFLPSQTQTLDLSNNKLSHIDFEFFYNLPNLQEVNLNKNELTRIPRFGHESGHLEKLDLRH  134 (873)
T ss_pred             eeeecCccccccccccccCCcCccceeeeeccccccccCcHHHHhcCCcceeeeeccchhhhcccccccccceeEEeeec
Confidence            357889999988877766666  4556699999999887 5788999999999999999999998777777899999999


Q ss_pred             CcCccC-chhhhCCCCCcEEEccCCcccccccccccce--ecEEEcCCCCCCCCC-ccccccCCccEEEcCCCccccccc
Q 014560           79 NALSAL-PAELGKLSKLGTLDLHSNQLKEYCVEACQLR--LSVLDLSNNSLSGLP-PEIGKMTTLRKLLLTGNPLRTLRS  154 (422)
Q Consensus        79 ~~i~~l-~~~l~~~~~L~~L~l~~~~~~~l~~~~~~~~--L~~L~l~~~~~~~~~-~~~~~l~~L~~L~l~~~~~~~~~~  154 (422)
                      |.|+++ .+.+..++.|++||++.|.++.++...++.+  +++|++++|.++.+. ..|..+.+|..|.++.|.++.++.
T Consensus       135 N~I~sv~se~L~~l~alrslDLSrN~is~i~~~sfp~~~ni~~L~La~N~It~l~~~~F~~lnsL~tlkLsrNrittLp~  214 (873)
T KOG4194|consen  135 NLISSVTSEELSALPALRSLDLSRNLISEIPKPSFPAKVNIKKLNLASNRITTLETGHFDSLNSLLTLKLSRNRITTLPQ  214 (873)
T ss_pred             cccccccHHHHHhHhhhhhhhhhhchhhcccCCCCCCCCCceEEeeccccccccccccccccchheeeecccCcccccCH
Confidence            999987 5669999999999999999999888777664  999999999999853 458888999999999999988876


Q ss_pred             cccCCCChHHHHHHHccCCCCccccccchhhhHHHhhhccccccceeeccCCCCCCC-CcccccCCCccEEeCCCCcccc
Q 014560          155 SLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAI-PSEIWEAGEITKLDLSRNSIQE  233 (422)
Q Consensus       155 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~-~~~~~~~~~L~~L~l~~~~l~~  233 (422)
                      ..|..                                   ...++.+++..|.+..+ ...+.++++|+.|.+..|++..
T Consensus       215 r~Fk~-----------------------------------L~~L~~LdLnrN~irive~ltFqgL~Sl~nlklqrN~I~k  259 (873)
T KOG4194|consen  215 RSFKR-----------------------------------LPKLESLDLNRNRIRIVEGLTFQGLPSLQNLKLQRNDISK  259 (873)
T ss_pred             HHhhh-----------------------------------cchhhhhhccccceeeehhhhhcCchhhhhhhhhhcCccc
Confidence            55531                                   14567778887777755 3445567888889999998888


Q ss_pred             CCcc-ccCCCCCcEEEecCCcCCCCChHHHhcCCCCCEEECCCCCCCcCCCCCCCCCCCccEEEccCCcCCCCCCCCCCC
Q 014560          234 LPPE-LSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSS  312 (422)
Q Consensus       234 ~~~~-~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~  312 (422)
                      +.+. |..+.++++|+++.|++.....+.+-++.+|+.|+++.|.+..+....|..+++|+.|+++.|.++...+..|..
T Consensus       260 L~DG~Fy~l~kme~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~rih~d~WsftqkL~~LdLs~N~i~~l~~~sf~~  339 (873)
T KOG4194|consen  260 LDDGAFYGLEKMEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQRIHIDSWSFTQKLKELDLSSNRITRLDEGSFRV  339 (873)
T ss_pred             ccCcceeeecccceeecccchhhhhhcccccccchhhhhccchhhhheeecchhhhcccceeEeccccccccCChhHHHH
Confidence            7655 778889999999999888888777788899999999999998888888888999999999999999888888888


Q ss_pred             CccCceEEeCCCcCccCCcc-cccCCCCcEEECCCCCCc----ccCccCcCCCCCCEEeCCCCCCcccCCccccCCcccc
Q 014560          313 LPHLQELYLRRMQLREAPTD-ILRLQQLRILDLSQNSLQ----SIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQ  387 (422)
Q Consensus       313 ~~~L~~L~l~~~~i~~l~~~-~~~~~~L~~l~l~~n~l~----~l~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~  387 (422)
                      +..|++|+++.|.+..+.+. |.++++|++||++.|.+.    .-...|..+++|+.|++.||+++.|+.-.+..++.|+
T Consensus       340 L~~Le~LnLs~Nsi~~l~e~af~~lssL~~LdLr~N~ls~~IEDaa~~f~gl~~LrkL~l~gNqlk~I~krAfsgl~~LE  419 (873)
T KOG4194|consen  340 LSQLEELNLSHNSIDHLAEGAFVGLSSLHKLDLRSNELSWCIEDAAVAFNGLPSLRKLRLTGNQLKSIPKRAFSGLEALE  419 (873)
T ss_pred             HHHhhhhcccccchHHHHhhHHHHhhhhhhhcCcCCeEEEEEecchhhhccchhhhheeecCceeeecchhhhccCcccc
Confidence            89999999999988877655 567789999999999876    2244588889999999999999988888888889999


Q ss_pred             EEEccCCCCCccchHHHhh
Q 014560          388 ALRLDGNPLRSIRRTILDR  406 (422)
Q Consensus       388 ~l~l~~n~~~~i~~~~~~~  406 (422)
                      .||+.+|.+.+|.+.+|+.
T Consensus       420 ~LdL~~NaiaSIq~nAFe~  438 (873)
T KOG4194|consen  420 HLDLGDNAIASIQPNAFEP  438 (873)
T ss_pred             eecCCCCcceeeccccccc
Confidence            9999999999998888765

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 4e-09
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 8e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 2e-05
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 4e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 5e-05
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 6e-05
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 1e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 6e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-04
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 6e-05
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 9e-05
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 1e-04
2z63_A 570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 4e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 4e-04
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 4e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 5e-04
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 5e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 6e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 8e-04
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 9e-04
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure 
Iteration: 1

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 1/103 (0%)
Query: 4   LDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPS 63
           LD+   ++  +S N I  +  LT L  + N L  +P  I +LS L  LDL  NR+ S+P+
Sbjct: 229 LDLSNLQIFNISAN-IFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPA 287
Query: 64  SISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKE 106
            +  C  L  FY  +N ++ LP E G L  L  L +  N L++
Sbjct: 288 ELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEK 330
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-55
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-48
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-44
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-38
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-48
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-50
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-47
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-31
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-49
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-45
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-33
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-28
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-35
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-34
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-48
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-39
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-48
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-38
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-45
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-43
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-45
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-42
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-39
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-36
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-44
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-37
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-43
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-42
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-40
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-32
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-40
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-38
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-39
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-37
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-34
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-28
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-39
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-38
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-39
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-38
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-37
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-35
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-21
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-39
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-36
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-34
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-39
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-38
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-35
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-30
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-39
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-27
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-31
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-37
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-24
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-37
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-36
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-22
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-37
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-27
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-37
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-35
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-36
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-33
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-32
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-29
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-36
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-28
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-26
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-35
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-33
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 3e-27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-35
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-35
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-28
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-30
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-31
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-30
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-29
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-23
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-23
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-26
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 7e-26
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-16
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-26
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-25
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-25
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-24
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-23
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-20
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-24
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-15
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 4e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-21
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-19
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-18
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-18
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-18
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-16
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-13
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-13
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 6e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 5e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-04
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
 Score =  194 bits (494), Expect = 7e-55
 Identities = 78/450 (17%), Positives = 143/450 (31%), Gaps = 80/450 (17%)

Query: 3   KLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRIL-SI 61
            +    +  T  +  +                      +  +L  L  ++L+    +  +
Sbjct: 452 IIYFANSPFTYDNIAVDWEDANSDYA----KQYENEELSWSNLKDLTDVELYNCPNMTQL 507

Query: 62  PSSISGCCSLAEFYMGNNALS----------ALPAELGKLSKLGTLDLHSNQLKEYCVEA 111
           P  +     L    +  N              L  +     K+    +  N L+E+   A
Sbjct: 508 PDFLYDLPELQSLNIACNRGISAAQLKADWTRLADDEDTGPKIQIFYMGYNNLEEFPASA 567

Query: 112 --CQLR-LSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYL 168
              ++  L +LD  +N +  L    G    L  L L  N +  +               +
Sbjct: 568 SLQKMVKLGLLDCVHNKVRHLE-AFGTNVKLTDLKLDYNQIEEIPEDFCA-----FTDQV 621

Query: 169 RSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAG--EITKLDL 226
                                           L      L  IP+         +  +D 
Sbjct: 622 E------------------------------GLGFSHNKLKYIPNIFNAKSVYVMGSVDF 651

Query: 227 SRNSIQELPPELSS------CASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQ 280
           S N I      +S         +  T+ LS N+I+ +P  +  + S +S + L NN +  
Sbjct: 652 SYNKIGSEGRNISCSMDDYKGINASTVTLSYNEIQKFPTELFATGSPISTIILSNNLMTS 711

Query: 281 VPSDGFKDIP-------MLQILDLSYN-IASLPENPPFSSLPHLQELYLRRMQLREAPTD 332
           +P +  K          +L  +DL +N + SL ++   ++LP+L  + +        PT 
Sbjct: 712 IPENSLKPKDGNYKNTYLLTTIDLRFNKLTSLSDDFRATTLPYLSNMDVSYNCFSSFPTQ 771

Query: 333 ILRLQQLRILDLSQNS-------LQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPS 385
            L   QL+   +           L+  P G     SL +L +  N+I  +  +L    P 
Sbjct: 772 PLNSSQLKAFGIRHQRDAEGNRILRQWPTGITTCPSLIQLQIGSNDIRKVDEKLT---PQ 828

Query: 386 LQALRLDGNPLRSIRRTILDRGTKAVLKYL 415
           L  L +  NP  SI  T +    +A +  L
Sbjct: 829 LYILDIADNPNISIDVTSVCPYIEAGMYVL 858
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query422
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.74
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.7
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.02
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.76
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.65
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.5
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.09
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.62
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.56
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 90.79
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 89.92
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
Probab=100.00  E-value=9e-41  Score=326.93  Aligned_cols=351  Identities=23%  Similarity=0.343  Sum_probs=285.6

Q ss_pred             cceecChhHHhhcccccceecccccccC------------------Cchhhh--ccccCCeEeccCCccc-cCCCCCccC
Q 014560           10 KLTVLSNNLIASWTMLTELIASKNLLNG------------------MPETIG--SLSRLIRLDLHQNRIL-SIPSSISGC   68 (422)
Q Consensus        10 ~i~~i~~~~~~~~~~L~~L~l~~~~i~~------------------~~~~~~--~~~~L~~L~l~~~~~~-~l~~~~~~~   68 (422)
                      +++.||.. |.++++|++|++++|.++.                  +|..+.  ++++|++|++++|.+. .+|..+.++
T Consensus       194 ~l~~ip~~-l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~ip~~l~~~~l~~L~~L~L~~n~l~~~~p~~l~~l  272 (636)
T 4eco_A          194 NITFVSKA-VMRLTKLRQFYMGNSPFVAENICEAWENENSEYAQQYKTEDLKWDNLKDLTDVEVYNCPNLTKLPTFLKAL  272 (636)
T ss_dssp             EEEEECGG-GGGCTTCCEEEEESCCCCGGGBSSSCSCTTSHHHHHHTTSCCCGGGCTTCCEEEEECCTTCSSCCTTTTTC
T ss_pred             CCccCCHH-HhcccCCCEEECcCCccccccccccccccccchhcccCchhhhhcccCCCCEEEecCCcCCccChHHHhcC
Confidence            44556664 7788888888888888876                  777777  8888888888888755 567778888


Q ss_pred             CCCCEEEcCCCc-Cc--cCchhhhCC------CCCcEEEccCCccccccc--ccccce-ecEEEcCCCCCC-CCCccccc
Q 014560           69 CSLAEFYMGNNA-LS--ALPAELGKL------SKLGTLDLHSNQLKEYCV--EACQLR-LSVLDLSNNSLS-GLPPEIGK  135 (422)
Q Consensus        69 ~~L~~L~l~~~~-i~--~l~~~l~~~------~~L~~L~l~~~~~~~l~~--~~~~~~-L~~L~l~~~~~~-~~~~~~~~  135 (422)
                      ++|++|++++|. ++  .+|..+..+      ++|++|++++|.++.+|.  .+.... |+.|++++|.+. .+| .+..
T Consensus       273 ~~L~~L~Ls~n~~l~~~~lp~~~~~L~~~~~l~~L~~L~L~~n~l~~ip~~~~l~~l~~L~~L~L~~N~l~g~ip-~~~~  351 (636)
T 4eco_A          273 PEMQLINVACNRGISGEQLKDDWQALADAPVGEKIQIIYIGYNNLKTFPVETSLQKMKKLGMLECLYNQLEGKLP-AFGS  351 (636)
T ss_dssp             SSCCEEECTTCTTSCHHHHHHHHHHHHHSGGGGTCCEEECCSSCCSSCCCHHHHTTCTTCCEEECCSCCCEEECC-CCEE
T ss_pred             CCCCEEECcCCCCCccccchHHHHhhhccccCCCCCEEECCCCcCCccCchhhhccCCCCCEEeCcCCcCccchh-hhCC
Confidence            888888888887 76  377777665      788888888888887776  555554 888888888887 477 7778


Q ss_pred             cCCccEEEcCCCccccccccccCCCChHHHHHHHccCCCCccccccchhhhHHHhhhccccc-cceeeccCCCCCCCCcc
Q 014560          136 MTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVT-SKELSLEGMNLSAIPSE  214 (422)
Q Consensus       136 l~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-l~~l~l~~~~~~~~~~~  214 (422)
                      +++|+.|++++|.++.++....                                    .... ++.+++++|.+..+|..
T Consensus       352 l~~L~~L~L~~N~l~~lp~~l~------------------------------------~l~~~L~~L~Ls~N~l~~lp~~  395 (636)
T 4eco_A          352 EIKLASLNLAYNQITEIPANFC------------------------------------GFTEQVENLSFAHNKLKYIPNI  395 (636)
T ss_dssp             EEEESEEECCSSEEEECCTTSE------------------------------------EECTTCCEEECCSSCCSSCCSC
T ss_pred             CCCCCEEECCCCccccccHhhh------------------------------------hhcccCcEEEccCCcCcccchh
Confidence            8888888888887765543321                                    1245 89999999999999887


Q ss_pred             cccCC--CccEEeCCCCcccc-CCcccc-------CCCCCcEEEecCCcCCCCChHHHhcCCCCCEEECCCCCCCcCCCC
Q 014560          215 IWEAG--EITKLDLSRNSIQE-LPPELS-------SCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSD  284 (422)
Q Consensus       215 ~~~~~--~L~~L~l~~~~l~~-~~~~~~-------~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~  284 (422)
                      +...+  +|+.|++++|.+.. +|..+.       .+++|+.|++++|.+..++...+..+++|+.|++++|.+..++..
T Consensus       396 ~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~~~~~~~~~~~L~~L~Ls~N~l~~lp~~~~~~l~~L~~L~Ls~N~l~~i~~~  475 (636)
T 4eco_A          396 FDAKSVSVMSAIDFSYNEIGSVDGKNFDPLDPTPFKGINVSSINLSNNQISKFPKELFSTGSPLSSINLMGNMLTEIPKN  475 (636)
T ss_dssp             CCTTCSSCEEEEECCSSCTTTTTTCSSCTTCSSCCCCCCEEEEECCSSCCCSCCTHHHHTTCCCSEEECCSSCCSBCCSS
T ss_pred             hhhcccCccCEEECcCCcCCCcchhhhcccccccccCCCCCEEECcCCccCcCCHHHHccCCCCCEEECCCCCCCCcCHH
Confidence            76654  89999999999977 556676       778999999999999999998888899999999999999988877


Q ss_pred             CCCCCC-------CccEEEccCCcCCCCCCCCCC--CCccCceEEeCCCcCccCCcccccCCCCcEEECCC------CCC
Q 014560          285 GFKDIP-------MLQILDLSYNIASLPENPPFS--SLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQ------NSL  349 (422)
Q Consensus       285 ~~~~~~-------~L~~l~l~~~~~~~~~~~~~~--~~~~L~~L~l~~~~i~~l~~~~~~~~~L~~l~l~~------n~l  349 (422)
                      .+....       +|+.|++++|.++.. +..+.  .+++|+.|++++|.++.+|..+.++++|+.|++++      |.+
T Consensus       476 ~~~~~~~~~~~l~~L~~L~Ls~N~l~~l-p~~~~~~~l~~L~~L~Ls~N~l~~ip~~~~~l~~L~~L~Ls~N~~ls~N~l  554 (636)
T 4eco_A          476 SLKDENENFKNTYLLTSIDLRFNKLTKL-SDDFRATTLPYLVGIDLSYNSFSKFPTQPLNSSTLKGFGIRNQRDAQGNRT  554 (636)
T ss_dssp             SSEETTEECTTGGGCCEEECCSSCCCBC-CGGGSTTTCTTCCEEECCSSCCSSCCCGGGGCSSCCEEECCSCBCTTCCBC
T ss_pred             HhccccccccccCCccEEECcCCcCCcc-ChhhhhccCCCcCEEECCCCCCCCcChhhhcCCCCCEEECCCCcccccCcc
Confidence            665443       999999999999854 44454  89999999999999999999999999999999954      555


Q ss_pred             c-ccCccCcCCCCCCEEeCCCCCCcccCCccccCCccccEEEccCCCCCccchH
Q 014560          350 Q-SIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRT  402 (422)
Q Consensus       350 ~-~l~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~l~l~~n~~~~i~~~  402 (422)
                      . .+|..+.++++|+.|++++|.++.+|..+.   ++|++|++++|++.+++..
T Consensus       555 ~~~~p~~l~~l~~L~~L~Ls~N~l~~ip~~~~---~~L~~L~Ls~N~l~~~~~~  605 (636)
T 4eco_A          555 LREWPEGITLCPSLTQLQIGSNDIRKVNEKIT---PNISVLDIKDNPNISIDLS  605 (636)
T ss_dssp             CCCCCTTGGGCSSCCEEECCSSCCCBCCSCCC---TTCCEEECCSCTTCEEECT
T ss_pred             cccChHHHhcCCCCCEEECCCCcCCccCHhHh---CcCCEEECcCCCCccccHH
Confidence            4 679999999999999999999999998754   7999999999999887754
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 422
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-16
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-08
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2 227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 7e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 9e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 87.0 bits (214), Expect = 2e-19
 Identities = 74/354 (20%), Positives = 135/354 (38%), Gaps = 24/354 (6%)

Query: 25  LTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSAL 84
           +T L A +  +  + + +  L+ L +++   N++  I   +     L +  M NN ++ +
Sbjct: 46  VTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQIADI 103

Query: 85  PAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLL 144
                  +  G    ++       ++       +   SN     +              L
Sbjct: 104 TPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNT----ISDISALSGLTSLQQL 159

Query: 145 TGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTS------ 198
           +     T    L N  T   L    +++ +       T  E LI    ++S  +      
Sbjct: 160 SFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILT 219

Query: 199 --KELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKD 256
              ELSL G  L  I + +     +T LDL+ N I  L P LS    L  L L  N+I +
Sbjct: 220 NLDELSLNGNQLKDIGT-LASLTNLTDLDLANNQISNLAP-LSGLTKLTELKLGANQISN 277

Query: 257 WPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHL 316
                L  L++L+ L+L+ N           ++  L  L L +N  ++ +  P SSL  L
Sbjct: 278 ISP--LAGLTALTNLELNENQ--LEDISPISNLKNLTYLTLYFN--NISDISPVSSLTKL 331

Query: 317 QELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDN 370
           Q L+    ++ +  + +  L  +  L    N +  +     NLT +T+L L+D 
Sbjct: 332 QRLFFANNKVSD-VSSLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query422
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.97
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.8
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.97  E-value=3.6e-28  Score=222.16  Aligned_cols=354  Identities=21%  Similarity=0.267  Sum_probs=252.2

Q ss_pred             ccCCcceecChhHHhhcccccceecccccccCCchhhhccccCCeEeccCCccccCCCCCccCCCCCEEEcCCCcCccCc
Q 014560            6 VEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALP   85 (422)
Q Consensus         6 ls~~~i~~i~~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~~L~~L~l~~~~i~~l~   85 (422)
                      +..+.+++...  .+.+.+|++|+++++.|+.+ +.+..+++|++|++++|.++.+|+ +.++++|++|++++|.+..++
T Consensus        29 l~~~~~~~~~~--~~~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~i~~i~  104 (384)
T d2omza2          29 LGKTNVTDTVS--QTDLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQIADIT  104 (384)
T ss_dssp             TTCSSTTSEEC--HHHHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCCG
T ss_pred             hCCCCCCCccC--HHHhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccccccccc
Confidence            44455554222  45677899999999999887 467889999999999999998864 899999999999999999886


Q ss_pred             hhhhCCCCCcEEEccCCcccccccccccceecEEEcCCCCCCCCCcc-ccccCCccEEEcCCCccccccccccCCCChHH
Q 014560           86 AELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPE-IGKMTTLRKLLLTGNPLRTLRSSLVNGPTPAL  164 (422)
Q Consensus        86 ~~l~~~~~L~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~~~~~~~~-~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~  164 (422)
                      . +..+++|+.|+++++.++.+........+.......+.+...... ...................+.....       
T Consensus       105 ~-l~~l~~L~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------  176 (384)
T d2omza2         105 P-LANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTT-------  176 (384)
T ss_dssp             G-GTTCTTCCEEECCSSCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTT-------
T ss_pred             c-ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhccccc-------
Confidence            4 889999999999999888766655544455555544443332111 1111111111111111111000000       


Q ss_pred             HHHHHccCCCCccccccchhhhHHHhhhccccccceeeccCCCCCCCCcccccCCCccEEeCCCCccccCCccccCCCCC
Q 014560          165 LKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASL  244 (422)
Q Consensus       165 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~L  244 (422)
                               ..........  ............++.+.+.++.+..+++ ....++++++++++|.++.++ .+..+++|
T Consensus       177 ---------~~~~~~~~~~--~~~~~~~~~l~~~~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L  243 (384)
T d2omza2         177 ---------LERLDISSNK--VSDISVLAKLTNLESLIATNNQISDITP-LGILTNLDELSLNGNQLKDIG-TLASLTNL  243 (384)
T ss_dssp             ---------CCEEECCSSC--CCCCGGGGGCTTCSEEECCSSCCCCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTC
T ss_pred             ---------cccccccccc--cccccccccccccceeeccCCccCCCCc-ccccCCCCEEECCCCCCCCcc-hhhccccc
Confidence                     0000000000  0000111223467788888887776654 355678999999999988765 57888999


Q ss_pred             cEEEecCCcCCCCChHHHhcCCCCCEEECCCCCCCcCCCCCCCCCCCccEEEccCCcCCCCCCCCCCCCccCceEEeCCC
Q 014560          245 QTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRM  324 (422)
Q Consensus       245 ~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~  324 (422)
                      +.+++++|.+.+.++  +..+++|+.++++.+.+..+++  +..++.++.+.+.++.+.+..  .+..+++++.+++++|
T Consensus       244 ~~L~l~~n~l~~~~~--~~~~~~L~~L~l~~~~l~~~~~--~~~~~~l~~l~~~~n~l~~~~--~~~~~~~l~~L~ls~n  317 (384)
T d2omza2         244 TDLDLANNQISNLAP--LSGLTKLTELKLGANQISNISP--LAGLTALTNLELNENQLEDIS--PISNLKNLTYLTLYFN  317 (384)
T ss_dssp             SEEECCSSCCCCCGG--GTTCTTCSEEECCSSCCCCCGG--GTTCTTCSEEECCSSCCSCCG--GGGGCTTCSEEECCSS
T ss_pred             chhccccCccCCCCc--ccccccCCEeeccCcccCCCCc--ccccccccccccccccccccc--ccchhcccCeEECCCC
Confidence            999999998887764  6788999999999988887754  778889999999998887643  3778889999999999


Q ss_pred             cCccCCcccccCCCCcEEECCCCCCcccCccCcCCCCCCEEeCCCCCCcccCCccccCCccccEEEccCC
Q 014560          325 QLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGN  394 (422)
Q Consensus       325 ~i~~l~~~~~~~~~L~~l~l~~n~l~~l~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~l~l~~n  394 (422)
                      .++.++. +..+++|+.|++++|.++.++ .+.++++|++|++++|+++.++. +..+ ++|+.|++++|
T Consensus       318 ~l~~l~~-l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~l~~l~~-l~~l-~~L~~L~L~~N  383 (384)
T d2omza2         318 NISDISP-VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP-LANL-TRITQLGLNDQ  383 (384)
T ss_dssp             CCSCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSCCCBCGG-GTTC-TTCSEEECCCE
T ss_pred             CCCCCcc-cccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCcCCCChh-hccC-CCCCEeeCCCC
Confidence            9998753 778999999999999999876 58889999999999999998764 5555 89999999987
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure