Citrus Sinensis ID: 014792

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MNDCNPESYKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSGSFVRVHNLSPGISLPEALRVRYRGESSKEEEDEMYVLSASNKHVSIELVGKDKIQDKFSKFEELTSAALPYLGVSSPGANIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSISEITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIHELVSAHESHEESYLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIRLSENPVSDPGRGGISRFAIIARLGKIKILNGSEVNS
cccccccccccccEEEEcccccEEEEEEEEEEcccccccEEEEEEcccccccccEEccEEEEEcccccccccEEEcccccccccHHHHHHHHccccccccHHHHHHHHcccccEEEEccccccHHHHHcccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHcccccccEEEccccccccccccccccccccEEEcccccccHHHHHHHHcccccccEEEccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccHHHHHHcccccEEcccccccccccccccccccccccEEEccccccccccccccHHHHHHHccccccEEccccccc
cccccccccEccEEEEEcccccEEEEEEEEEccccccccEEEEEEccccccEccEEccEEccccccccEEcEEccccccccccHHHHHHHHcccccccccccccEEEEEccccEEEEEEcHHHHHHHHHHHHcccEEEEcccccccccHHHHHHccccEEEEccHcHHccHHHHHHHHHHcccccEEEcccccccccccccccccccEEEEEccccccHHHHHHHHHHcccHHHEEccccccccccccccccccccccEEEEEccccccccHHHHHHHcccccHHEEEEccccccEEEccccccHHHcccccccccccccccccccEEEcccccccccccccccccccccccccEEEccccccccHHHHHHHHHcccccEEEEccccccccccccHHHHEEEEEccccEEEcccEEcc
mndcnpesyklgqrvhsandarriGTVKYVGEVQgysgtwlgvdwdygngkhdgsingVRYFQAksqksgsfvrvhnlspgislpeALRVryrgesskeeedEMYVLSASNKHVSIELVGKDKIQDKFSKFEEltsaalpylgvsspganigTIVTNLKeldltgnllsdWKDIGAFGEQLPALAVLNLSNnlmskevtglpqlkSIRILVLNCTGVNWMQVEILKHSLPALEELHLmgnsiseitpvsspivqgfdnlqllnledNCIAEWSEILKLCQIRSLEQLYLNknnlnriyypnndTIHELVSAhesheesylpFQNLCCLllgnskklptsshVSFVVYFLIFAFSLhasgnnmiedlasidsldsfpklmdirlsenpvsdpgrggiSRFAIIARLGKIKilngsevns
mndcnpesyklgqrvhsandarriGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSGsfvrvhnlspgislpealrVRYRGEsskeeedemYVLSASNKHVSIELVGKDKIQDKFSKFEELTSaalpylgvsspgaNIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSISEITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIHELVSAHESHEESYLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIRLsenpvsdpgrggISRFAIIARLGkikilngsevns
MNDCNPESYKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSGSFVRVHNLSPGISLPEALRVRYRGESSKEEEDEMYVLSASNKHVSIELVGKDKIQDKFSKFEELTSAALPYLGVSSPGANIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSISEITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIHELVSAHESHEESYLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIRLSENPVSDPGRGGISRFAIIARLGKIKILNGSEVNS
********************ARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAK*****SFVRVHNLS**I*****************************KHVSIELVGKDKIQDKFSKFEELTSAALPYLGVSSPGANIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSISEITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIHELVSAHESHEESYLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIR***********GGISRFAIIARLGKIKIL*******
******E***LGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSGSFVRVHNLSPGISLPEALRVRYRGESS******************IELVGKDKIQDKFSKFEELTSAALPYLGVSSPGANIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSISEITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIHELVSAHESHEESYLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIRLSENPVSDPGRGGISRFAIIARLGKIKILNGSEVN*
**********LGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSGSFVRVHNLSPGISLPEALRVRY*************VLSASNKHVSIELVGKDKIQDKFSKFEELTSAALPYLGVSSPGANIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSISEITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIHELVS********YLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIRLSENPVSDPGRGGISRFAIIARLGKIKILNGSEVNS
*****PESYKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSGSFVRVHNLSPGISLPEALRVRYRGESSKEEEDEMYVLSASNKHVSIELVGKDKIQDKFSKFEELTSAALPYLGVSSPGANIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSISEITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIH*L*******E*SYLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIRLSENPVSDPGRGGISRFAIIARLGKIKILNGSEV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDCNPESYKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSGSFVRVHNLSPGISLPEALRVRYRGESSKEEEDEMYVLSASNKHVSIELVGKDKIQDKFSKFEELTSAALPYLGVSSPGANIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSISEITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIHELVSAHESHEESYLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIRLSENPVSDPGRGGISRFAIIARLGKIKILNGSEVNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query418 2.2.26 [Sep-21-2011]
Q5RBD9 527 Tubulin-specific chaperon yes no 0.851 0.675 0.282 4e-35
Q5FVQ9 524 Tubulin-specific chaperon yes no 0.849 0.677 0.281 4e-34
Q15813 527 Tubulin-specific chaperon yes no 0.851 0.675 0.272 9e-34
Q5U508 522 Tubulin-specific chaperon N/A no 0.849 0.680 0.288 2e-32
Q5U378 521 Tubulin-specific chaperon yes no 0.849 0.681 0.291 1e-31
Q8CIV8 524 Tubulin-specific chaperon yes no 0.849 0.677 0.274 1e-31
Q32KS0 528 Tubulin-specific chaperon yes no 0.851 0.674 0.272 4e-31
Q55CN0525 Tubulin-specific chaperon yes no 0.830 0.660 0.255 4e-22
Q5PQJ7 424 Tubulin-specific chaperon no no 0.547 0.540 0.327 3e-20
Q5QJ74 424 Tubulin-specific chaperon no no 0.547 0.540 0.327 3e-20
>sp|Q5RBD9|TBCE_PONAB Tubulin-specific chaperone E OS=Pongo abelii GN=TBCE PE=2 SV=1 Back     alignment and function desciption
 Score =  149 bits (376), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 117/414 (28%), Positives = 197/414 (47%), Gaps = 58/414 (14%)

Query: 11  LGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYG-NGKHDGSINGVRYFQAKSQKS 69
           +GQRV    +     TV++ G V   +G WLGV+WD    GKHDGS  G  YFQ +    
Sbjct: 10  IGQRVEVNGEH---ATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFQCRHPTG 66

Query: 70  GSFVRVHNLSPGISLPEALRVRYRGESSKEEEDEMYVLSASNKHVSIELVGKDKIQDKFS 129
           GSF+R + ++ G     A++ RY  E   EE+ +  +++  NK V  E +G D I  + S
Sbjct: 67  GSFIRPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPV--ETIGFDSIMKQQS 124

Query: 130 KFEELTSAALPYLGVSSPGANIGTI--VTNLKELDLTGNLLSDWKDIGAFGEQLPALAVL 187
           +  +L   +L    VS  G   G      N++++DL+ NLLS W ++    +QL  L VL
Sbjct: 125 QLSKLQEVSLRNCAVSCAGEKGGVAEGCPNIRKVDLSKNLLSSWDEVIHIADQLRHLEVL 184

Query: 188 NLSNNLMS----KEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSIS 243
           N+S N +       +TG   L ++++LVLN TG+ W +V       P LEEL+L  N+I 
Sbjct: 185 NVSENKLKFPSGSVLTG--TLSALKVLVLNQTGITWAEVLRCAMGCPGLEELYLESNNIF 242

Query: 244 EITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNND 303
            I+   + ++Q    ++LL+L  N + + +++  +  +  LEQL L+   ++ +++P+  
Sbjct: 243 -ISERPTDVLQ---TVKLLDLSSNQLIDENQLYLIAHLPRLEQLILSDIGISSLHFPD-- 296

Query: 304 TIHELVSAHESHEESYLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMI 363
                                + C           +S    + Y ++         +N I
Sbjct: 297 -------------------AGIGC----------KTSLFPSLKYLVV--------NDNQI 319

Query: 364 EDLASIDSLDSFPKLMDIRLSENPVSDPGR-GGISRFAIIARLGKIKILNGSEV 416
              +  + LD  P L  +    NP++   +    +R  IIA +G++K LN  E+
Sbjct: 320 SQWSFFNELDKLPSLRALSCLRNPLTKEDKEAETARLLIIASIGQLKTLNKCEI 373
Tubulin-folding protein; involved in the second step of the tubulin folding pathway. Seems to be implicated in the maintenance of the neuronal microtubule network. Involved in regulation of tubulin heterodimer dissociation.
Pongo abelii (taxid: 9601)
>sp|Q5FVQ9|TBCE_RAT Tubulin-specific chaperone E OS=Rattus norvegicus GN=Tbce PE=2 SV=1 Back     alignment and function description
>sp|Q15813|TBCE_HUMAN Tubulin-specific chaperone E OS=Homo sapiens GN=TBCE PE=1 SV=1 Back     alignment and function description
>sp|Q5U508|TBCE_XENLA Tubulin-specific chaperone E OS=Xenopus laevis GN=tbce PE=2 SV=1 Back     alignment and function description
>sp|Q5U378|TBCE_DANRE Tubulin-specific chaperone E OS=Danio rerio GN=tbce PE=2 SV=2 Back     alignment and function description
>sp|Q8CIV8|TBCE_MOUSE Tubulin-specific chaperone E OS=Mus musculus GN=Tbce PE=1 SV=1 Back     alignment and function description
>sp|Q32KS0|TBCE_BOVIN Tubulin-specific chaperone E OS=Bos taurus GN=TBCE PE=2 SV=1 Back     alignment and function description
>sp|Q55CN0|TBCE_DICDI Tubulin-specific chaperone E OS=Dictyostelium discoideum GN=tbce PE=3 SV=1 Back     alignment and function description
>sp|Q5PQJ7|TBCEL_RAT Tubulin-specific chaperone cofactor E-like protein OS=Rattus norvegicus GN=Tbcel PE=2 SV=1 Back     alignment and function description
>sp|Q5QJ74|TBCEL_HUMAN Tubulin-specific chaperone cofactor E-like protein OS=Homo sapiens GN=TBCEL PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query418
255569100 533 tubulin-specific chaperone E, putative [ 0.911 0.714 0.668 1e-154
224146265 537 tubulin folding cofactor [Populus tricho 0.916 0.713 0.646 1e-150
225460123 541 PREDICTED: tubulin-specific chaperone E 0.921 0.711 0.643 1e-145
147812666 601 hypothetical protein VITISV_016688 [Viti 0.921 0.640 0.611 1e-141
449442769500 PREDICTED: tubulin-specific chaperone E- 0.909 0.76 0.620 1e-134
449476178 538 PREDICTED: tubulin-specific chaperone E- 0.906 0.704 0.621 1e-134
356532986 533 PREDICTED: tubulin-specific chaperone E- 0.894 0.701 0.595 1e-132
297841911 531 hypothetical protein ARALYDRAFT_476275 [ 0.899 0.708 0.587 1e-131
18409854 531 tubulin folding cofactor E / Pfifferling 0.899 0.708 0.590 1e-128
356558041 547 PREDICTED: LOW QUALITY PROTEIN: tubulin- 0.894 0.683 0.570 1e-127
>gi|255569100|ref|XP_002525519.1| tubulin-specific chaperone E, putative [Ricinus communis] gi|223535198|gb|EEF36877.1| tubulin-specific chaperone E, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 276/413 (66%), Positives = 326/413 (78%), Gaps = 32/413 (7%)

Query: 7   ESYKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKS 66
           E +KLGQRVHSA+D RRIG VKY+G V+GYSGTW+GVDWD G GKHDGS+NGVRYFQA+S
Sbjct: 5   EPFKLGQRVHSASDPRRIGMVKYIGPVEGYSGTWVGVDWDNGEGKHDGSVNGVRYFQARS 64

Query: 67  QKSGSFVRVHNLSPGISLPEALRVRYRGESSKEEEDEMYVLSASNKHVSIELVGKDKIQD 126
            KSGSF+RV NL+PGISL EAL +RY+GES+KEEEDEMYVLSASNK VS+E VGK+KI+D
Sbjct: 65  DKSGSFIRVPNLNPGISLVEALHIRYKGESTKEEEDEMYVLSASNKKVSVEFVGKEKIKD 124

Query: 127 KFSKFEELTSAALPYLGVSSPGA--NIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPAL 184
           K SKF+EL SA+LP+LG+SSPG+  +I  +V NLKELDLTGNLLS+WKDIG   EQLPAL
Sbjct: 125 KLSKFDELKSASLPFLGISSPGSPTDIRNLVPNLKELDLTGNLLSEWKDIGTICEQLPAL 184

Query: 185 AVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSISE 244
           A LNLSNNLMS+ +  L QLK+I ILVLN TG+NW QVE+L H LPA+EELHLMGN I  
Sbjct: 185 AALNLSNNLMSRTIAELSQLKNIHILVLNNTGINWTQVEVLNHLLPAIEELHLMGNGIGT 244

Query: 245 ITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDT 304
           I   SS IVQGFD+L+LLNLEDN IAEW+EILKL  +RSLEQLYLNKN L RI+YP+ DT
Sbjct: 245 IMSSSSSIVQGFDSLRLLNLEDNFIAEWNEILKLSSLRSLEQLYLNKNRLKRIFYPDADT 304

Query: 305 IHELVSAHESHEESYLPFQNLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIE 364
           I +L++  ES+ E  +PFQNL CLLL                            G N IE
Sbjct: 305 IDKLLTGSESNVE--IPFQNLRCLLL----------------------------GGNRIE 334

Query: 365 DLASIDSLDSFPKLMDIRLSENPVSDPGRGGISRFAIIARLGKIKILNGSEVN 417
           DLAS+DSL+SFP+L+D+RLSENP++D GRGGI RF +IARL K++ILNGSEV 
Sbjct: 335 DLASVDSLNSFPRLVDVRLSENPIADTGRGGIPRFVLIARLSKVEILNGSEVT 387

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224146265|ref|XP_002325942.1| tubulin folding cofactor [Populus trichocarpa] gi|222862817|gb|EEF00324.1| tubulin folding cofactor [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225460123|ref|XP_002275735.1| PREDICTED: tubulin-specific chaperone E [Vitis vinifera] gi|297741006|emb|CBI31318.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147812666|emb|CAN61855.1| hypothetical protein VITISV_016688 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442769|ref|XP_004139153.1| PREDICTED: tubulin-specific chaperone E-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449476178|ref|XP_004154663.1| PREDICTED: tubulin-specific chaperone E-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356532986|ref|XP_003535050.1| PREDICTED: tubulin-specific chaperone E-like [Glycine max] Back     alignment and taxonomy information
>gi|297841911|ref|XP_002888837.1| hypothetical protein ARALYDRAFT_476275 [Arabidopsis lyrata subsp. lyrata] gi|297334678|gb|EFH65096.1| hypothetical protein ARALYDRAFT_476275 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18409854|ref|NP_565017.1| tubulin folding cofactor E / Pfifferling (PFI) [Arabidopsis thaliana] gi|26452683|dbj|BAC43424.1| unknown protein [Arabidopsis thaliana] gi|27311595|gb|AAO00763.1| Unknown protein [Arabidopsis thaliana] gi|31711942|gb|AAP68327.1| At1g71440 [Arabidopsis thaliana] gi|332197080|gb|AEE35201.1| tubulin folding cofactor E / Pfifferling (PFI) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356558041|ref|XP_003547317.1| PREDICTED: LOW QUALITY PROTEIN: tubulin-specific chaperone E-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query418
TAIR|locus:2825339 531 PFI "AT1G71440" [Arabidopsis t 0.758 0.596 0.634 1e-124
FB|FBgn0033055 542 tbce "tubulin-specific chapero 0.700 0.540 0.327 1.7e-36
UNIPROTKB|Q32KS0 528 TBCE "Tubulin-specific chapero 0.672 0.532 0.338 3.1e-35
ZFIN|ZDB-GENE-051030-120 521 tbce "tubulin folding cofactor 0.849 0.681 0.327 3.1e-35
UNIPROTKB|Q5RBD9 527 TBCE "Tubulin-specific chapero 0.669 0.531 0.328 3.1e-35
UNIPROTKB|F1NVX8 526 TBCE "Uncharacterized protein" 0.677 0.538 0.306 5.1e-35
UNIPROTKB|Q15813 527 TBCE "Tubulin-specific chapero 0.669 0.531 0.318 2.2e-34
UNIPROTKB|Q5U508 522 tbce "Tubulin-specific chapero 0.643 0.515 0.333 4.6e-34
RGD|1305533 524 Tbce "tubulin folding cofactor 0.696 0.555 0.325 4.2e-33
MGI|MGI:1917680 524 Tbce "tubulin-specific chapero 0.696 0.555 0.322 2.2e-32
TAIR|locus:2825339 PFI "AT1G71440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1038 (370.5 bits), Expect = 1.0e-124, Sum P(2) = 1.0e-124
 Identities = 208/328 (63%), Positives = 259/328 (78%)

Query:     7 ESYKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDY-GNGKHDGSINGVRYFQAK 65
             ES+ +GQRVHS ND+RR+GTVKYVG+V+GYSGTW+GVDWD  G+GKH+GS+NGV YF  +
Sbjct:     8 ESFIIGQRVHSLNDSRRVGTVKYVGDVEGYSGTWIGVDWDQDGDGKHNGSVNGVFYFNGR 67

Query:    66 SQKSGSFVRVHNLSPGISLPEALRVRYRGESSKEEEDEMYVLSASNKHVSIELVGKDKIQ 125
             SQ S SFVR  NLS GI+L +AL +RYR  S+K+EEDEMYVLSA N+ VSI+L+G DKIQ
Sbjct:    68 SQSSASFVRSQNLSRGITLLQALELRYRTISTKDEEDEMYVLSAGNRRVSIQLLGGDKIQ 127

Query:   126 DKFSKFEELTSAALPYLGVSSPG--ANIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPA 183
             DK S+FEELTSA+L YLGVSS G  +++G+I+ NLK LDLTGNL+SDW++IGA  EQLPA
Sbjct:   128 DKLSRFEELTSASLSYLGVSSLGVSSDLGSILPNLKLLDLTGNLISDWEEIGALCEQLPA 187

Query:   184 LAVLNLSNNLMSKEVTGLPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSIS 243
             L  LNLS N +S ++  LPQLK+IR+LVLN +G++W QVEIL+ SLP +EELHLMGN IS
Sbjct:   188 LTTLNLSCNSLSSDIKSLPQLKNIRVLVLNNSGLSWTQVEILRRSLPGIEELHLMGNMIS 247

Query:   244 EITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNND 303
              IT  SS   Q F++L+LLNL+DNCI++WSE+LKL Q+  LEQLYLNKN L+RI+   N 
Sbjct:   248 TITSTSSSDDQAFNSLRLLNLDDNCISDWSEVLKLSQLPCLEQLYLNKNKLSRIFQSVNG 307

Query:   304 TIHELVSAHESHEESYLPFQNLCCLLLG 331
             T        ES E+   PF +L CLLLG
Sbjct:   308 T--------ESSEKGSDPFPSLSCLLLG 327
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP
GO:0000910 "cytokinesis" evidence=IGI
GO:0007021 "tubulin complex assembly" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
FB|FBgn0033055 tbce "tubulin-specific chaperone E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q32KS0 TBCE "Tubulin-specific chaperone E" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051030-120 tbce "tubulin folding cofactor E" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RBD9 TBCE "Tubulin-specific chaperone E" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVX8 TBCE "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q15813 TBCE "Tubulin-specific chaperone E" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5U508 tbce "Tubulin-specific chaperone E" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
RGD|1305533 Tbce "tubulin folding cofactor E" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1917680 Tbce "tubulin-specific chaperone E" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query418
pfam0130267 pfam01302, CAP_GLY, CAP-Gly domain 1e-24
smart0105268 smart01052, CAP_GLY, Cytoskeleton-associated prote 6e-22
COG5244 669 COG5244, NIP100, Dynactin complex subunit involved 4e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
>gnl|CDD|216424 pfam01302, CAP_GLY, CAP-Gly domain Back     alignment and domain information 
 Score = 95.7 bits (239), Expect = 1e-24
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 11 LGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSG 70
          +G RV      RR GTV+YVG V    G W+GV+ D   GK+DGS++GVRYF+    K G
Sbjct: 1  VGDRVEVLGGGRR-GTVRYVGPVPFAPGLWVGVELDEPRGKNDGSVDGVRYFECP-PKYG 58

Query: 71 SFVRVHNLS 79
           FVR   + 
Sbjct: 59 IFVRPSKVE 67

Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved motif, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of Caenorhabditis elegans F53F4.3 protein CAP-Gly domain was recently solved. The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove. Length = 67
>gnl|CDD|214997 smart01052, CAP_GLY, Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network Back     alignment and domain information
>gnl|CDD|227569 COG5244, NIP100, Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 418
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 100.0
KOG2982 418 consensus Uncharacterized conserved protein [Funct 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.86
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
PF0130269 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytos 99.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.71
KOG3206234 consensus Alpha-tubulin folding cofactor B [Posttr 99.7
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.69
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.64
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.63
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.62
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
COG5244 669 NIP100 Dynactin complex subunit involved in mitoti 99.47
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.42
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.38
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.37
KOG0971 1243 consensus Microtubule-associated protein dynactin 99.31
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.3
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.3
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.29
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.25
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.14
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 99.1
KOG4568 664 consensus Cytoskeleton-associated protein and rela 99.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.96
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.88
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.87
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.87
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.68
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.68
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
PLN03150623 hypothetical protein; Provisional 98.58
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.56
KOG2123 388 consensus Uncharacterized conserved protein [Funct 98.56
PLN03150623 hypothetical protein; Provisional 98.56
KOG4341483 consensus F-box protein containing LRR [General fu 98.5
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.47
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.34
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.23
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 98.23
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.2
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.16
KOG4341483 consensus F-box protein containing LRR [General fu 98.15
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.14
KOG4568 664 consensus Cytoskeleton-associated protein and rela 98.14
KOG3556724 consensus Familial cylindromatosis protein [Genera 98.09
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.91
KOG02411714 consensus Kinesin-like protein [Cytoskeleton] 97.8
PRK15386 426 type III secretion protein GogB; Provisional 97.7
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.44
PRK15386 426 type III secretion protein GogB; Provisional 97.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.89
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 96.77
KOG4308478 consensus LRR-containing protein [Function unknown 96.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.03
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.95
KOG4308 478 consensus LRR-containing protein [Function unknown 95.6
PRK1070862 hypothetical protein; Provisional 94.96
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 94.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.61
PTZ00243 1560 ABC transporter; Provisional 93.08
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 92.72
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.39
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.6
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.87
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.75
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.56
KOG0473 326 consensus Leucine-rich repeat protein [Function un 87.54
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.42
smart0037026 LRR Leucine-rich repeats, outliers. 84.42
PF0992653 DUF2158: Uncharacterized small protein (DUF2158); 84.2
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=7.5e-56  Score=406.99  Aligned_cols=361  Identities=31%  Similarity=0.528  Sum_probs=314.4

Q ss_pred             CCCCCCEEEeCCCCceeeEEEEEeecCCCCceEEEEEEeCCC-CCCCCEECCEEeeecCCCCccccccccccCCCCcchh
Q 014792            8 SYKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGN-GKHDGSINGVRYFQAKSQKSGSFVRVHNLSPGISLPE   86 (418)
Q Consensus         8 ~~~~g~rv~~~~~~~~~gtvr~~g~~~~~~~~w~gve~d~~~-gk~~g~~~g~~yf~~~~~~~~sf~~~~~l~~~~s~~~   86 (418)
                      .+.||+||.+.|   .+|||||+|.|+|+++.|+|||||||+ |||+|.+.|++||++++|+.|||+|+.++..+.++..
T Consensus         2 ~~~IG~RvkI~~---~~~Tvr~iG~V~g~~~~w~GvEWDd~~RGKH~G~vdgk~YF~~q~P~GGSFik~~kV~~p~d~~~   78 (505)
T KOG3207|consen    2 TMEIGTRVKIGG---EIATVRYIGEVEGNNSKWYGVEWDDPVRGKHDGIVDGKRYFQTQHPNGGSFIKPGKVKFPTDLLR   78 (505)
T ss_pred             ceeccceEEEcC---EEEEEEEEEEEcCCCCcceeeEecCCCccccCceecceeeeeeecCCCccccCCccCCCCccHHH
Confidence            578999999976   789999999999999999999999999 9999999999999999999999999999999999999


Q ss_pred             HHhhhccCCCCcccccceEEEeeCCCceEEEEechhhHHHHHhcccccceecccCcCcCCCCC-chhhhcCCccEEEcCC
Q 014792           87 ALRVRYRGESSKEEEDEMYVLSASNKHVSIELVGKDKIQDKFSKFEELTSAALPYLGVSSPGA-NIGTIVTNLKELDLTG  165 (418)
Q Consensus        87 ~l~~~y~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~l~~~~~~l~~L~~L~L~~~~i~~~~~-~~~~~~~~L~~L~Ls~  165 (418)
                      +++++|......+.+. ....+.+++.  ++++|++++....+++++|+++.|.++.+..++. ...+.|++++.|||+.
T Consensus        79 t~~ery~e~~s~~sd~-~~~~si~nK~--vE~iGfDki~akQsn~kkL~~IsLdn~~V~~~~~~~~~k~~~~v~~LdLS~  155 (505)
T KOG3207|consen   79 TFKERYYEKYSYSSDL-ESVLSISNKQ--VEFIGFDKIAAKQSNLKKLREISLDNYRVEDAGIEEYSKILPNVRDLDLSR  155 (505)
T ss_pred             HHHHHHHHhhcCCcch-hhHhhhcCce--eEEecHHHHHHHhhhHHhhhheeecCccccccchhhhhhhCCcceeecchh
Confidence            9999998875544433 3334555665  8999999999999999999999999999988875 4566679999999999


Q ss_pred             CCCCChHHHHHHhhcCCCCCEEEcCCCCCCCccCC--CCCCCCccEEEecCCCCCHHHHHHHHhcCCcccEEEccCCCCC
Q 014792          166 NLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTG--LPQLKSIRILVLNCTGVNWMQVEILKHSLPALEELHLMGNSIS  243 (418)
Q Consensus       166 n~l~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~--l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~  243 (418)
                      |.+..|..+.+++.+||+|+.|+|+.|++.....+  -..++.|+.|.++.|.++|.++...+..+|+|+.|+|..|...
T Consensus       156 NL~~nw~~v~~i~eqLp~Le~LNls~Nrl~~~~~s~~~~~l~~lK~L~l~~CGls~k~V~~~~~~fPsl~~L~L~~N~~~  235 (505)
T KOG3207|consen  156 NLFHNWFPVLKIAEQLPSLENLNLSSNRLSNFISSNTTLLLSHLKQLVLNSCGLSWKDVQWILLTFPSLEVLYLEANEII  235 (505)
T ss_pred             hhHHhHHHHHHHHHhcccchhcccccccccCCccccchhhhhhhheEEeccCCCCHHHHHHHHHhCCcHHHhhhhccccc
Confidence            99999999999999999999999999998865553  3367899999999999999999999999999999999999522


Q ss_pred             ccCCCCCCccCCCCCccEEeCCCCCCCChhhhhhcCCCCCCCEEecCCCCCCcccCCCCCchhhhhccccccCccccCCC
Q 014792          244 EITPVSSPIVQGFDNLQLLNLEDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIHELVSAHESHEESYLPFQ  323 (418)
Q Consensus       244 ~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~l~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  323 (418)
                      .+...   ....+..|+.|||++|.+.+.+.....+.++.|+.|+++.+.|..+..++...           .+....++
T Consensus       236 ~~~~~---~~~i~~~L~~LdLs~N~li~~~~~~~~~~l~~L~~Lnls~tgi~si~~~d~~s-----------~~kt~~f~  301 (505)
T KOG3207|consen  236 LIKAT---STKILQTLQELDLSNNNLIDFDQGYKVGTLPGLNQLNLSSTGIASIAEPDVES-----------LDKTHTFP  301 (505)
T ss_pred             ceecc---hhhhhhHHhhccccCCcccccccccccccccchhhhhccccCcchhcCCCccc-----------hhhhcccc
Confidence            22111   24456899999999999999887677889999999999999999886665421           12246789


Q ss_pred             CCcEEEccCCCCCCCCCccchhhhhhhhhhhccCCCCCCcCCCcccccccCCCCCceEEcCCCCCCCCCCcchhHHHHHH
Q 014792          324 NLCCLLLGNSKKLPTSSHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIRLSENPVSDPGRGGISRFAIIA  403 (418)
Q Consensus       324 ~L~~L~L~~n~~i~~~~~~~~l~~~~~~l~~l~~~~~n~i~~~~~~~~l~~~~~L~~L~l~~N~l~~~~~~~~~~~~~i~  403 (418)
                      +|+.|+++                            .|.|.+|+++..+..+++|+.|.+..|++..+..  .+...+||
T Consensus       302 kL~~L~i~----------------------------~N~I~~w~sl~~l~~l~nlk~l~~~~n~ln~e~~--~a~~~VIA  351 (505)
T KOG3207|consen  302 KLEYLNIS----------------------------ENNIRDWRSLNHLRTLENLKHLRITLNYLNKETD--TAKLLVIA  351 (505)
T ss_pred             cceeeecc----------------------------cCccccccccchhhccchhhhhhccccccccccc--ceeEEeee
Confidence            99999999                            9999999999999999999999999999987652  66777899


Q ss_pred             hhCCceeecCcccCC
Q 014792          404 RLGKIKILNGSEVNS  418 (418)
Q Consensus       404 ~l~~L~~Ln~s~i~~  418 (418)
                      ++++|..||...|.|
T Consensus       352 r~~~l~~LN~~di~p  366 (505)
T KOG3207|consen  352 RISQLVKLNDVDISP  366 (505)
T ss_pred             ehhhhhhhcccccCh
Confidence            999999999998875

>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF01302 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytoskeleton-associated proteins (CAP) are made of three distinct parts, an N-terminal section that is most probably globular and contains the CAP-Gly domain, a large central region predicted to be in an alpha-helical coiled-coil conformation and, finally, a short C-terminal globular domain Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>COG5244 NIP100 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4568 consensus Cytoskeleton-associated protein and related proteins [Cytoskeleton; General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4568 consensus Cytoskeleton-associated protein and related proteins [Cytoskeleton; General function prediction only] Back     alignment and domain information
>KOG3556 consensus Familial cylindromatosis protein [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0241 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF09926 DUF2158: Uncharacterized small protein (DUF2158); InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query418
1whg_A113 Solution Structure Of The Cap-Gly Domain In Mouse T 4e-08
2cp0_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 9e-08
2cp5_A141 Solution Structure Of The 1st Cap-Gly Domain In Hum 2e-07
2cp7_A84 Solution Structure Of The 1st Cap-Gly Domain In Mou 2e-07
1tov_A98 Structural Genomics Of Caenorhabditis Elegans: Cap- 3e-07
1lpl_A95 Structural Genomics Of Caenorhabditis Elegans: Cap- 3e-07
2cp3_A84 Solution Structure Of The 2nd Cap-Gly Domain In Hum 7e-07
3rdv_A72 Structure Of The Slain2c-Clipcg1 Complex Length = 7 8e-07
2e3i_A86 Crystal Structure Of The Clip-170 Cap-Gly Domain 1 8e-07
2e4h_A98 Solution Structure Of Cytoskeletal Protein In Compl 1e-06
2e3h_A90 Crystal Structure Of The Clip-170 Cap-Gly Domain 2 1e-06
2cp6_A172 Solution Structure Of The 2nd Cap-Gly Domain In Hum 1e-06
2qk0_A74 Structural Basis Of Microtubule Plus End Tracking B 2e-06
2cow_A100 Solution Structure Of The Cap-Gly Domain In Human K 4e-06
2cp2_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 5e-06
1txq_A93 Crystal Structure Of The Eb1 C-Terminal Domain Comp 8e-06
2hkn_A97 Crystal Structure Of The Cap-Gly Domain Of Human Dy 8e-06
2coy_A112 Solution Structure Of The Cap-Gly Domain In Human D 9e-06
3tq7_P71 Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Do 1e-05
2hl3_A97 Crystal Structure Of The A49m Mutant Cap-Gly Domain 1e-05
4b6m_A84 Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gl 1e-05
2z0w_A96 Crystal Structure Of The 2nd Cap-Gly Domain In Huma 2e-05
1whh_A102 Solution Structure Of The 2nd Cap-Gly Domain In Mou 5e-05
1whj_A102 Solution Structure Of The 1st Cap-Gly Domain In Mou 7e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 8e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 8e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-04
1whk_A91 Solution Structure Of The 3rd Cap-Gly Domain In Mou 2e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-04
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 2e-04
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 3e-04
3oja_A 487 Crystal Structure Of Lrim1APL1C COMPLEX Length = 48 5e-04
3o53_A317 Crystal Structure Of Lrim1 Leucine-Rich Repeat Doma 7e-04
>pdb|1WHG|A Chain A, Solution Structure Of The Cap-Gly Domain In Mouse Tubulin Specific Chaperone B Length = 113 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 1/73 (1%)
Query: 15  VHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSGSFVR 74
           V + + + R GTV YVG      G W+GV +D   GK+DGS+NG RYF+ ++ K G+FV+
Sbjct: 41  VRAPDHSLRRGTVMYVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQA-KYGAFVK 99
Query: 75  VHNLSPGISLPEA 87
              ++ G S P +
Sbjct: 100 PSAVTVGDSGPSS 112
>pdb|2CP0|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170-Related Protein Clipr59 Length = 95 Back     alignment and structure
>pdb|2CP5|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170RESTIN Length = 141 Back     alignment and structure
>pdb|2CP7|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse Clip- 170RESTIN Length = 84 Back     alignment and structure
>pdb|1TOV|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 98 Back     alignment and structure
>pdb|1LPL|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 95 Back     alignment and structure
>pdb|2CP3|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 115CYLN2 Length = 84 Back     alignment and structure
>pdb|3RDV|A Chain A, Structure Of The Slain2c-Clipcg1 Complex Length = 72 Back     alignment and structure
>pdb|2E3I|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 1 Length = 86 Back     alignment and structure
>pdb|2E4H|A Chain A, Solution Structure Of Cytoskeletal Protein In Complex With Tubulin Tail Length = 98 Back     alignment and structure
>pdb|2E3H|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 2 Length = 90 Back     alignment and structure
>pdb|2CP6|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 170RESTIN Length = 172 Back     alignment and structure
>pdb|2QK0|A Chain A, Structural Basis Of Microtubule Plus End Tracking By Xmap215, Clip-170 And Eb1 Length = 74 Back     alignment and structure
>pdb|2COW|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Kinesin- Like Protein Kif13b Length = 100 Back     alignment and structure
>pdb|2CP2|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 115CYLN2 Length = 95 Back     alignment and structure
>pdb|1TXQ|A Chain A, Crystal Structure Of The Eb1 C-Terminal Domain Complexed With The Cap-Gly Domain Of P150glued Length = 93 Back     alignment and structure
>pdb|2HKN|A Chain A, Crystal Structure Of The Cap-Gly Domain Of Human Dynactin-1 (P150- Glued) Length = 97 Back     alignment and structure
>pdb|2COY|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Dynactin 1 Length = 112 Back     alignment and structure
>pdb|3TQ7|P Chain P, Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Domain Of P150glued Length = 71 Back     alignment and structure
>pdb|2HL3|A Chain A, Crystal Structure Of The A49m Mutant Cap-Gly Domain Of Human Dynactin-1 (P150-Glued) In Complex With Human Eb1 C- Terminal Hexapeptide Length = 97 Back     alignment and structure
>pdb|4B6M|A Chain A, Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gly Domain Length = 84 Back     alignment and structure
>pdb|2Z0W|A Chain A, Crystal Structure Of The 2nd Cap-Gly Domain In Human Restin- Like Protein 2 Reveals A Swapped-Dimer Length = 96 Back     alignment and structure
>pdb|1WHH|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Mouse Clip170-Related 59kda Protein Clipr-59 Length = 102 Back     alignment and structure
>pdb|1WHJ|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 102 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1WHK|A Chain A, Solution Structure Of The 3rd Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 91 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure
>pdb|3OJA|A Chain A, Crystal Structure Of Lrim1APL1C COMPLEX Length = 487 Back     alignment and structure
>pdb|3O53|A Chain A, Crystal Structure Of Lrim1 Leucine-Rich Repeat Domain Length = 317 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query418
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 2e-30
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 8e-29
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 2e-28
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 3e-28
1txq_A93 Dynactin 1; protein complex, structural protein/pr 8e-28
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 1e-27
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 2e-27
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 3e-27
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 4e-27
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 4e-27
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 6e-27
1whg_A113 Tubulin specific chaperone B; microtubule binding, 8e-27
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 9e-27
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 9e-27
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 1e-26
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 2e-26
2coz_A122 CAP350, centrosome-associated protein 350; microtu 4e-26
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 1e-25
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 8e-25
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 9e-21
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-18
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-12
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-15
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-12
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 2e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 2e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 96 Back     alignment and structure
 Score =  112 bits (281), Expect = 2e-30
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 3/91 (3%)

Query: 6  PESYKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAK 65
              +LG+RV       R+GT+++ G      G W G++ +  +GK+DGS+ GV+YF   
Sbjct: 8  EGELRLGERVLVVGQ--RLGTIRFFGTTNFAPGYWYGIELEKPHGKNDGSVGGVQYFSCS 65

Query: 66 SQKSGSFVRVHNLSPGISLPEALRVRYRGES 96
            + G F     +       + L       S
Sbjct: 66 -PRYGIFAPPSRVQRVTDSLDTLSEISGPSS 95
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Length = 86 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 141 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 100 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Length = 93 Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Length = 95 Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Length = 72 Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 84 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Length = 95 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 112 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Length = 113 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 91 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Length = 90 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 122 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 104 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 172 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 92 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query418
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
4b6m_A84 Tubulin-specific chaperone, putative; structural p 99.88
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.85
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 99.84
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 99.84
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
1txq_A93 Dynactin 1; protein complex, structural protein/pr 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 99.84
2coz_A122 CAP350, centrosome-associated protein 350; microtu 99.84
1whg_A113 Tubulin specific chaperone B; microtubule binding, 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.83
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.83
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 99.82
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.75
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.68
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.67
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.66
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.59
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.45
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.37
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.37
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.21
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.04
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.98
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.18
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.69
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.55
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.81
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.6
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.91  E-value=7.2e-24  Score=202.62  Aligned_cols=252  Identities=19%  Similarity=0.211  Sum_probs=127.4

Q ss_pred             HhcccccceecccCcCcCCCCCchhhhcCCccEEEcCCCCCCChHHHHHHhhcCCCCCEEEcCCCCCCCccCCCCCCCCc
Q 014792          128 FSKFEELTSAALPYLGVSSPGANIGTIVTNLKELDLTGNLLSDWKDIGAFGEQLPALAVLNLSNNLMSKEVTGLPQLKSI  207 (418)
Q Consensus       128 ~~~l~~L~~L~L~~~~i~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L  207 (418)
                      +..+++|++|++++|.++..++ +.. +++|++|++++|.+..++    .+..+++|++|++++|.+...++ +..+++|
T Consensus        62 ~~~~~~L~~L~l~~n~i~~~~~-~~~-l~~L~~L~L~~n~i~~~~----~~~~l~~L~~L~l~~n~i~~~~~-~~~l~~L  134 (347)
T 4fmz_A           62 IEYLTNLEYLNLNGNQITDISP-LSN-LVKLTNLYIGTNKITDIS----ALQNLTNLRELYLNEDNISDISP-LANLTKM  134 (347)
T ss_dssp             GGGCTTCCEEECCSSCCCCCGG-GTT-CTTCCEEECCSSCCCCCG----GGTTCTTCSEEECTTSCCCCCGG-GTTCTTC
T ss_pred             hhhcCCccEEEccCCccccchh-hhc-CCcCCEEEccCCcccCch----HHcCCCcCCEEECcCCcccCchh-hccCCce
Confidence            4455555555555555555443 332 255555555555555421    24555555555555555554332 4444444


Q ss_pred             cEEEecC-----------------------CCCCHHHHHHHHhcCCcccEEEccCCCCCccCCCCCCccCCCCCccEEeC
Q 014792          208 RILVLNC-----------------------TGVNWMQVEILKHSLPALEELHLMGNSISEITPVSSPIVQGFDNLQLLNL  264 (418)
Q Consensus       208 ~~L~L~~-----------------------n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~l~~L~~L~L  264 (418)
                      ++|++++                       |.+...  +. +..+++|++|++++|.+.++++     +..+++|+.|++
T Consensus       135 ~~L~l~~n~~~~~~~~~~~l~~L~~L~l~~~~~~~~--~~-~~~l~~L~~L~l~~n~l~~~~~-----~~~l~~L~~L~l  206 (347)
T 4fmz_A          135 YSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDV--TP-IANLTDLYSLSLNYNQIEDISP-----LASLTSLHYFTA  206 (347)
T ss_dssp             CEEECTTCTTCCCCGGGTTCTTCCEEECCSSCCCCC--GG-GGGCTTCSEEECTTSCCCCCGG-----GGGCTTCCEEEC
T ss_pred             eEEECCCCCCcccccchhhCCCCcEEEecCCCcCCc--hh-hccCCCCCEEEccCCccccccc-----ccCCCccceeec
Confidence            5555444                       444321  11 3444555555555555444332     344455555555


Q ss_pred             CCCCCCChhhhhhcCCCCCCCEEecCCCCCCcccCCCCCchhhhhccccccCc---cccCCCCCcEEEccCC--CCCCCC
Q 014792          265 EDNCIAEWSEILKLCQIRSLEQLYLNKNNLNRIYYPNNDTIHELVSAHESHEE---SYLPFQNLCCLLLGNS--KKLPTS  339 (418)
Q Consensus       265 ~~n~l~~~~~l~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~~~~~~~~---~~~~l~~L~~L~L~~n--~~i~~~  339 (418)
                      ++|.+.+.+.   +..+++|++|++++|.++.+.+......++.++++.+...   .+..+++|+.|++++|  ..++..
T Consensus       207 ~~n~l~~~~~---~~~~~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~n~l~~~~~~  283 (347)
T 4fmz_A          207 YVNQITDITP---VANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQISDISVL  283 (347)
T ss_dssp             CSSCCCCCGG---GGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGGG
T ss_pred             ccCCCCCCch---hhcCCcCCEEEccCCccCCCcchhcCCCCCEEECCCCccCCChhHhcCCCcCEEEccCCccCCChhh
Confidence            5555555432   4555666666666666666543223334445555554322   2344556666666655  122111


Q ss_pred             CccchhhhhhhhhhhccCCCCCCcCCCcccccccCCCCCceEEcCCCCCCCCCCcchhHHHHHHhhCCceeecCc
Q 014792          340 SHVSFVVYFLIFAFSLHASGNNMIEDLASIDSLDSFPKLMDIRLSENPVSDPGRGGISRFAIIARLGKIKILNGS  414 (418)
Q Consensus       340 ~~~~~l~~~~~~l~~l~~~~~n~i~~~~~~~~l~~~~~L~~L~l~~N~l~~~~~~~~~~~~~i~~l~~L~~Ln~s  414 (418)
                             .....|+.|+++ +|.+...+. ..+..+++|++|++++|++++..    +    ++.+++|+.|+++
T Consensus       284 -------~~l~~L~~L~L~-~n~l~~~~~-~~l~~l~~L~~L~L~~n~l~~~~----~----~~~l~~L~~L~l~  341 (347)
T 4fmz_A          284 -------NNLSQLNSLFLN-NNQLGNEDM-EVIGGLTNLTTLFLSQNHITDIR----P----LASLSKMDSADFA  341 (347)
T ss_dssp             -------GGCTTCSEEECC-SSCCCGGGH-HHHHTCTTCSEEECCSSSCCCCG----G----GGGCTTCSEESSS
T ss_pred             -------cCCCCCCEEECc-CCcCCCcCh-hHhhccccCCEEEccCCcccccc----C----hhhhhccceeehh
Confidence                   112235555665 555544432 34566666777777777666321    1    4566777777665
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4b6m_A Tubulin-specific chaperone, putative; structural protein; 1.59A {Trypanosoma brucei} Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 418
d2cowa188 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Hu 1e-23
d2e3ia171 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) 1e-23
d1ixda_104 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 2e-22
d2cp0a183 b.34.10.1 (A:7-89) CLIP170-related 59kda protein C 2e-22
d1tova_98 b.34.10.1 (A:) Cytoskeleton-associated protein F53 6e-22
d1whga_113 b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1 6e-22
d1whha_102 b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR 8e-22
d2cp6a1160 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [ 2e-21
d2e3ha171 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapien 3e-21
d2coza1109 b.34.10.1 (A:8-116) Centrosome-associated protein 3e-21
d1whka_91 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 9e-21
d2hqha172 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapien 1e-20
d1whma_92 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 1e-20
d1whja_102 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 2e-20
d1whla_95 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 6e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: Kinesin-like protein kif13b
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 92.2 bits (229), Expect = 1e-23
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 6  PESYKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAK 65
          PE  + G+ V       + G V+YVG      GTW+GV+ D  +GK+DGSI G +YF+  
Sbjct: 15 PEWLREGEFVTVGAH--KTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCN 72

Query: 66 SQKSGSFVRVHNLSPG 81
              G  VR   +   
Sbjct: 73 P-GYGLLVRPSRVRRA 87
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 98 Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 91 Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query418
d2e3ia171 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d2cp0a183 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.86
d2hqha172 Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2e3ha171 CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2cowa188 Kinesin-like protein kif13b {Human (Homo sapiens) 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1whka_91 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.84
d1ixda_104 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.84
d2coza1109 Centrosome-associated protein 350 {Human (Homo sap 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1whja_102 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.82
d1tova_98 Cytoskeleton-associated protein F53F4.3 {Caenorhab 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1whha_102 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.81
d2cp6a1160 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1whma_92 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1whga_113 Tubulin-specific chaperone B (SKAP1) {Mouse (Mus m 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1whla_95 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.42
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.97
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.49
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.03
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.76
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.36
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: Restin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.89  E-value=2.2e-23  Score=144.17  Aligned_cols=70  Identities=37%  Similarity=0.712  Sum_probs=64.5

Q ss_pred             CCCCCEEEeCCCCceeeEEEEEeecCCCCceEEEEEEeCCCCCCCCEECCEEeeecCCCCccccccccccCCC
Q 014792            9 YKLGQRVHSANDARRIGTVKYVGEVQGYSGTWLGVDWDYGNGKHDGSINGVRYFQAKSQKSGSFVRVHNLSPG   81 (418)
Q Consensus         9 ~~~g~rv~~~~~~~~~gtvr~~g~~~~~~~~w~gve~d~~~gk~~g~~~g~~yf~~~~~~~~sf~~~~~l~~~   81 (418)
                      |+|||||.+.++  +.|||||+|++++.++.|+|||||+|.|||||+++|++||+|. ++.|.|++++++...
T Consensus         1 f~vG~rV~v~~~--~~G~vryvG~~~~~~g~~vGVEld~p~Gk~dGt~~G~~YF~c~-~~~G~Fv~~~~v~k~   70 (71)
T d2e3ia1           1 FRVGERVWVNGN--KPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCE-PLKGIFTRPSKLTRK   70 (71)
T ss_dssp             CCTTCEEEETTT--EEEEEEEEEECSSSSSEEEEEEESSSCSSBSSEETTEESSCCS-TTCEEEECGGGEESS
T ss_pred             CccCCEEEECCC--cEEEEEEEeecCCCCCcEEEEEECCCCCCCCCEECCEEEEecC-CCcEEEeCHHHEEec
Confidence            689999999875  5699999999999999999999999999999999999999997 699999999987643
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure