Citrus Sinensis ID: 015335

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MAANGSKNPTRKQLIVSILCKHLSLDHKDFSSNAAEKDIKTLYSDILKSSGKSSNDEVMKWIEFAESFPADSKACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMPHVMRWMDYIQSKEALGDLFGTISLEKPGFEPPLHGAKSAVDSNAKKTVQSTNHAEKSEAPSNLKSGDAKKGDTALQEKKKSVETEAVDKDKTKKAVGDKEAGQEKKKSSETAAVDKDKELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCTSSIPKASIK
ccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccEEccccccccHHHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHccHHHHHHHccccccccccccccccccccccccccccEEEEEEEEEEEEEEcccccccEEEEEEcccccccEEEEccccccccccccccEEEEEEEcccccccccccccEEEEEEcccccEEEEEccccccccccEEEEcccccccccccccHHHHHHHHcccEEEcccEEEEEccEEEEEccccEEEEccccccc
cccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHccHHHHHccccHHHHHHHHHccccHHHHHHHcccccccccccccccHHHccHHHHHHHHHHcHcccHHccccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHccEEEEEEEEEEEcccccccEEEEEEccccccEEEEEcccccccHHHccccEEEEEcccccEEEccEEEccEEcEEEEcccEEEEEcEcccccccccEcEcccccccccccEcHHHcHHHHHHHHEEEccccEEEEccEEcEccccEEEEEccccccc
maangsknptrKQLIVSILCKhlsldhkdfssnaaEKDIKTLYSDILkssgkssndEVMKWIEFaesfpadskACFDVLIKLNEELATKSVllgnglrtseADVIVFSAVHSFVVGLanldqgkmphvMRWMDYIQSKEALGdlfgtislekpgfepplhgaksavdsnakktvqstnhaekseapsnlksgdakkgdtALQEKKKSveteavdkdktkkavgdkeagqekkkssetaavdkdkeLSVSLLNIQVGLirkswkhpsadsllVEEIDVGEAKLRQVVSGLakycnpddltNRRVALItnvkpgklrdvMSEGLVlcasnedhtnvepllppegakigerisfsgidgkpeevlnpkkkqlekitpnlftddkgvatfkgipfmtsagpctssipkasik
maangsknptrkQLIVSILCKHLSLDHKDFSSNAAEKDIKTLYSDILKSSGKSSNDEVMKWIEFAESFPADSKACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMPHVMRWMDYIQSKEALGDLFGTISLEKPGFEPPLHGAKSAVDSNAKKTVQStnhaekseapsnlksgdakkgdtalqekkksveteavdkdktkkavgdkeagqekkkssetaavdkdkelsVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAkycnpddltnrrVALItnvkpgklrdVMSEGLVLCAsnedhtnvepllppegakIGERISfsgidgkpeevlnpkkkqlekitpnlftddKGVATFKGIPfmtsagpctssipkasik
MAANGSKNPTRKQLIVSILCKHLSLDHKDFSSNAAEKDIKTLYSDILKSSGKSSNDEVMKWIEFAESFPADSKACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMPHVMRWMDYIQSKEALGDLFGTISLEKPGFEPPLHGAKSAVDSNAKKTVQSTNHAEKSEAPSNLKSGDAKKGDTALQEKKKSVETEAVDKDKTKKAVGDKEAGQEKKKSSETAAVDKDKELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCTSSIPKASIK
*************LIVSILCKHLSLDHKDF********IKTLYSDI***********VMKWIEFAESFPADSKACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMPHVMRWMDYIQSKEALGDLFGTISL************************************************************************************************SVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLVLCAS***********************************************NLFTDDKGVATFKGIPFM****************
**************IVSILCKHLSLDHKDFSSNAAEKDIKTLYSDILKSSGKSSNDEVMKWIEFAESFPA**KACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMPHVMRWMDYIQSKEALGDLFGTISLEKPGFEPPLHGAKSAVDSNAKKTVQSTNHAEKSEAPS**********************************************************LSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGK*****NPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCTSSIPKASI*
**********RKQLIVSILCKHLSLDHKDFSSNAAEKDIKTLYSDILKSSGKSSNDEVMKWIEFAESFPADSKACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMPHVMRWMDYIQSKEALGDLFGTISLEKPGFEPPLHGA*****************************************************************************VDKDKELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCTSSIPKASIK
******KNPTRKQLIVSILCKHLSLDHKDFSSNAAEKDIKTLYSDILKSSGKSSNDEVMKWIEFAESFPADSKACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMPHVMRWMDYIQSKEALGDLFGTISLEKPGFEPPLHG****V******************************************************************************ELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCTSSIPKASI*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAANGSKNPTRKQLIVSILCKHLSLDHKDFSSNAAEKDIKTLYSDILKSSGKSSNDEVMKWIEFAESFPADSKACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMPHVMRWMDYIQSKEALGDLFGTISLEKPGFEPPLHGAKSAVDSNAKKTVQSTNHAEKSEAPSNLKSGDAKKGDTALQEKKKSVETEAVDKDKTKKAVGDKEAGQEKKKSSETAAVDKDKELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCTSSIPKASIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query408 2.2.26 [Sep-21-2011]
Q9ZTS1801 Probable methionine--tRNA no no 0.519 0.264 0.435 2e-41
Q9SVN5797 Probable methionine--tRNA no no 0.406 0.208 0.485 2e-39
Q12904312 Aminoacyl tRNA synthase c yes no 0.357 0.467 0.479 5e-34
P31230310 Aminoacyl tRNA synthase c yes no 0.377 0.496 0.471 1e-33
O54873359 Aminoacyl tRNA synthase c yes no 0.377 0.428 0.471 3e-33
Q9P6K7450 Uncharacterized tRNA-bind yes no 0.75 0.68 0.300 4e-32
Q7ZX51528 Tyrosine--tRNA ligase, cy N/A no 0.529 0.409 0.400 6e-31
Q6DIJ1528 Tyrosine--tRNA ligase, cy no no 0.463 0.357 0.414 1e-29
Q4KM49528 Tyrosine--tRNA ligase, cy no no 0.375 0.289 0.470 2e-28
Q29465528 Tyrosine--tRNA ligase, cy no no 0.375 0.289 0.458 3e-28
>sp|Q9ZTS1|SYM_ORYSJ Probable methionine--tRNA ligase OS=Oryza sativa subsp. japonica GN=Os06g0508700 PE=2 SV=2 Back     alignment and function desciption
 Score =  170 bits (430), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 137/216 (63%), Gaps = 4/216 (1%)

Query: 197 GDTALQEKKKSVETEA---VDKDKTKKAVGDKEAGQEKKKSSETAAVDKDKELSVSLLNI 253
           G  A +  K   + EA    DK K  K     +  ++KK+S  + + + + +++V+ L+I
Sbjct: 586 GSQAERSSKAQADAEAKKVADKLKGTKLSDGGQKKEQKKQSGGSKSKNAEVDVTVAKLDI 645

Query: 254 QVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGK 313
           +VGLIRK+ KHP ADSL VEEIDVGE   R VVSGL K+   +++ NR+V ++ N+KP  
Sbjct: 646 RVGLIRKAQKHPDADSLYVEEIDVGEEAPRTVVSGLVKFIPLEEMQNRKVCVLCNLKPVA 705

Query: 314 LRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQLEKIT 373
           +R + S  +VL ASNEDHT VE + PPE A +GER++F+G  G+PE  LN K K  EK++
Sbjct: 706 MRGIKSHAMVLAASNEDHTKVELVEPPESAAVGERVTFAGYSGEPEASLNAKSKTWEKLS 765

Query: 374 PNLFTDDKGVATFKGIPFMTSAGPC-TSSIPKASIK 408
            +L ++ + VA +K +PF TSAG C   SI    I+
Sbjct: 766 ADLHSNGELVACYKDVPFTTSAGVCKVKSIASGEIR 801

Oryza sativa subsp. japonica (taxid: 39947)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 0
>sp|Q9SVN5|SYM_ARATH Probable methionine--tRNA ligase OS=Arabidopsis thaliana GN=At4g13780 PE=2 SV=1 Back     alignment and function description
>sp|Q12904|AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens GN=AIMP1 PE=1 SV=2 Back     alignment and function description
>sp|P31230|AIMP1_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus GN=Aimp1 PE=1 SV=2 Back     alignment and function description
>sp|O54873|AIMP1_CRIGR Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Cricetulus griseus GN=AIMP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9P6K7|YLF4_SCHPO Uncharacterized tRNA-binding protein C30C2.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30C2.04 PE=4 SV=1 Back     alignment and function description
>sp|Q7ZX51|SYYC_XENLA Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=yars PE=2 SV=1 Back     alignment and function description
>sp|Q6DIJ1|SYYC_XENTR Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=yars PE=2 SV=1 Back     alignment and function description
>sp|Q4KM49|SYYC_RAT Tyrosine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Yars PE=2 SV=3 Back     alignment and function description
>sp|Q29465|SYYC_BOVIN Tyrosine--tRNA ligase, cytoplasmic OS=Bos taurus GN=YARS PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
224144994425 predicted protein [Populus trichocarpa] 0.909 0.872 0.677 1e-146
359486328392 PREDICTED: uncharacterized tRNA-binding 0.919 0.956 0.671 1e-145
255559715391 methionyl-tRNA synthetase, putative [Ric 0.938 0.979 0.658 1e-141
147837872 523 hypothetical protein VITISV_013997 [Viti 0.911 0.711 0.599 1e-137
449457397392 PREDICTED: probable methionine--tRNA lig 0.938 0.977 0.621 1e-134
356516237390 PREDICTED: probable methionyl-tRNA synth 0.933 0.976 0.607 1e-131
297824001389 tRNA-binding region domain-containing pr 0.924 0.969 0.618 1e-128
359807430389 uncharacterized protein LOC100809851 [Gl 0.931 0.976 0.602 1e-126
18405465389 OB-fold nucleic acid binding domain-cont 0.928 0.974 0.621 1e-124
357131207453 PREDICTED: probable methionyl-tRNA synth 0.943 0.849 0.534 1e-109
>gi|224144994|ref|XP_002325488.1| predicted protein [Populus trichocarpa] gi|222862363|gb|EEE99869.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 275/406 (67%), Positives = 313/406 (77%), Gaps = 35/406 (8%)

Query: 11  RKQLIVSILCKHLSLDHKDFSSNAAEKDIKTLYSDILKSSGKSS----NDEVMKWIEFAE 66
           RKQ+I S L KHLSL  +  S +  E DIK+LY +ILKSSGK S    ++EVMKWI FAE
Sbjct: 47  RKQIISSALSKHLSLSPEAPSGDLGEYDIKSLYLNILKSSGKRSPSKESEEVMKWISFAE 106

Query: 67  SFPADSKACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMP 126
            FP DS  CFD L  LN++LA  SVLLGNGL  SEAD+IVFS +HS V+GL++L++ K+ 
Sbjct: 107 IFPIDSPTCFDALSGLNKDLALNSVLLGNGLTPSEADIIVFSVIHSSVIGLSHLEREKLV 166

Query: 127 HVMRWMDYIQSKEALGDLFGTISLEKPGFEPPLHG----AKSAVDSNAKKTVQSTNHAEK 182
           HVMRWMDYIQ+K   G LF  + LEK  FE  L G    AKS +D+NAKKTV++T + EK
Sbjct: 167 HVMRWMDYIQNKVDFGKLFEKVLLEKGAFE--LQGIKGDAKSEIDTNAKKTVENTKNKEK 224

Query: 183 SEAPSNLKSGDAKKGDTALQEKKKSVETEAVDKDKTKKAVGDKEAGQEKKKSSETAAVDK 242
           SEA  ++K  D                          K+ G KE+ QEKKK SET A +K
Sbjct: 225 SEADLSMKKSD-------------------------NKSTGKKESAQEKKKPSETEAGEK 259

Query: 243 DKELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRR 302
           DKELSVSLLNIQVGLIRK+WKHPSADSLLVEEID+G+AKLRQVVSGLAK+ +PDDLTNRR
Sbjct: 260 DKELSVSLLNIQVGLIRKAWKHPSADSLLVEEIDIGDAKLRQVVSGLAKFYSPDDLTNRR 319

Query: 303 VALITNVKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVL 362
           V LITNVKPGKLRDVMSEGLVLCASNEDHT VEPLLPPEGAK+GER+SF GIDGKPE+VL
Sbjct: 320 VVLITNVKPGKLRDVMSEGLVLCASNEDHTIVEPLLPPEGAKVGERVSFLGIDGKPEDVL 379

Query: 363 NPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCTSSIPKASIK 408
           NPKKKQLEKITPNLF+DDKGVATFKGIPFMTS GPCTSSIPKASIK
Sbjct: 380 NPKKKQLEKITPNLFSDDKGVATFKGIPFMTSGGPCTSSIPKASIK 425

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359486328|ref|XP_002275301.2| PREDICTED: uncharacterized tRNA-binding protein C30C2.04-like [Vitis vinifera] gi|297736480|emb|CBI25351.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255559715|ref|XP_002520877.1| methionyl-tRNA synthetase, putative [Ricinus communis] gi|223540008|gb|EEF41586.1| methionyl-tRNA synthetase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147837872|emb|CAN60565.1| hypothetical protein VITISV_013997 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457397|ref|XP_004146435.1| PREDICTED: probable methionine--tRNA ligase-like [Cucumis sativus] gi|449491630|ref|XP_004158957.1| PREDICTED: probable methionine--tRNA ligase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356516237|ref|XP_003526802.1| PREDICTED: probable methionyl-tRNA synthetase-like [Glycine max] Back     alignment and taxonomy information
>gi|297824001|ref|XP_002879883.1| tRNA-binding region domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325722|gb|EFH56142.1| tRNA-binding region domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359807430|ref|NP_001240878.1| uncharacterized protein LOC100809851 [Glycine max] gi|255636276|gb|ACU18478.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|18405465|ref|NP_565938.1| OB-fold nucleic acid binding domain-containing protein [Arabidopsis thaliana] gi|14334468|gb|AAK59432.1| putative methionyl-tRNA synthetase [Arabidopsis thaliana] gi|16323444|gb|AAL15216.1| putative methionyl-tRNA synthetase [Arabidopsis thaliana] gi|330254767|gb|AEC09861.1| OB-fold nucleic acid binding domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357131207|ref|XP_003567231.1| PREDICTED: probable methionyl-tRNA synthetase-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
TAIR|locus:2064801389 AT2G40660 [Arabidopsis thalian 0.933 0.979 0.625 4.6e-121
DICTYBASE|DDB_G0291926363 DDB_G0291926 "endothelial mono 0.534 0.600 0.390 2.5e-43
ZFIN|ZDB-GENE-060825-144315 aimp1 "aminoacyl tRNA syntheta 0.485 0.628 0.448 6.7e-43
UNIPROTKB|F1NLE7318 AIMP1 "Uncharacterized protein 0.563 0.723 0.420 7.8e-39
UNIPROTKB|I3LFC4319 AIMP1 "Uncharacterized protein 0.504 0.645 0.424 1.3e-38
TAIR|locus:2119515797 AT4G13780 [Arabidopsis thalian 0.865 0.442 0.325 1.6e-38
UNIPROTKB|Q4G079315 Aimp1 "Small inducible cytokin 0.458 0.593 0.454 2.4e-37
UNIPROTKB|Q12904312 AIMP1 "Aminoacyl tRNA synthase 0.492 0.644 0.412 3.9e-37
POMBASE|SPAC30C2.04450 SPAC30C2.04 "cofactor for meth 0.723 0.655 0.315 6.3e-37
UNIPROTKB|Q3ZBX5322 SCYE1 "Uncharacterized protein 0.509 0.645 0.403 1e-36
TAIR|locus:2064801 AT2G40660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1191 (424.3 bits), Expect = 4.6e-121, P = 4.6e-121
 Identities = 250/400 (62%), Positives = 304/400 (76%)

Query:    12 KQLIVSILCKHLSLDHKDFSSNAAEKDIKTLYSDILKSSGK---SSNDEVMKWIEFAESF 68
             KQ+I+S LCKH SLD + F   A E DIKTLYS++LK+SGK   + N++V+KW++FAE F
Sbjct:     6 KQMILSALCKHFSLDPEPFVGGAGESDIKTLYSNVLKASGKEVSAQNNDVLKWLDFAEGF 65

Query:    69 PADSKACFDVLIKLNEELATKSVLLGNGLRTSEADVIVFSAVHSFVVGLANLDQGKMPHV 128
              +DSK  F  L KLN ELATKSVLLGNGL  S ADV VFSA+HS V+GL++ D+ K+PHV
Sbjct:    66 SSDSKDWFSALEKLNLELATKSVLLGNGLTPSAADVAVFSALHSSVLGLSDSDKEKVPHV 125

Query:   129 MRWMDYIQSKEALGDLFGTISLEKPGFEPPLHGAKSAVDSNAKKTVQSTNHAEKSEAPSN 188
             +RW++YIQ+KE L  LF  I ++ P F       K A+       V++ ++++K  A   
Sbjct:   126 IRWVNYIQNKEELSTLFAPIPVKLPEFS--FEVPKPAIK------VETNSNSKK--AAEG 175

Query:   189 LKSGDAKKGDTALQEKKKSVETEAVDKDKTKKAVGDKEAGQEKKKSSETAAVDKDKELSV 248
             +K  D  K D   Q   K  E E    +  K A  +K+A +EKKK +E     K+ ELSV
Sbjct:   176 VKPVD--KPDVQPQLGTKKTEPE----EPKKNAAKEKDAKKEKKKPAEPEPAKKEAELSV 229

Query:   249 SLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITN 308
             SLLNIQVGLIRK+WKHPSADSLLVEEIDVGE K+RQVVSGLAK+C+P+DLTNR VALITN
Sbjct:   230 SLLNIQVGLIRKAWKHPSADSLLVEEIDVGEDKVRQVVSGLAKFCSPEDLTNRLVALITN 289

Query:   309 VKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQ 368
             VKPGKLRDVMS+GLVLCAS+EDH+ VEPLLPP GAK GER+SFSGI+GKPE+VLNPKKKQ
Sbjct:   290 VKPGKLRDVMSQGLVLCASSEDHSVVEPLLPPAGAKPGERVSFSGIEGKPEDVLNPKKKQ 349

Query:   369 LEKITPNLFTDDKGVATFKGIPFMTSAGPCTSSIPKASIK 408
             LEKITP L+TD+ GVAT+KGI FMTSAGPCTSSIPKA+IK
Sbjct:   350 LEKITPGLYTDENGVATYKGIQFMTSAGPCTSSIPKATIK 389
GO:0000049 "tRNA binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
DICTYBASE|DDB_G0291926 DDB_G0291926 "endothelial monocyte-activating polypeptide II precursor pro-EMAP II family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060825-144 aimp1 "aminoacyl tRNA synthetase complex-interacting multifunctional protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLE7 AIMP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LFC4 AIMP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2119515 AT4G13780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4G079 Aimp1 "Small inducible cytokine subfamily E, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q12904 AIMP1 "Aminoacyl tRNA synthase complex-interacting multifunctional protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPAC30C2.04 SPAC30C2.04 "cofactor for methionyl-and glutamyl-tRNA synthetases (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBX5 SCYE1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
PLN02610801 PLN02610, PLN02610, probable methionyl-tRNA synthe 8e-70
cd02799105 cd02799, tRNA_bind_EMAP-II_like, tRNA-binding-doma 1e-51
cd0215399 cd02153, tRNA_bindingDomain, The tRNA binding doma 1e-32
pfam0158895 pfam01588, tRNA_bind, Putative tRNA binding domain 4e-28
cd10304100 cd10304, GST_C_Arc1p_N_like, Glutathione S-transfe 2e-25
PRK00133673 PRK00133, metG, methionyl-tRNA synthetase; Reviewe 7e-22
PRK12267648 PRK12267, PRK12267, methionyl-tRNA synthetase; Rev 7e-21
cd02800105 cd02800, tRNA_bind_EcMetRS_like, tRNA-binding-doma 3e-20
TIGR00399137 TIGR00399, metG_C_term, methionyl-tRNA synthetase 6e-19
COG0073123 COG0073, ARC1, EMAP domain [General function predi 3e-16
cd02798107 cd02798, tRNA_bind_CsaA, tRNA-binding-domain-conta 7e-16
cd1028982 cd10289, GST_C_AaRS_like, Glutathione S-transferas 4e-14
cd10305101 cd10305, GST_C_AIMP3, Glutathione S-transferase C- 2e-10
cd02796103 cd02796, tRNA_bind_bactPheRS, tRNA-binding-domain- 7e-10
TIGR00472 797 TIGR00472, pheT_bact, phenylalanyl-tRNA synthetase 1e-09
PRK10089112 PRK10089, PRK10089, tRNA-binding protein; Provisio 1e-08
PRK00629 791 PRK00629, pheT, phenylalanyl-tRNA synthetase subun 2e-07
cd1030882 cd10308, GST_C_eEF1b_like, Glutathione S-transfera 2e-06
cd1030981 cd10309, GST_C_GluProRS_N, Glutathione S-transfera 2e-06
cd1030687 cd10306, GST_C_GluRS_N, Glutathione S-transferase 3e-06
cd10292118 cd10292, GST_C_YghU_like, C-terminal, alpha helica 0.002
>gnl|CDD|215329 PLN02610, PLN02610, probable methionyl-tRNA synthetase Back     alignment and domain information 
 Score =  234 bits (599), Expect = 8e-70
 Identities = 92/202 (45%), Positives = 129/202 (63%), Gaps = 2/202 (0%)

Query: 209 ETEAVDKDKTKKAVGDKEAGQEKKKSSET-AAVDKDKELSVSLLNIQVGLIRKSWKHPSA 267
             +   + K K      +  Q KK      +    ++E+ VS L+I+VGLI K+ KHP A
Sbjct: 600 AKKLAKQLKKKALSDGGKKKQGKKAGGGGKSKAAAEREIDVSRLDIRVGLIVKAEKHPDA 659

Query: 268 DSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLVLCAS 327
           DSL VEEIDVGE   R VVSGL KY   +++ NR+V ++ N+KP  +R + S+ +VL AS
Sbjct: 660 DSLYVEEIDVGEGAPRTVVSGLVKYIPLEEMQNRKVCVLCNLKPAAMRGIKSQAMVLAAS 719

Query: 328 NEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQLEKITPNLFTDDKGVATFK 387
           N DHT VE + PPE A +GER++F G +G+P++VLNPKKK  E + P+L T+ + VA +K
Sbjct: 720 NSDHTKVELVEPPESAAVGERVTFPGFEGEPDDVLNPKKKVWETLQPDLHTNSELVACYK 779

Query: 388 GIPFMTSAGPC-TSSIPKASIK 408
            +PF TSAG C  +SI   SI+
Sbjct: 780 DVPFTTSAGVCKVASIANGSIR 801

Length = 801
>gnl|CDD|239198 cd02799, tRNA_bind_EMAP-II_like, tRNA-binding-domain-containing EMAP2-like proteins Back     alignment and domain information
>gnl|CDD|239066 cd02153, tRNA_bindingDomain, The tRNA binding domain is also known as the Myf domain in literature Back     alignment and domain information
>gnl|CDD|216589 pfam01588, tRNA_bind, Putative tRNA binding domain Back     alignment and domain information
>gnl|CDD|198337 cd10304, GST_C_Arc1p_N_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Aminoacyl tRNA synthetase cofactor 1 and similar proteins Back     alignment and domain information
>gnl|CDD|234655 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|237028 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|239199 cd02800, tRNA_bind_EcMetRS_like, tRNA-binding-domain-containing Escherichia coli methionyl-tRNA synthetase (EcMetRS)-like proteins Back     alignment and domain information
>gnl|CDD|232958 TIGR00399, metG_C_term, methionyl-tRNA synthetase C-terminal region/beta chain Back     alignment and domain information
>gnl|CDD|223151 COG0073, ARC1, EMAP domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|239197 cd02798, tRNA_bind_CsaA, tRNA-binding-domain-containing CsaA-like proteins Back     alignment and domain information
>gnl|CDD|198322 cd10289, GST_C_AaRS_like, Glutathione S-transferase C-terminal-like, alpha helical domain of various Aminoacyl-tRNA synthetases and similar domains Back     alignment and domain information
>gnl|CDD|198338 cd10305, GST_C_AIMP3, Glutathione S-transferase C-terminal-like, alpha helical domain of Aminoacyl tRNA synthetase complex-Interacting Multifunctional Protein 3 Back     alignment and domain information
>gnl|CDD|239196 cd02796, tRNA_bind_bactPheRS, tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain Back     alignment and domain information
>gnl|CDD|232990 TIGR00472, pheT_bact, phenylalanyl-tRNA synthetase, beta subunit, non-spirochete bacterial Back     alignment and domain information
>gnl|CDD|182232 PRK10089, PRK10089, tRNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234804 PRK00629, pheT, phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|198341 cd10308, GST_C_eEF1b_like, Glutathione S-transferase C-terminal-like, alpha helical domain of eukaryotic translation Elongation Factor 1 beta Back     alignment and domain information
>gnl|CDD|198342 cd10309, GST_C_GluProRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of bifunctional Glutamyl-Prolyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|198339 cd10306, GST_C_GluRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of Glutamyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|198325 cd10292, GST_C_YghU_like, C-terminal, alpha helical domain of Escherichia coli Yghu Glutathione S-transferases and related uncharacterized proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 408
KOG2241255 consensus tRNA-binding protein [Translation, ribos 100.0
PLN02610801 probable methionyl-tRNA synthetase 100.0
TIGR02222107 chap_CsaA export-related chaperone CsaA. This mode 99.96
cd02798107 tRNA_bind_CsaA tRNA-binding-domain-containing CsaA 99.96
PRK10089112 tRNA-binding protein; Provisional 99.96
cd02799105 tRNA_bind_EMAP-II_like tRNA-binding-domain-contain 99.95
TIGR00399137 metG_C_term methionyl-tRNA synthetase C-terminal r 99.94
cd02800105 tRNA_bind_EcMetRS_like tRNA-binding-domain-contain 99.93
PF0158895 tRNA_bind: Putative tRNA binding domain; InterPro: 99.93
COG0073123 ARC1 EMAP domain [General function prediction only 99.92
cd0215399 tRNA_bindingDomain The tRNA binding domain is also 99.91
PRK12267648 methionyl-tRNA synthetase; Reviewed 99.87
PRK00133673 metG methionyl-tRNA synthetase; Reviewed 99.86
cd02796103 tRNA_bind_bactPheRS tRNA-binding-domain-containing 99.81
TIGR00472 798 pheT_bact phenylalanyl-tRNA synthetase, beta subun 99.63
PRK00629 791 pheT phenylalanyl-tRNA synthetase subunit beta; Re 99.59
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.52
KOG0867226 consensus Glutathione S-transferase [Posttranslati 99.46
PLN02395215 glutathione S-transferase 99.43
PRK10542201 glutathionine S-transferase; Provisional 99.43
PRK09481211 sspA stringent starvation protein A; Provisional 99.42
PLN02473214 glutathione S-transferase 99.38
PRK11752264 putative S-transferase; Provisional 99.36
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.33
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 99.31
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.31
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 99.3
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.29
PLN02907 722 glutamate-tRNA ligase 99.29
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 99.25
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 99.24
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 99.23
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 99.23
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 99.22
PTZ00057205 glutathione s-transferase; Provisional 99.19
PRK10357202 putative glutathione S-transferase; Provisional 99.18
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 99.17
PRK15113214 glutathione S-transferase; Provisional 99.17
PLN02378213 glutathione S-transferase DHAR1 99.17
COG2517219 Predicted RNA-binding protein containing a C-termi 99.17
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 99.13
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 99.13
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 99.13
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 99.12
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 99.11
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 99.09
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 99.09
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 99.08
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 99.08
PLN02817265 glutathione dehydrogenase (ascorbate) 99.07
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 99.03
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.99
PRK10387210 glutaredoxin 2; Provisional 98.97
TIGR02306 341 RNA_lig_DRB0094 RNA ligase, DRB0094 family. The me 98.94
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 98.87
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 98.85
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 98.85
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 98.85
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 98.83
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 98.82
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 98.81
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 98.78
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 98.77
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 98.72
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 98.64
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 98.6
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 98.56
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 98.52
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 98.49
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 98.42
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 98.41
KOG1147 712 consensus Glutamyl-tRNA synthetase [Translation, r 98.36
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 98.31
KOG0868217 consensus Glutathione S-transferase [Posttranslati 98.14
KOG0406231 consensus Glutathione S-transferase [Posttranslati 98.14
KOG4420325 consensus Uncharacterized conserved protein (Gangl 98.13
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 98.11
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.08
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 97.98
KOG1695206 consensus Glutathione S-transferase [Posttranslati 97.95
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 97.82
KOG2903319 consensus Predicted glutathione S-transferase [Pos 97.27
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 95.72
KOG3029370 consensus Glutathione S-transferase-related protei 94.42
PHA02142 366 putative RNA ligase 94.31
KOG1668231 consensus Elongation factor 1 beta/delta chain [Tr 93.17
KOG4244281 consensus Failed axon connections (fax) protein/gl 92.84
KOG3027257 consensus Mitochondrial outer membrane protein Met 91.82
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 91.51
KOG3028313 consensus Translocase of outer mitochondrial membr 88.0
PTZ00385659 lysyl-tRNA synthetase; Provisional 87.44
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 87.06
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 86.03
>KOG2241 consensus tRNA-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=6.8e-58  Score=432.69  Aligned_cols=169  Identities=53%  Similarity=0.849  Sum_probs=164.4

Q ss_pred             cccccccCccccceEEEEEEEEEeCCCCCceEEEEEEccCCeeEEEEeCCCCCCCchhcCCCEEEEEeeccccccccccc
Q 015335          240 VDKDKELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMS  319 (408)
Q Consensus       240 ~~~~~~~~~~~ldirVG~I~~~~~hp~adkL~v~~Vd~G~~~~r~IvsGl~~~~~~~~l~g~~V~v~~nlkp~k~rGv~S  319 (408)
                      ++.+..+++++||||||+|+++++||++|+||+++||+|+.++|||||||++|+++|+|+||+|+|+|||||+|||||+|
T Consensus        86 ~~~~~~p~~~~LDiRvG~Ivka~kHpdADsLYve~IdvgE~~PRTVvSGLvk~vpleemq~R~VvvlcNLKPakmRgv~S  165 (255)
T KOG2241|consen   86 PMMEAGPDVSLLDIRVGKIVKAGKHPDADSLYVEEIDVGEAEPRTVVSGLVKHVPLEEMQNRLVVVLCNLKPAKMRGVKS  165 (255)
T ss_pred             CcccCCCCcceeeEEEeEEEEecccCCcceeEEEEeeecccccceeehhhHhhCCHHHHhCCeEEEEecccccccccccc
Confidence            45566788999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cceeeeccCCCCCceEEecCCCCCCCCceEEEcCCCCCCCccCCcchhhHhhhCCCeeECCCeEEEECCeeeeeCCCCee
Q 015335          320 EGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCT  399 (408)
Q Consensus       320 ~gMvLca~~~~~~~v~ll~pp~~~~~G~~v~~~g~~~~p~~~l~~kkk~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~~~  399 (408)
                      +|||||++++|+..||+|.||.++.+|+||+|+||+++|+++||||||+||.|||+|+|+++|+++|||.+|+|+.|.|+
T Consensus       166 ~gMvlcaSs~d~~~VE~l~pP~gs~pGdRv~fegfegePd~~LnPKKKiwE~iqpdl~t~~~~va~yKg~~~~~~~G~~~  245 (255)
T KOG2241|consen  166 QGMVLCASSPDKSVVEPLAPPAGSKPGDRVTFEGFEGEPDKELNPKKKIWEKIQPDLKTNEEGVATYKGAPFETKKGVCT  245 (255)
T ss_pred             ceeEEecCCcccceeeeccCCCCCCCCCeeeecCCCCCcchhcChhhhhHHHhCCCcccccceEEEecCCceeccCceEE
Confidence            99999999999888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             e-ecCCcccC
Q 015335          400 S-SIPKASIK  408 (408)
Q Consensus       400 ~-~~~~~~vk  408 (408)
                      + +|.||+||
T Consensus       246 a~ti~n~~Ik  255 (255)
T KOG2241|consen  246 AQTISNGGIK  255 (255)
T ss_pred             EeeccCCCCC
Confidence            8 89999997

>PLN02610 probable methionyl-tRNA synthetase Back     alignment and domain information
>TIGR02222 chap_CsaA export-related chaperone CsaA Back     alignment and domain information
>cd02798 tRNA_bind_CsaA tRNA-binding-domain-containing CsaA-like proteins Back     alignment and domain information
>PRK10089 tRNA-binding protein; Provisional Back     alignment and domain information
>cd02799 tRNA_bind_EMAP-II_like tRNA-binding-domain-containing EMAP2-like proteins Back     alignment and domain information
>TIGR00399 metG_C_term methionyl-tRNA synthetase C-terminal region/beta chain Back     alignment and domain information
>cd02800 tRNA_bind_EcMetRS_like tRNA-binding-domain-containing Escherichia coli methionyl-tRNA synthetase (EcMetRS)-like proteins Back     alignment and domain information
>PF01588 tRNA_bind: Putative tRNA binding domain; InterPro: IPR002547 This domain is found in prokaryotic methionyl-tRNA synthetases, prokaryotic phenylalanyl tRNA synthetases the yeast GU4 nucleic-binding protein (G4p1 or p42, ARC1) [], human tyrosyl-tRNA synthetase [], and endothelial-monocyte activating polypeptide II Back     alignment and domain information
>COG0073 ARC1 EMAP domain [General function prediction only] Back     alignment and domain information
>cd02153 tRNA_bindingDomain The tRNA binding domain is also known as the Myf domain in literature Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd02796 tRNA_bind_bactPheRS tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain Back     alignment and domain information
>TIGR00472 pheT_bact phenylalanyl-tRNA synthetase, beta subunit, non-spirochete bacterial Back     alignment and domain information
>PRK00629 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>COG2517 Predicted RNA-binding protein containing a C-terminal EMAP domain [General function prediction only] Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>TIGR02306 RNA_lig_DRB0094 RNA ligase, DRB0094 family Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>PHA02142 putative RNA ligase Back     alignment and domain information
>KOG1668 consensus Elongation factor 1 beta/delta chain [Transcription] Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00385 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
1euj_A166 A Novel Anti-Tumor Cytokine Contains A Rna-Binding 8e-35
1e7z_A174 Crystal Structure Of The Emap2RNA BINDING DOMAIN OF 9e-35
1fl0_A171 Crystal Structure Of The Emap2RNA-Binding Domain Of 2e-34
1ntg_A172 Crystal Structure Of The Emap Ii-Like Cytokine Rele 3e-28
1rqg_A722 Methionyl-Trna Synthetase From Pyrococcus Abyssi Le 4e-13
1mkh_A107 C-Terminal Domain Of Methionyl-Trna Synthetase From 1e-12
3ers_X118 Crystal Structure Of E. Coli Trbp111 Length = 118 5e-08
1pyb_A111 Crystal Structure Of Aquifex Aeolicus Trbp111: A St 1e-07
2cwp_A112 Crystal Structure Of Metrs Related Protein From Pyr 4e-06
>pdb|1EUJ|A Chain A, A Novel Anti-Tumor Cytokine Contains A Rna-Binding Motif Present In Aminoacyl-Trna Synthetases Length = 166 Back     alignment and structure 
Iteration: 1

 Score =  144 bits (363), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 71/148 (47%), Positives = 103/148 (69%), Gaps = 2/148 (1%)
Query: 244 KELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRV 303
           K + VS L++++G I  + KHP ADSL VEE+DVGE   R VVSGL  +   + + NR V
Sbjct: 2   KPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMV 61
Query: 304 ALITNVKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLN 363
            L+ N+KP K+R V+S+ +V+CAS+ +   +E L PP G+  G+RI+F    G+P++ LN
Sbjct: 62  ILLCNLKPAKMRGVLSQAMVMCASSPE--KIEILAPPNGSVPGDRITFDAFPGEPDKELN 119
Query: 364 PKKKQLEKITPNLFTDDKGVATFKGIPF 391
           PKKK  E+I P+L T+D+ VAT+KG+PF
Sbjct: 120 PKKKIWEQIQPDLHTNDECVATYKGVPF 147
>pdb|1E7Z|A Chain A, Crystal Structure Of The Emap2RNA BINDING DOMAIN OF THE P43 Protein From Human Aminoacyl-Trna Synthetase Complex Length = 174 Back     alignment and structure
>pdb|1FL0|A Chain A, Crystal Structure Of The Emap2RNA-Binding Domain Of The P43 Protein From Human Aminoacyl-Trna Synthetase Complex Length = 171 Back     alignment and structure
>pdb|1NTG|A Chain A, Crystal Structure Of The Emap Ii-Like Cytokine Released From Human Tyrosyl-Trna Synthetase Length = 172 Back     alignment and structure
>pdb|1RQG|A Chain A, Methionyl-Trna Synthetase From Pyrococcus Abyssi Length = 722 Back     alignment and structure
>pdb|1MKH|A Chain A, C-Terminal Domain Of Methionyl-Trna Synthetase From Pyrococcus Abyssi Length = 107 Back     alignment and structure
>pdb|3ERS|X Chain X, Crystal Structure Of E. Coli Trbp111 Length = 118 Back     alignment and structure
>pdb|1PYB|A Chain A, Crystal Structure Of Aquifex Aeolicus Trbp111: A Stucture- Specific Trna Binding Protein Length = 111 Back     alignment and structure
>pdb|2CWP|A Chain A, Crystal Structure Of Metrs Related Protein From Pyrococcus Horikoshii Length = 112 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
1fl0_A171 Endothelial-monocyte activating polypeptide II; RN 2e-67
1ntg_A172 Tyrrs, tyrosyl-tRNA synthetase; beta barrel, ligas 2e-65
1pxf_A111 Hypothetical protein YGJH; oligonucleotide-oligosa 1e-31
1rqg_A722 Methionyl-tRNA synthetase; translation, dimerizati 1e-26
1mkh_A107 Metrs;, C-terminal domain of methionyl-tRNA synthe 5e-26
1pyb_A111 Methionyl-tRNA synthetase beta subunit; oligonucle 2e-22
2cwp_A112 Metrs related protein; structural GEN riken struct 1e-21
1gd7_A109 CSAA protein; oligonucleotide-binding fold, functi 1e-19
3g48_A112 Chaperone CSAA; structural genomics, niaid structu 2e-19
2q2i_A116 AGR_C_4014P, secretion chaperone; beta barrel, OB 9e-18
2q2h_A131 AGR_C_4014P, secretion chaperone, phage-display de 3e-17
2nzh_A113 Protein CSAA; beta barrel, oligonucleotide/oligosa 3e-17
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 1e-15
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 6e-14
2e8g_A241 Hypothetical protein PH0536; oligonucleotide/oligo 8e-12
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 7e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
3pco_B 795 Phenylalanyl-tRNA synthetase, beta chain; aminoacy 1e-07
3bu2_A199 Putative tRNA-binding protein; structural genomics 1e-06
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 6e-05
2rhq_B 795 Phenylalanyl-tRNA synthetase beta chain; heterotet 2e-04
>1fl0_A Endothelial-monocyte activating polypeptide II; RNA-binding domain, OB-fold, tRNA synthetase complex, RNA binding protein; 1.50A {Homo sapiens} SCOP: b.40.4.4 PDB: 1e7z_A 1euj_A Length = 171 Back     alignment and structure
 Score =  210 bits (536), Expect = 2e-67
 Identities = 74/165 (44%), Positives = 110/165 (66%), Gaps = 4/165 (2%)

Query: 246 LSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVAL 305
           + VS L++++G I  + KHP ADSL VEE+DVGE   R VVSGL  +   + + NR V L
Sbjct: 1   IDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVIL 60

Query: 306 ITNVKPGKLRDVMSEGLVLCASNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPK 365
           + N+KP K+R V+S+ +V+CAS+ +   +E L PP G+  G+RI+F    G+P++ LNPK
Sbjct: 61  LCNLKPAKMRGVLSQAMVMCASSPEK--IEILAPPNGSVPGDRITFDAFPGEPDKELNPK 118

Query: 366 KKQLEKITPNLFTDDKGVATFKGIPFM-TSAGPCTS-SIPKASIK 408
           KK  E+I P+L T+D+ VAT+KG+PF     G C + ++  + IK
Sbjct: 119 KKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK 163
>1ntg_A Tyrrs, tyrosyl-tRNA synthetase; beta barrel, ligase; 2.21A {Homo sapiens} SCOP: b.40.4.4 Length = 172 Back     alignment and structure
>1pxf_A Hypothetical protein YGJH; oligonucleotide-oligosaccharide binding fold, OB fold, beta- barrel; 1.87A {Escherichia coli} SCOP: b.40.4.4 PDB: 3ers_X Length = 111 Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Length = 722 Back     alignment and structure
>1mkh_A Metrs;, C-terminal domain of methionyl-tRNA synthetase; beta barrel, dimerization domain, ligase; 2.01A {Pyrococcus abyssi} SCOP: b.40.4.4 Length = 107 Back     alignment and structure
>1pyb_A Methionyl-tRNA synthetase beta subunit; oligonucleotide, oligosaccharide-binding fold, OB-fold, beta-barrel, RNA binding protein; 2.50A {Aquifex aeolicus} SCOP: b.40.4.4 Length = 111 Back     alignment and structure
>2cwp_A Metrs related protein; structural GEN riken structural genomics/proteomics initiative, RSGI; 2.10A {Pyrococcus horikoshii} Length = 112 Back     alignment and structure
>1gd7_A CSAA protein; oligonucleotide-binding fold, functional dimer, hydrophobic cavity, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: b.40.4.4 Length = 109 Back     alignment and structure
>3g48_A Chaperone CSAA; structural genomics, niaid structural centers for infectious diseases, center for structural GENO infectious diseases; 1.50A {Bacillus anthracis} Length = 112 Back     alignment and structure
>2q2i_A AGR_C_4014P, secretion chaperone; beta barrel, OB fold, homodimer, protein secretio; 1.55A {Agrobacterium tumefaciens str} Length = 116 Back     alignment and structure
>2q2h_A AGR_C_4014P, secretion chaperone, phage-display derived peptid; beta barrel, OB fold, homodimer, protein secretio; HET: CIT; 1.65A {Agrobacterium tumefaciens str} Length = 131 Back     alignment and structure
>2nzh_A Protein CSAA; beta barrel, oligonucleotide/oligosaccharide binding fold, H chaperone; 1.90A {Bacillus subtilis} PDB: 2nzo_A Length = 113 Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Length = 209 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>2e8g_A Hypothetical protein PH0536; oligonucleotide/oligosaccharide-binding fold, alpha-helices bundle, structural genomics, NPPSFA; 1.70A {Pyrococcus horikoshii} Length = 241 Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pco_B Phenylalanyl-tRNA synthetase, beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Length = 795 Back     alignment and structure
>3bu2_A Putative tRNA-binding protein; structural genomics, PSI-2, protein structure initiative; 2.70A {Staphylococcus saprophyticus subsp} Length = 199 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>2rhq_B Phenylalanyl-tRNA synthetase beta chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_B* Length = 795 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
1ntg_A172 Tyrrs, tyrosyl-tRNA synthetase; beta barrel, ligas 100.0
1fl0_A171 Endothelial-monocyte activating polypeptide II; RN 100.0
3ers_X118 TRNA-binding protein YGJH; oligonucleotide-oligosa 100.0
3g48_A112 Chaperone CSAA; structural genomics, niaid structu 99.97
1gd7_A109 CSAA protein; oligonucleotide-binding fold, functi 99.97
2cwp_A112 Metrs related protein; structural GEN riken struct 99.97
2q2h_A131 AGR_C_4014P, secretion chaperone, phage-display de 99.97
2nzh_A113 Protein CSAA; beta barrel, oligonucleotide/oligosa 99.97
1mkh_A107 Metrs;, C-terminal domain of methionyl-tRNA synthe 99.97
1pxf_A111 Hypothetical protein YGJH; oligonucleotide-oligosa 99.97
2q2i_A116 AGR_C_4014P, secretion chaperone; beta barrel, OB 99.97
1pyb_A111 Methionyl-tRNA synthetase beta subunit; oligonucle 99.97
2e8g_A241 Hypothetical protein PH0536; oligonucleotide/oligo 99.92
3bu2_A199 Putative tRNA-binding protein; structural genomics 99.89
1rqg_A722 Methionyl-tRNA synthetase; translation, dimerizati 99.87
3pco_B 795 Phenylalanyl-tRNA synthetase, beta chain; aminoacy 99.78
1b7y_B 785 Phers, protein (phenylalanyl-tRNA synthetase); enz 99.71
2rhq_B 795 Phenylalanyl-tRNA synthetase beta chain; heterotet 99.67
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.63
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.61
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.61
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.59
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.58
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 99.57
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.54
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.54
4glt_A225 Glutathione S-transferase-like protein; structural 99.53
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.5
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.49
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.49
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.49
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.48
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.48
3lyp_A215 Stringent starvation protein A; structural genomic 99.47
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.47
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.47
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.47
3lxz_A229 Glutathione S-transferase family protein; structur 99.47
3lyk_A216 Stringent starvation protein A homolog; structural 99.46
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.46
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.46
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.46
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.46
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.46
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.46
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.46
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.46
3n5o_A235 Glutathione transferase; seattle structural genomi 99.45
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.45
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.45
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.45
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.45
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.45
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.45
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.44
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.44
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.44
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.44
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.43
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.43
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.43
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.43
4exj_A238 Uncharacterized protein; transferase-like protein, 99.42
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.42
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.42
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.42
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.41
4dej_A231 Glutathione S-transferase related protein; transfe 99.41
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.41
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.41
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.4
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.39
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.39
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.39
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.39
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.38
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.38
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.38
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.38
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.38
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.38
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.38
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.38
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.38
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.38
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.37
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.37
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.37
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.37
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.36
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.36
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.35
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.35
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.35
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.35
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.35
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.35
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.35
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.34
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.34
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.34
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.33
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.33
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.32
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.32
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.32
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.31
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.29
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.29
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.29
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.26
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.26
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.25
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.25
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.24
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.19
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.18
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.16
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.15
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.11
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.11
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.09
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.06
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.06
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.06
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.03
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.01
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.0
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 98.97
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 98.91
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 98.9
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 98.86
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 98.34
>1ntg_A Tyrrs, tyrosyl-tRNA synthetase; beta barrel, ligase; 2.21A {Homo sapiens} SCOP: b.40.4.4 Back     alignment and structure
Probab=100.00  E-value=6.2e-51  Score=369.81  Aligned_cols=165  Identities=44%  Similarity=0.696  Sum_probs=158.1

Q ss_pred             cccCccccceEEEEEEEEEeCCCCCceEEEEEEccCCeeEEEEeCCCCCCCchhcCCCEEEEEeecccccccccccccee
Q 015335          244 KELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLV  323 (408)
Q Consensus       244 ~~~~~~~ldirVG~I~~~~~hp~adkL~v~~Vd~G~~~~r~IvsGl~~~~~~~~l~g~~V~v~~nlkp~k~rGv~S~gMv  323 (408)
                      .+.+|+++|||||+|++|++||+||+||+|+||+|++++||||||+.+||++++|+|++|++++||+|++|||+.|+|||
T Consensus         3 ~~~df~kl~irVG~I~~~e~hP~AdkL~v~~VD~G~~~~rqIvsG~~n~~~~eel~G~~Vvvl~nlkp~klrGv~S~GMv   82 (172)
T 1ntg_A            3 EEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGML   82 (172)
T ss_dssp             CCCCGGGSCEEEEEEEEEEECTTCSSCEEEEEECSSSSCEEEEESCTTTSCGGGTTTCEEEEECCBCCEEETTEEECCEE
T ss_pred             cccCccEeCEEEEEEEEEEECCCCCccEEEEEEeCCCcEEEEEECCCCCCChHHHCCCEEEEEEeEcceeecceecCCEE
Confidence            46789999999999999999999999999999999877999999999999999999999999999999999999999999


Q ss_pred             eeccCCC-CCceEEecCCCCCCCCceEEEcCC-CCCCCccCCcchhhHhhhCCCeeECCCeEEEECCeeeeeCCCCeee-
Q 015335          324 LCASNED-HTNVEPLLPPEGAKIGERISFSGI-DGKPEEVLNPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCTS-  400 (408)
Q Consensus       324 Lca~~~~-~~~v~ll~pp~~~~~G~~v~~~g~-~~~p~~~l~~kkk~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~~~~-  400 (408)
                      ||+.+++ +.+++|+.||+++++|++|.|+|| +++|+++||||+|+||.+|++|+|+++|+++|+|.+|+|++|+|++ 
T Consensus        83 Lcs~~e~~~~~v~il~~~~~~~~G~~v~~~g~~~~~p~~~l~~kkk~~e~~~~~l~t~~~~~a~~k~~~~~~~~g~~~~~  162 (172)
T 1ntg_A           83 LCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCK  162 (172)
T ss_dssp             CEEEEESSSEEEEECBCCBTCCTTCEEEETTCSSCCCCSSBCGGGCHHHHHHTTEEECTTSBEEETTEEEEETTEECBCS
T ss_pred             eEecccccCCCeEEEECCCCCCCCCEEEeCCcCCCCCccccCcchhhHHhhCCCcEECCCCEEEECCEEEEeCCCCEEee
Confidence            9998764 557889999999999999999999 7999999999999999999999999999999999999999999998 


Q ss_pred             ecCCcccC
Q 015335          401 SIPKASIK  408 (408)
Q Consensus       401 ~~~~~~vk  408 (408)
                      ++.||+|+
T Consensus       163 ~l~~~~i~  170 (172)
T 1ntg_A          163 SLKGGNIS  170 (172)
T ss_dssp             SCTTCEEE
T ss_pred             ecCCCEEE
Confidence            99999985
>1fl0_A Endothelial-monocyte activating polypeptide II; RNA-binding domain, OB-fold, tRNA synthetase complex, RNA binding protein; 1.50A {Homo sapiens} SCOP: b.40.4.4 PDB: 1e7z_A 1euj_A Back     alignment and structure
>3g48_A Chaperone CSAA; structural genomics, niaid structural centers for infectious diseases, center for structural GENO infectious diseases; 1.50A {Bacillus anthracis} SCOP: b.40.4.4 Back     alignment and structure
>1gd7_A CSAA protein; oligonucleotide-binding fold, functional dimer, hydrophobic cavity, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: b.40.4.4 Back     alignment and structure
>2cwp_A Metrs related protein; structural GEN riken structural genomics/proteomics initiative, RSGI; 2.10A {Pyrococcus horikoshii} Back     alignment and structure
>2q2h_A AGR_C_4014P, secretion chaperone, phage-display derived peptid; beta barrel, OB fold, homodimer, protein secretio; HET: CIT; 1.65A {Agrobacterium tumefaciens str} Back     alignment and structure
>2nzh_A Protein CSAA; beta barrel, oligonucleotide/oligosaccharide binding fold, H chaperone; 1.90A {Bacillus subtilis} PDB: 2nzo_A Back     alignment and structure
>1mkh_A Metrs;, C-terminal domain of methionyl-tRNA synthetase; beta barrel, dimerization domain, ligase; 2.01A {Pyrococcus abyssi} SCOP: b.40.4.4 Back     alignment and structure
>1pxf_A Hypothetical protein YGJH; oligonucleotide-oligosaccharide binding fold, OB fold, beta- barrel; 1.87A {Escherichia coli} PDB: 3ers_X Back     alignment and structure
>2q2i_A AGR_C_4014P, secretion chaperone; beta barrel, OB fold, homodimer, protein secretio; 1.55A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pyb_A Methionyl-tRNA synthetase beta subunit; oligonucleotide, oligosaccharide-binding fold, OB-fold, beta-barrel, RNA binding protein; 2.50A {Aquifex aeolicus} SCOP: b.40.4.4 Back     alignment and structure
>2e8g_A Hypothetical protein PH0536; oligonucleotide/oligosaccharide-binding fold, alpha-helices bundle, structural genomics, NPPSFA; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3bu2_A Putative tRNA-binding protein; structural genomics, PSI-2, protein structure initiative; 2.70A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Back     alignment and structure
>3pco_B Phenylalanyl-tRNA synthetase, beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Back     alignment and structure
>1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: a.6.1.1 a.6.1.1 b.40.4.4 b.153.1.1 d.58.13.1 d.104.1.1 PDB: 1b70_B* 1eiy_B 1jjc_B* 1pys_B 2akw_B* 2aly_B* 2amc_B* 3hfz_B* 3teh_B* 2iy5_B* Back     alignment and structure
>2rhq_B Phenylalanyl-tRNA synthetase beta chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_B* Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 408
d1ntga_171 b.40.4.4 (A:) C-terminal domain of metazoan tyrosy 4e-42
d1fl0a_164 b.40.4.4 (A:) EMAP II {Human (Homo sapiens) [TaxId 3e-40
d1pxfa_111 b.40.4.4 (A:) Structure-specific tRNA-binding prot 4e-21
d1mkha_107 b.40.4.4 (A:) C-terminal domain of methionyl-tRNA 6e-20
d1pyba_107 b.40.4.4 (A:) Structure-specific tRNA-binding prot 1e-18
d1gd7a_109 b.40.4.4 (A:) TRBP111 homolog CsaA {Thermus thermo 4e-16
d2hrkb1118 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, 2e-11
d1k0da1151 a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni 2e-04
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 5e-04
d1r5aa1129 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano 0.001
d1aw9a1135 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays 0.002
d1gnwa1126 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress 0.003
d1jlva1123 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano 0.004
>d1ntga_ b.40.4.4 (A:) C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Myf domain
domain: C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  143 bits (363), Expect = 4e-42
 Identities = 72/167 (43%), Positives = 104/167 (62%), Gaps = 3/167 (1%)

Query: 244 KELSVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRV 303
           +E+  S L+I+VG I    KHP ADSL VE+IDVGEA+ R VVSGL ++   ++L +R V
Sbjct: 2   EEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV 61

Query: 304 ALITNVKPGKLRDVMSEGLVLCASNED-HTNVEPLLPPEGAKIGERISFSGI-DGKPEEV 361
            ++ N+KP K+R V S+G++LCAS E  +  VEPL PP G+  GE +   G   G+P+E 
Sbjct: 62  VVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEE 121

Query: 362 LNPKKKQLEKITPNLFTDDKGVATFKGIPFMTSAGPCTS-SIPKASI 407
           L PKKK  EK+  +    ++ +A +K   FMT  G  +  S+   +I
Sbjct: 122 LKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNI 168
>d1fl0a_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1pxfa_ b.40.4.4 (A:) Structure-specific tRNA-binding protein TRBP111 {Escherichia coli [TaxId: 562]} Length = 111 Back     information, alignment and structure
>d1mkha_ b.40.4.4 (A:) C-terminal domain of methionyl-tRNA synthetase, MetRS-CD {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 107 Back     information, alignment and structure
>d1pyba_ b.40.4.4 (A:) Structure-specific tRNA-binding protein TRBP111 {Aquifex aeolicus [TaxId: 63363]} Length = 107 Back     information, alignment and structure
>d1gd7a_ b.40.4.4 (A:) TRBP111 homolog CsaA {Thermus thermophilus [TaxId: 274]} Length = 109 Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 118 Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135 Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
d1fl0a_164 EMAP II {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ntga_171 C-terminal domain of metazoan tyrosyl-tRNA synthet 100.0
d1pyba_107 Structure-specific tRNA-binding protein TRBP111 {A 99.98
d1pxfa_111 Structure-specific tRNA-binding protein TRBP111 {E 99.97
d1mkha_107 C-terminal domain of methionyl-tRNA synthetase, Me 99.97
d1gd7a_109 TRBP111 homolog CsaA {Thermus thermophilus [TaxId: 99.96
d1jjcb3113 Domain B2 of PheRS-beta, PheT {Thermus thermophilu 99.8
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 99.63
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.61
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.59
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.57
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.56
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.52
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.52
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.51
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.51
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.5
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.5
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.45
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.43
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.38
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.33
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.32
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.31
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.27
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.21
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.15
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.15
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.14
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.13
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.11
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 99.11
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.08
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.08
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.05
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 98.93
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 98.91
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 98.91
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 98.86
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 98.75
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 98.64
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 98.42
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 97.86
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 88.5
>d1fl0a_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Myf domain
domain: EMAP II
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5e-45  Score=327.63  Aligned_cols=160  Identities=46%  Similarity=0.807  Sum_probs=152.8

Q ss_pred             CccccceEEEEEEEEEeCCCCCceEEEEEEccCCeeEEEEeCCCCCCCchhcCCCEEEEEeeccccccccccccceeeec
Q 015335          247 SVSLLNIQVGLIRKSWKHPSADSLLVEEIDVGEAKLRQVVSGLAKYCNPDDLTNRRVALITNVKPGKLRDVMSEGLVLCA  326 (408)
Q Consensus       247 ~~~~ldirVG~I~~~~~hp~adkL~v~~Vd~G~~~~r~IvsGl~~~~~~~~l~g~~V~v~~nlkp~k~rGv~S~gMvLca  326 (408)
                      ||++||||||+|++|++||+||+||+|+||+|++++||||||+.++|++++++|++|++++||||++|||+.|+|||||+
T Consensus         2 Df~kldirVGkI~~~~~hP~adkL~v~~VD~G~~~~~~Iv~g~~~~~~~~~l~g~~v~~~~nlkp~kirGv~SeGMllsa   81 (164)
T d1fl0a_           2 DVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCA   81 (164)
T ss_dssp             CGGGSCEEEEEEEEEEEETTEEEEEEEEEECSSSSCEEEEECCTTTSCGGGGTTEEEEEECCSCCEESSSCEECCEECEE
T ss_pred             CccceeEEEEEEEEEEECCCCCcceEEEEEccCCceEEEEeeccccccchhccCccccccccccccccCceEcceEEEee
Confidence            79999999999999999999999999999999989999999999999999999999999999999999999999998888


Q ss_pred             cCCCCCceEEecCCCCCCCCceEEEcCCCCCCCccCCcchhhHhhhCCCeeECCCeEEEECCeeeee-CCCCeee-ecCC
Q 015335          327 SNEDHTNVEPLLPPEGAKIGERISFSGIDGKPEEVLNPKKKQLEKITPNLFTDDKGVATFKGIPFMT-SAGPCTS-SIPK  404 (408)
Q Consensus       327 ~~~~~~~v~ll~pp~~~~~G~~v~~~g~~~~p~~~l~~kkk~~~~~~~~l~~~~~~~~~~~~~~~~~-~~g~~~~-~~~~  404 (408)
                      ++++  +++++.||+++++|++|+|+|++++|+.+++||++.|+.++++|+++++|+++|+|.++.+ +.|+|++ ++.|
T Consensus        82 ~~~~--~~~ll~~p~~~~~G~~v~~~~~~~~~~~~l~~k~~~~~~i~~~l~~n~~~~~~~~g~~~~~~~~g~~~~~~l~~  159 (164)
T d1fl0a_          82 SSPE--KIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSN  159 (164)
T ss_dssp             EETT--EEEECBCCTTCCTTCBCCCTTSCCCCCSSCCTTTCTHHHHGGGEEECTTSBEEETTEECEETTTEECBCSSCCS
T ss_pred             eCCC--ccEEEeCCCCCCCCCEEEecccCCCCchhcCcccchhHhhccCcEECCCCEEEECCEEeeeccCCCEEcccCCC
Confidence            7654  5788999999999999999999999999999999999999999999999999999999954 6899999 8999


Q ss_pred             cccC
Q 015335          405 ASIK  408 (408)
Q Consensus       405 ~~vk  408 (408)
                      +.||
T Consensus       160 ~~Ik  163 (164)
T d1fl0a_         160 SGIK  163 (164)
T ss_dssp             CEEC
T ss_pred             Ceee
Confidence            9997
>d1ntga_ b.40.4.4 (A:) C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pyba_ b.40.4.4 (A:) Structure-specific tRNA-binding protein TRBP111 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pxfa_ b.40.4.4 (A:) Structure-specific tRNA-binding protein TRBP111 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkha_ b.40.4.4 (A:) C-terminal domain of methionyl-tRNA synthetase, MetRS-CD {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gd7a_ b.40.4.4 (A:) TRBP111 homolog CsaA {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjcb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure