Citrus Sinensis ID: 015393
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 408 | ||||||
| 255547716 | 394 | conserved hypothetical protein [Ricinus | 0.941 | 0.974 | 0.729 | 1e-164 | |
| 225425418 | 385 | PREDICTED: F-box protein At1g67340-like | 0.894 | 0.948 | 0.777 | 1e-160 | |
| 224053499 | 403 | predicted protein [Populus trichocarpa] | 0.906 | 0.918 | 0.736 | 1e-160 | |
| 224075553 | 403 | predicted protein [Populus trichocarpa] | 0.909 | 0.920 | 0.731 | 1e-159 | |
| 356512373 | 394 | PREDICTED: F-box protein At1g67340-like | 0.941 | 0.974 | 0.672 | 1e-154 | |
| 356525160 | 391 | PREDICTED: F-box protein At1g67340-like | 0.933 | 0.974 | 0.686 | 1e-153 | |
| 449435083 | 382 | PREDICTED: F-box protein At1g67340-like | 0.914 | 0.976 | 0.719 | 1e-149 | |
| 356540140 | 350 | PREDICTED: F-box protein At1g67340-like | 0.840 | 0.98 | 0.725 | 1e-148 | |
| 356566106 | 348 | PREDICTED: F-box protein At1g67340-like | 0.801 | 0.939 | 0.748 | 1e-148 | |
| 297838467 | 375 | zinc finger family protein [Arabidopsis | 0.838 | 0.912 | 0.734 | 1e-146 |
| >gi|255547716|ref|XP_002514915.1| conserved hypothetical protein [Ricinus communis] gi|223545966|gb|EEF47469.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 585 bits (1508), Expect = e-164, Method: Compositional matrix adjust.
Identities = 305/418 (72%), Positives = 337/418 (80%), Gaps = 34/418 (8%)
Query: 1 MRTKRGLCYPRVVDVCLGQRVVPVNDKKRRGF--------SSGEPKTTYRKKARFSPD-V 51
M+T+RGLCYPR + L +R+V KRR ++GE + RK+ R SP+ +
Sbjct: 1 MKTRRGLCYPRTDALDLDKRLV-----KRRKLGEIIAAATATGE-QMVCRKRQRLSPEKI 54
Query: 52 AG-KSDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKT 110
AG K+D F ALPDDLV ILCKLSS+A CPSDFVNVL TCKR+NGL LNS+VLSKAS KT
Sbjct: 55 AGDKTDFFYALPDDLVTCILCKLSSSASCPSDFVNVLATCKRLNGLGLNSIVLSKASPKT 114
Query: 111 FAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQA 170
FA+KA NWS+SAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHA A
Sbjct: 115 FALKAKNWSDSAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAPA 174
Query: 171 LYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEG 230
LYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEG
Sbjct: 175 LYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEG 234
Query: 231 RRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGC 290
RRFLVQANARELAAVLS+ ++TR+W+ WNP + + NH H +G GC
Sbjct: 235 RRFLVQANARELAAVLSNPN-SDLNTRAWVNWNP-----------HAHSNHR-HASGPGC 281
Query: 291 PLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSV 350
PLLSDFGCNVPAPEAHPASRF+A+WFA RGG+PG GLRLCSHVGCGRPETR+HEFRRCSV
Sbjct: 282 PLLSDFGCNVPAPEAHPASRFMADWFATRGGSPGQGLRLCSHVGCGRPETRKHEFRRCSV 341
Query: 351 CGAVNYCSRACQALDWKLRHKADCAPAERWLDEEGNGDVDVDLNDAEGGGEDNVVADS 408
CGAVNYCSRACQALDWKLRHK +CAP ERW+ E+G G G G NVV DS
Sbjct: 342 CGAVNYCSRACQALDWKLRHKEECAPVERWVVEDGEGG-----EAGVGDGNQNVVVDS 394
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225425418|ref|XP_002271442.1| PREDICTED: F-box protein At1g67340-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224053499|ref|XP_002297844.1| predicted protein [Populus trichocarpa] gi|222845102|gb|EEE82649.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224075553|ref|XP_002304680.1| predicted protein [Populus trichocarpa] gi|222842112|gb|EEE79659.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356512373|ref|XP_003524894.1| PREDICTED: F-box protein At1g67340-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356525160|ref|XP_003531195.1| PREDICTED: F-box protein At1g67340-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449435083|ref|XP_004135325.1| PREDICTED: F-box protein At1g67340-like [Cucumis sativus] gi|449494931|ref|XP_004159686.1| PREDICTED: F-box protein At1g67340-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356540140|ref|XP_003538548.1| PREDICTED: F-box protein At1g67340-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356566106|ref|XP_003551276.1| PREDICTED: F-box protein At1g67340-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297838467|ref|XP_002887115.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297332956|gb|EFH63374.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 408 | ||||||
| TAIR|locus:2019604 | 379 | AT1G67340 "AT1G67340" [Arabido | 0.833 | 0.897 | 0.745 | 2.6e-141 | |
| TAIR|locus:2177522 | 336 | AT5G50450 [Arabidopsis thalian | 0.617 | 0.75 | 0.585 | 1.3e-70 | |
| ASPGD|ASPL0000075121 | 807 | AN8765 [Emericella nidulans (t | 0.563 | 0.285 | 0.288 | 3.3e-05 | |
| UNIPROTKB|G4NGF6 | 1240 | MGG_04327 "Uncharacterized pro | 0.107 | 0.035 | 0.5 | 5.5e-05 | |
| TAIR|locus:2121959 | 1008 | UBP16 "ubiquitin-specific prot | 0.127 | 0.051 | 0.442 | 0.00032 | |
| UNIPROTKB|Q8E8U7 | 484 | SO_4559 "Sel1 domain-containin | 0.323 | 0.272 | 0.312 | 0.00043 | |
| TIGR_CMR|SO_4559 | 484 | SO_4559 "conserved domain prot | 0.323 | 0.272 | 0.312 | 0.00043 | |
| UNIPROTKB|Q74B01 | 213 | GSU2395 "Uncharacterized prote | 0.372 | 0.713 | 0.257 | 0.00061 | |
| TIGR_CMR|GSU_2395 | 213 | GSU_2395 "conserved hypothetic | 0.372 | 0.713 | 0.257 | 0.00061 |
| TAIR|locus:2019604 AT1G67340 "AT1G67340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1382 (491.5 bits), Expect = 2.6e-141, P = 2.6e-141
Identities = 267/358 (74%), Positives = 298/358 (83%)
Query: 49 PDVAGKSDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASK 108
P+ +DL D++PDDLV+SILCKL ST+RCP+DF+NVL+TCKR+ GLA+N +VLS+ S
Sbjct: 35 PENTTGADLLDSIPDDLVISILCKLGSTSRCPADFINVLLTCKRLKGLAMNPIVLSRLSP 94
Query: 109 KTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHA 168
K A+KA+NWSE +HRFLK C DAG++EACYTLGMIRFYCLQNRG+GASLMAKAAISSHA
Sbjct: 95 KAIAVKAHNWSEYSHRFLKRCVDAGSLEACYTLGMIRFYCLQNRGNGASLMAKAAISSHA 154
Query: 169 QALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIA 228
ALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGH+DALRELGHCLQDGYGV QN++
Sbjct: 155 PALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHVDALRELGHCLQDGYGVPQNVS 214
Query: 229 EGRRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGI 288
EGRRFLVQANARELAAVLSS GI RS TW LSQP P P PNH G T
Sbjct: 215 EGRRFLVQANARELAAVLSS----GIQARS--TWLSLSQP-PPPVV----PNH-GQQT-- 260
Query: 289 GCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGT-PGPGLRLCSHVGCGRPETRRHEFRR 347
CPLLSDFGCNVPAPE HPA+RFLA+WFA RGG PG GLRLCSH GCGRPETR+HEFRR
Sbjct: 261 -CPLLSDFGCNVPAPETHPANRFLADWFAVRGGDCPGDGLRLCSHAGCGRPETRKHEFRR 319
Query: 348 CSVCGAVNYCSRACQALDWKLRHKADCAPAERWLDEEGNGDVDVDLNDAEGGGEDNVV 405
CSVCG VNYCSRACQALDWKLRHK DCAP +RWL+E G+ +V + D G G DNV+
Sbjct: 320 CSVCGVVNYCSRACQALDWKLRHKMDCAPVQRWLEEGDGGEGNVQI-DGNGNG-DNVL 375
|
|
| TAIR|locus:2177522 AT5G50450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000075121 AN8765 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NGF6 MGG_04327 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121959 UBP16 "ubiquitin-specific protease 16" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8E8U7 SO_4559 "Sel1 domain-containing protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_4559 SO_4559 "conserved domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74B01 GSU2395 "Uncharacterized protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2395 GSU_2395 "conserved hypothetical protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0008009901 | hypothetical protein (403 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 408 | |||
| COG0790 | 292 | COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily | 7e-11 | |
| pfam01753 | 39 | pfam01753, zf-MYND, MYND finger | 9e-08 | |
| COG0790 | 292 | COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily | 7e-05 | |
| COG0790 | 292 | COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily | 3e-04 | |
| COG0790 | 292 | COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily | 0.003 |
| >gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
Score = 62.4 bits (151), Expect = 7e-11
Identities = 30/137 (21%), Positives = 58/137 (42%), Gaps = 7/137 (5%)
Query: 114 KANNWSESAHRFLKLCADAGNVEACYTLGMIRFY---CLQNRGSGASLMAKAAISSHAQA 170
+ + +++A + + A G EA + LG++ + KAA + +A
Sbjct: 89 VSRDKTKAAD-WYRCAAADGLAEALFNLGLMYANGRGVPLDLVKALKYYEKAAKLGNVEA 147
Query: 171 ---LYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNI 227
+Y L + +G D + + L +AA LG+ DA LG + G GV +++
Sbjct: 148 ALAMYRLGLAYLSGLQALAVAYDDKKALYLYRKAAELGNPDAQLLLGRMYEKGLGVPRDL 207
Query: 228 AEGRRFLVQANARELAA 244
+ R+ +A + A
Sbjct: 208 KKAFRWYKKAAEQGDGA 224
|
Length = 292 |
| >gnl|CDD|201954 pfam01753, zf-MYND, MYND finger | Back alignment and domain information |
|---|
| >gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 408 | |||
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 99.84 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 99.75 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 99.73 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 99.62 | |
| KOG4014 | 248 | consensus Uncharacterized conserved protein (conta | 99.46 | |
| KOG4014 | 248 | consensus Uncharacterized conserved protein (conta | 99.43 | |
| PF01753 | 37 | zf-MYND: MYND finger; InterPro: IPR002893 Zinc fin | 98.71 | |
| smart00671 | 36 | SEL1 Sel1-like repeats. These represent a subfamil | 98.48 | |
| PF08238 | 39 | Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r | 98.43 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.33 | |
| smart00671 | 36 | SEL1 Sel1-like repeats. These represent a subfamil | 98.32 | |
| PF08238 | 39 | Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r | 98.26 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 98.23 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.16 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.07 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 98.07 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 97.93 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 97.87 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.84 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.8 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.79 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.77 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 97.76 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.69 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.68 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 97.67 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.63 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.62 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 97.57 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 97.56 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.56 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.52 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.48 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.46 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.35 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.33 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.33 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 97.33 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.28 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 97.26 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.25 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.23 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.22 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 97.2 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.18 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.18 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.17 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 97.16 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 97.03 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.97 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 96.97 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 96.94 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 96.89 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.88 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 96.84 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 96.81 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 96.79 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 96.77 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 96.73 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 96.59 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 96.56 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.54 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 96.52 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.46 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 96.44 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 96.44 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 96.41 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 96.39 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.37 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 96.36 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.32 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.27 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.26 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 96.26 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 96.23 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 96.21 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 96.16 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.14 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 96.08 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 96.05 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 96.02 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 96.01 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 95.98 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 95.89 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 95.85 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 95.75 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 95.74 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 95.5 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 95.25 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 95.13 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 95.01 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 95.01 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 94.98 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 94.97 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 94.91 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 94.64 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 94.64 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 94.58 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 94.47 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 94.46 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 94.44 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 94.42 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 94.37 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 94.1 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 94.02 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 93.98 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 93.97 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 93.86 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 93.7 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 93.59 | |
| KOG3612 | 588 | consensus PHD Zn-finger protein [General function | 93.56 | |
| KOG2061 | 362 | consensus Uncharacterized MYND Zn-finger protein [ | 93.48 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 93.44 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 93.42 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 93.3 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 93.27 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 93.25 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 93.24 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 93.03 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 93.02 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 92.98 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 92.88 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 92.81 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 92.8 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 92.77 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 92.68 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 92.65 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 92.63 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 92.56 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 92.55 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 92.51 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 92.18 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 91.66 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 91.62 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 91.49 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 91.46 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 91.43 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 91.26 | |
| PLN02789 | 320 | farnesyltranstransferase | 90.97 | |
| PLN02789 | 320 | farnesyltranstransferase | 90.82 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 90.26 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 89.81 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 89.52 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 89.31 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 89.29 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 89.28 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 89.23 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 89.01 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 88.83 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 88.69 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 88.5 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 88.09 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 87.99 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 87.88 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 87.57 | |
| PLN03158 | 396 | methionine aminopeptidase; Provisional | 87.26 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 86.92 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 86.7 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 86.37 | |
| PF13824 | 55 | zf-Mss51: Zinc-finger of mitochondrial splicing su | 86.25 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 86.03 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 85.71 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 84.78 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 84.62 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 84.34 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 84.19 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 84.07 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 84.01 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 83.81 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 83.71 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 83.62 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 83.35 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 82.51 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 81.53 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 81.03 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 80.16 |
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.84 E-value=7.9e-20 Score=177.87 Aligned_cols=131 Identities=23% Similarity=0.276 Sum_probs=121.6
Q ss_pred hcCCHHHHHHHHHHHHHcCCHHHHHHhHHHHhh---ccCCHHHHHHHHHHHHhcCcHHH---HHHHHHHHHcC---CCCC
Q 015393 115 ANNWSESAHRFLKLCADAGNVEACYTLGMIRFY---CLQNRGSGASLMAKAAISSHAQA---LYSLAVIQFNG---SGGS 185 (408)
Q Consensus 115 ~~~~~~~A~~~l~~aAe~G~~~A~~~LG~~y~~---~~~d~~~A~~~~~kAA~~G~~~A---~~~Lg~~y~~G---~Gv~ 185 (408)
...+..+|+.||+.+++.|++.++++||.+|.. +.+|..+|+.||++||++|+++| ++.||.+|..| .++.
T Consensus 89 v~~~~~~A~~~~~~~a~~g~~~a~~~lg~~~~~G~gv~~d~~~A~~~~~~Aa~~g~~~a~~~~~~l~~~~~~g~~~~~~~ 168 (292)
T COG0790 89 VSRDKTKAADWYRCAAADGLAEALFNLGLMYANGRGVPLDLVKALKYYEKAAKLGNVEAALAMYRLGLAYLSGLQALAVA 168 (292)
T ss_pred ccccHHHHHHHHHHHhhcccHHHHHhHHHHHhcCCCcccCHHHHHHHHHHHHHcCChhHHHHHHHHHHHHHcChhhhccc
Confidence 344578999999999999999999999999994 56899999999999999999999 99999999999 7876
Q ss_pred CCccCHHHHHHHHHHHHhCCCHHHHHHHHHHHHcCCCccccHHHHHHHHHHHHHcCCHHHHhh
Q 015393 186 KNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSS 248 (408)
Q Consensus 186 ~~~~d~~kA~~~~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~d~~~A~~w~~kAA~~G~~~A~~~ 248 (408)
. +..+|+.||.+|+++|++.|++.||.+|..|.||++|.++|++||.+|+++|+..+...
T Consensus 169 ~---~~~~A~~~~~~aa~~~~~~a~~~lg~~y~~G~Gv~~d~~~A~~wy~~Aa~~g~~~a~~~ 228 (292)
T COG0790 169 Y---DDKKALYLYRKAAELGNPDAQLLLGRMYEKGLGVPRDLKKAFRWYKKAAEQGDGAACYN 228 (292)
T ss_pred H---HHHhHHHHHHHHHHhcCHHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHHHCCCHHHHHH
Confidence 6 88899999999999999999999999999999999999999999999999999665554
|
|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] | Back alignment and domain information |
|---|
| >KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] | Back alignment and domain information |
|---|
| >PF01753 zf-MYND: MYND finger; InterPro: IPR002893 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00671 SEL1 Sel1-like repeats | Back alignment and domain information |
|---|
| >PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00671 SEL1 Sel1-like repeats | Back alignment and domain information |
|---|
| >PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG3612 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2061 consensus Uncharacterized MYND Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03158 methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13824 zf-Mss51: Zinc-finger of mitochondrial splicing suppressor 51 | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 408 | |||
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 1e-14 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 6e-14 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 3e-13 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 1e-11 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 1e-10 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 1e-14 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 2e-14 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 8e-14 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 1e-13 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 1e-13 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 2e-13 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 4e-13 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 8e-08 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 6e-05 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 2e-04 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 3e-13 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 2e-10 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 4e-12 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 4e-08 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 6e-12 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 1e-11 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 2e-11 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 4e-08 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 9e-08 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 2e-07 | |
| 2od1_A | 60 | Protein CBFA2T1; zinc finger, cross-braced topolog | 2e-09 | |
| 2odd_A | 64 | Protein CBFA2T1; MYND zinc finger, cross-braced to | 3e-09 | |
| 2jw6_A | 52 | Deformed epidermal autoregulatory factor 1 homolo; | 1e-08 | |
| 2dj8_A | 60 | Protein CBFA2T1; zinc finger MYND domain, protein | 2e-08 | |
| 2d8q_A | 70 | BLU protein, zinc finger MYND domain containing pr | 4e-08 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 1e-04 |
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
Score = 72.6 bits (179), Expect = 1e-14
Identities = 25/121 (20%), Positives = 52/121 (42%), Gaps = 6/121 (4%)
Query: 120 ESAHRFLKLCADAGNVEACYTLGMIRFYCL---QNRGSGASLMAKAAISSHAQALYSLAV 176
A ++ + D C+ LG++ + +N AS AKA +++ + L
Sbjct: 23 TQAKKYFEKACDLKENSGCFNLGVLYYQGQGVEKNLKKAASFYAKACDLNYSNGCHLLGN 82
Query: 177 IQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQ 236
+ ++G G S+N +A + ++A L + + LG DG V ++ + + +
Sbjct: 83 LYYSGQGVSQNTN--KA-LQYYSKACDLKYAEGCASLGGIYHDGKVVTRDFKKAVEYFTK 139
Query: 237 A 237
A
Sbjct: 140 A 140
|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >2od1_A Protein CBFA2T1; zinc finger, cross-braced topology, metal binding protein; NMR {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2odd_A Protein CBFA2T1; MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, metal binding protein; NMR {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2jw6_A Deformed epidermal autoregulatory factor 1 homolo; zinc binding domain, transcription, alternative splicing, DI mutation, DNA-binding; NMR {Homo sapiens} SCOP: g.85.1.1 Length = 52 | Back alignment and structure |
|---|
| >2dj8_A Protein CBFA2T1; zinc finger MYND domain, protein MTG8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.85.1.1 Length = 60 | Back alignment and structure |
|---|
| >2d8q_A BLU protein, zinc finger MYND domain containing protein 10; zmynd10, ZF-MYND, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.1 PDB: 2dan_A Length = 70 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 408 | |||
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 99.93 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.88 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.88 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 99.87 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 99.86 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 99.79 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 99.79 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 99.79 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.71 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.7 | |
| 2d8q_A | 70 | BLU protein, zinc finger MYND domain containing pr | 98.88 | |
| 2od1_A | 60 | Protein CBFA2T1; zinc finger, cross-braced topolog | 98.8 | |
| 2dj8_A | 60 | Protein CBFA2T1; zinc finger MYND domain, protein | 98.8 | |
| 2odd_A | 64 | Protein CBFA2T1; MYND zinc finger, cross-braced to | 98.77 | |
| 2jw6_A | 52 | Deformed epidermal autoregulatory factor 1 homolo; | 98.76 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 98.64 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.59 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.58 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 98.55 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.5 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.48 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.46 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.42 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.41 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 98.4 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.4 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.39 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.38 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 98.38 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.38 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.37 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.35 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.33 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.3 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.29 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 98.28 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 98.25 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.24 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 98.22 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.21 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.2 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.19 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 98.18 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 98.17 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 98.16 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 98.16 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.16 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.15 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 98.15 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.15 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.12 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.11 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.11 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.1 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.1 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.09 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 98.09 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.08 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 98.08 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 98.08 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 98.08 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 98.08 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 98.07 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.07 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 98.06 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 98.06 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.06 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.06 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 98.06 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.05 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.03 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.03 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.03 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 98.03 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.03 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.02 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.02 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.01 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.01 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.99 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.98 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.97 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.97 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.96 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.96 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.95 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.95 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.95 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.95 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.94 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.94 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.94 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.93 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 97.92 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 97.92 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.91 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 97.91 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.9 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.89 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.89 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 97.89 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.89 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 97.89 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.88 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.87 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.87 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.86 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.85 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.85 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.83 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.82 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.81 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.8 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.8 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.79 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.79 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.78 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.78 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 97.77 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.77 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 97.77 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.76 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 97.75 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.74 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.73 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.71 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.71 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 97.71 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.71 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.7 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.7 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.7 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 97.69 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.69 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.69 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.68 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 97.68 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.67 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.67 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.67 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.65 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.65 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.64 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.64 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.63 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.62 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 97.61 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.61 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.6 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.6 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.6 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.55 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.55 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 97.54 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.54 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 97.54 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.54 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.51 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 97.49 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.49 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.48 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.47 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.47 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 97.47 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.45 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.45 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.44 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.43 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.43 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.42 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.41 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 97.4 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.39 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.39 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 97.32 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 97.31 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 97.29 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.18 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.17 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 97.12 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 97.03 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.99 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 96.94 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 96.89 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 96.87 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.76 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.71 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 96.5 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 96.47 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.43 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 96.37 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 96.15 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 95.9 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.86 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 95.72 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 95.66 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 95.62 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 95.53 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.28 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 95.25 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 95.14 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 95.13 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 94.82 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 94.5 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 93.86 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 93.56 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 93.04 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 92.99 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 92.98 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 92.7 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 92.54 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 92.43 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 92.25 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 91.87 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 90.91 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 90.01 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 87.38 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 86.5 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 84.41 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 83.25 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 82.76 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 82.51 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 82.31 | |
| 2yqq_A | 56 | Zinc finger HIT domain-containing protein 3; struc | 82.21 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 81.63 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 80.58 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 80.38 |
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
Probab=99.93 E-value=7.1e-25 Score=188.79 Aligned_cols=126 Identities=18% Similarity=0.113 Sum_probs=119.4
Q ss_pred CHHHHHHHHHHHHHcCCHHHHHHhHHHHhhccCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHcCCCCCCCccCHHHHHHH
Q 015393 118 WSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVAL 197 (408)
Q Consensus 118 ~~~~A~~~l~~aAe~G~~~A~~~LG~~y~~~~~d~~~A~~~~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~~~~d~~kA~~~ 197 (408)
+.++|+.||+++++.|++.|+ ||.+|.. ..+.++|++||++|++.|++.|+++||.+|..|.|+++ |+.+|++|
T Consensus 10 d~~~A~~~~~~aa~~g~~~a~--lg~~y~~-g~~~~~A~~~~~~Aa~~g~~~a~~~Lg~~y~~G~g~~~---d~~~A~~~ 83 (138)
T 1klx_A 10 DLKKAIQYYVKACELNEMFGC--LSLVSNS-QINKQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKK---DLRKAAQY 83 (138)
T ss_dssp HHHHHHHHHHHHHHTTCTTHH--HHHHTCT-TSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHCSSSCC---CHHHHHHH
T ss_pred CHHHHHHHHHHHHcCCCHhhh--HHHHHHc-CCCHHHHHHHHHHHHcCCCHHHHHHHHHHHHcCCCCCc---cHHHHHHH
Confidence 467999999999999999999 9999984 46677899999999999999999999999999999888 99999999
Q ss_pred HHHHHhCCCHHHHHHHHHHHHcCCCccccHHHHHHHHHHHHHcCCHHHHhhh
Q 015393 198 CARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSA 249 (408)
Q Consensus 198 ~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~d~~~A~~w~~kAA~~G~~~A~~~~ 249 (408)
|++|++.|++.|+++||.+|..|.||++|.++|++||++|++.|++.|+...
T Consensus 84 ~~~Aa~~g~~~a~~~Lg~~y~~G~g~~~d~~~A~~~~~~Aa~~g~~~A~~~l 135 (138)
T 1klx_A 84 YSKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDACGIL 135 (138)
T ss_dssp HHHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHHHHHHHTTCHHHHHHC
T ss_pred HHHHHcCCCHHHHHHHHHHHHCCCCCCcCHHHHHHHHHHHHHCCCHHHHHHH
Confidence 9999999999999999999999999999999999999999999999998764
|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2d8q_A BLU protein, zinc finger MYND domain containing protein 10; zmynd10, ZF-MYND, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.1 PDB: 2dan_A | Back alignment and structure |
|---|
| >2od1_A Protein CBFA2T1; zinc finger, cross-braced topology, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dj8_A Protein CBFA2T1; zinc finger MYND domain, protein MTG8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.85.1.1 | Back alignment and structure |
|---|
| >2odd_A Protein CBFA2T1; MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw6_A Deformed epidermal autoregulatory factor 1 homolo; zinc binding domain, transcription, alternative splicing, DI mutation, DNA-binding; NMR {Homo sapiens} SCOP: g.85.1.1 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2yqq_A Zinc finger HIT domain-containing protein 3; structure genomics, ZF-HIT domain, TRIP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 408 | ||||
| d2jw6a1 | 38 | g.85.1.1 (A:503-540) Zinc finger MYND domain-conta | 2e-07 | |
| d2dj8a1 | 47 | g.85.1.1 (A:8-54) Zinc finger MYND domain-containi | 2e-07 | |
| d2dana1 | 47 | g.85.1.1 (A:8-54) Zinc finger MYND domain-containi | 6e-07 | |
| d1ouva_ | 265 | a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He | 4e-04 |
| >d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
class: Small proteins fold: HIT/MYND zinc finger-like superfamily: HIT/MYND zinc finger-like family: MYND zinc finger domain: Zinc finger MYND domain-containing protein 2, MTG8 species: Human (Homo sapiens) [TaxId: 9606]
Score = 44.6 bits (105), Expect = 2e-07
Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 6/42 (14%)
Query: 333 VGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADC 374
V CGR C+ C VNYCS CQ DWK H+ C
Sbjct: 3 VNCGREAMSE-----CTGCHKVNYCSTFCQRKDWK-DHQHIC 38
|
| >d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 408 | |||
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 99.93 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 99.83 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 99.78 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 99.75 | |
| d2dana1 | 47 | Zinc finger MYND domain-containing protein 10, ZMY | 99.14 | |
| d2jw6a1 | 38 | Zinc finger MYND domain-containing protein 2, MTG8 | 99.08 | |
| d2dj8a1 | 47 | Zinc finger MYND domain-containing protein 2, MTG8 | 99.06 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.48 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.41 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.29 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.25 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.23 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 98.21 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.21 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.13 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.09 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.09 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.02 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.01 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.0 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.99 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 97.97 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.95 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.84 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.82 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.79 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.74 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.67 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.67 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 97.66 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.59 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 97.59 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.57 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.44 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.42 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.41 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 97.34 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.33 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 97.29 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.28 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 97.25 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.24 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.18 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.15 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.09 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 97.08 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 96.98 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 96.3 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.11 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 96.08 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 95.81 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 95.12 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 95.09 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 94.76 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 94.3 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 93.99 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 93.13 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 92.03 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 90.65 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 89.83 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 89.66 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 89.03 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 84.09 |
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: HCP-like family: HCP-like domain: Cysteine rich protein B (HcpB) species: Helicobacter pylori [TaxId: 210]
Probab=99.93 E-value=1.5e-25 Score=190.07 Aligned_cols=125 Identities=18% Similarity=0.098 Sum_probs=119.0
Q ss_pred CHHHHHHHHHHHHHcCCHHHHHHhHHHHhhccCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHcCCCCCCCccCHHHHHHH
Q 015393 118 WSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVAL 197 (408)
Q Consensus 118 ~~~~A~~~l~~aAe~G~~~A~~~LG~~y~~~~~d~~~A~~~~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~~~~d~~kA~~~ 197 (408)
+.++|+.||+++++.|++.|++.||.. .+.|.++|++||++|++.|++.|++.||.+|.+|.++++ |..+|++|
T Consensus 8 d~~~A~~~~~kaa~~g~~~a~~~l~~~---~~~~~~~a~~~~~~aa~~g~~~a~~~Lg~~y~~g~~~~~---d~~~A~~~ 81 (133)
T d1klxa_ 8 DLKKAIQYYVKACELNEMFGCLSLVSN---SQINKQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKK---DLRKAAQY 81 (133)
T ss_dssp HHHHHHHHHHHHHHTTCTTHHHHHHTC---TTSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHCSSSCC---CHHHHHHH
T ss_pred CHHHHHHHHHHHHHCCChhhhhhhccc---cccCHHHHHHHHhhhhcccchhhhhhHHHhhhhccccch---hhHHHHHH
Confidence 467999999999999999999999864 468999999999999999999999999999999999887 99999999
Q ss_pred HHHHHhCCCHHHHHHHHHHHHcCCCccccHHHHHHHHHHHHHcCCHHHHhh
Q 015393 198 CARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSS 248 (408)
Q Consensus 198 ~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~d~~~A~~w~~kAA~~G~~~A~~~ 248 (408)
|++|++.|++.|++.||.+|.+|.||++|.++|++||++|+++|+..|+..
T Consensus 82 ~~~aa~~g~~~a~~~Lg~~y~~G~gv~~d~~~A~~~~~~Aa~~G~~~A~~~ 132 (133)
T d1klxa_ 82 YSKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDACGI 132 (133)
T ss_dssp HHHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHHHHHHHTTCHHHHHH
T ss_pred HhhhhccCcchHHHHHHHHHHcCCccCCCHHHHHHHHHHHHHCCCHHHHHh
Confidence 999999999999999999999999999999999999999999999999753
|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|