Citrus Sinensis ID: 015393


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MRTKRGLCYPRVVDVCLGQRVVPVNDKKRRGFSSGEPKTTYRKKARFSPDVAGKSDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADCAPAERWLDEEGNGDVDVDLNDAEGGGEDNVVADS
ccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcHHHHHHHHHcccccccHHHHHcHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHcccccccHHHHHHHHHccccccHHHccHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccHHHccccccccccccccHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEHHcccHHHEEEccHcccHHHHHHHHHHHHcccHHHHHHHcEEEEEEcccccHHHHHHHHHHHcccHHHHHHHHHHEEcccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccHcHHHHHHHHccccccccccccccHccccccccccccccccHHHHccccccccccccHHHHHHHHHHHcccccccccHHcccccccccccccHHHHHHHHcccEEEccHHHHHHHHHHHcccccccHHHHHHcccccccEEcccccccccccEEEEcc
mrtkrglcyprvvdvclgqrvvpvndkkrrgfssgepkttyrkkarfspdvagksdlfdalpdDLVVSILCklsstarcpsdFVNVLITCKRMNGLALNSLVLSKASKKTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQfngsggskndkdLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSAAcqgistrswltwnplsqphpaphprnqnpnhnghvtgigcpllsdfgcnvpapeahpasRFLAEWFaarggtpgpglrlcshvgcgrpetrrhefrrcsvcgavnycSRACQALDWKLrhkadcapaerwldeegngdvdvdlndaegggednvvads
mrtkrglcyprvvdvclgqrvvpvndkkrrgfssgepkttyrkkarfspdvagKSDLFDALPDDLVVSILCKLsstarcpsDFVNVLITCKRMNGLALNSLVLSKASKKTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADCAPAerwldeegngdvdvdlndaegggednvvads
MRTKRGLCYPRVVDVCLGQRVVPVNDKKRRGFSSGEPKTTYRKKARFSPDVAGKSDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADCAPAERWLDEEGNGDVDVDLNDAEGGGEDNVVADS
*****GLCYPRVVDVCLGQRVVPV******************************SDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCL******************AQALYSLAVIQFNGS******KDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSAACQGISTRSWLTWNP*******************HVTGIGCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADCAPAERWLD**************************
***********************************************************ALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADCAPAERWLDEE************************
MRTKRGLCYPRVVDVCLGQRVVPVNDKKRRGFSSGEPKTTYRKKARFSPDVAGKSDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADCAPAERWLDEEGNGDVDVDLNDAEGGGEDNVVADS
******************************************************SDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADCAPAERWLDEEGNGDVDVDL****GGGEDNVVADS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTKRGLCYPRVVDVCLGQRVVPVNDKKRRGFSSGEPKTTYRKKARFSPDVAGKSDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADCAPAERWLDEEGNGDVDVDLNDAEGGGEDNVVADS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query408 2.2.26 [Sep-21-2011]
Q9FYF9379 F-box protein At1g67340 O yes no 0.813 0.875 0.745 1e-147
Q9FK27336 F-box protein At5g50450 O no no 0.754 0.916 0.569 1e-106
Q9SB51 1008 Ubiquitin carboxyl-termin no no 0.127 0.051 0.442 1e-05
>sp|Q9FYF9|FB76_ARATH F-box protein At1g67340 OS=Arabidopsis thaliana GN=At1g67340 PE=1 SV=1 Back     alignment and function desciption
 Score =  521 bits (1341), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 264/354 (74%), Positives = 293/354 (82%), Gaps = 22/354 (6%)

Query: 55  SDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKTFAIK 114
           +DL D++PDDLV+SILCKL ST+RCP+DF+NVL+TCKR+ GLA+N +VLS+ S K  A+K
Sbjct: 41  ADLLDSIPDDLVISILCKLGSTSRCPADFINVLLTCKRLKGLAMNPIVLSRLSPKAIAVK 100

Query: 115 ANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSL 174
           A+NWSE +HRFLK C DAG++EACYTLGMIRFYCLQNRG+GASLMAKAAISSHA ALYSL
Sbjct: 101 AHNWSEYSHRFLKRCVDAGSLEACYTLGMIRFYCLQNRGNGASLMAKAAISSHAPALYSL 160

Query: 175 AVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFL 234
           AVIQFNGSGGSKNDKDLRAGVALCARAAFLGH+DALRELGHCLQDGYGV QN++EGRRFL
Sbjct: 161 AVIQFNGSGGSKNDKDLRAGVALCARAAFLGHVDALRELGHCLQDGYGVPQNVSEGRRFL 220

Query: 235 VQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGCPLLS 294
           VQANARELAAVLSS    GI  RS  TW  LSQP P        PNH        CPLLS
Sbjct: 221 VQANARELAAVLSS----GIQARS--TWLSLSQPPPP-----VVPNHGQQT----CPLLS 265

Query: 295 DFGCNVPAPEAHPASRFLAEWFAARGGT-PGPGLRLCSHVGCGRPETRRHEFRRCSVCGA 353
           DFGCNVPAPE HPA+RFLA+WFA RGG  PG GLRLCSH GCGRPETR+HEFRRCSVCG 
Sbjct: 266 DFGCNVPAPETHPANRFLADWFAVRGGDCPGDGLRLCSHAGCGRPETRKHEFRRCSVCGV 325

Query: 354 VNYCSRACQALDWKLRHKADCAPAERWLDE--EGNGDVDVDLNDAEGGGEDNVV 405
           VNYCSRACQALDWKLRHK DCAP +RWL+E   G G+V +D N    G  DNV+
Sbjct: 326 VNYCSRACQALDWKLRHKMDCAPVQRWLEEGDGGEGNVQIDGN----GNGDNVL 375




Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FK27|FB342_ARATH F-box protein At5g50450 OS=Arabidopsis thaliana GN=At5g50450 PE=2 SV=1 Back     alignment and function description
>sp|Q9SB51|UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana GN=UBP16 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
255547716394 conserved hypothetical protein [Ricinus 0.941 0.974 0.729 1e-164
225425418385 PREDICTED: F-box protein At1g67340-like 0.894 0.948 0.777 1e-160
224053499403 predicted protein [Populus trichocarpa] 0.906 0.918 0.736 1e-160
224075553403 predicted protein [Populus trichocarpa] 0.909 0.920 0.731 1e-159
356512373394 PREDICTED: F-box protein At1g67340-like 0.941 0.974 0.672 1e-154
356525160391 PREDICTED: F-box protein At1g67340-like 0.933 0.974 0.686 1e-153
449435083382 PREDICTED: F-box protein At1g67340-like 0.914 0.976 0.719 1e-149
356540140350 PREDICTED: F-box protein At1g67340-like 0.840 0.98 0.725 1e-148
356566106348 PREDICTED: F-box protein At1g67340-like 0.801 0.939 0.748 1e-148
297838467375 zinc finger family protein [Arabidopsis 0.838 0.912 0.734 1e-146
>gi|255547716|ref|XP_002514915.1| conserved hypothetical protein [Ricinus communis] gi|223545966|gb|EEF47469.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  585 bits (1508), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 305/418 (72%), Positives = 337/418 (80%), Gaps = 34/418 (8%)

Query: 1   MRTKRGLCYPRVVDVCLGQRVVPVNDKKRRGF--------SSGEPKTTYRKKARFSPD-V 51
           M+T+RGLCYPR   + L +R+V     KRR          ++GE +   RK+ R SP+ +
Sbjct: 1   MKTRRGLCYPRTDALDLDKRLV-----KRRKLGEIIAAATATGE-QMVCRKRQRLSPEKI 54

Query: 52  AG-KSDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASKKT 110
           AG K+D F ALPDDLV  ILCKLSS+A CPSDFVNVL TCKR+NGL LNS+VLSKAS KT
Sbjct: 55  AGDKTDFFYALPDDLVTCILCKLSSSASCPSDFVNVLATCKRLNGLGLNSIVLSKASPKT 114

Query: 111 FAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQA 170
           FA+KA NWS+SAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHA A
Sbjct: 115 FALKAKNWSDSAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAPA 174

Query: 171 LYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEG 230
           LYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEG
Sbjct: 175 LYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEG 234

Query: 231 RRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGIGC 290
           RRFLVQANARELAAVLS+     ++TR+W+ WNP           + + NH  H +G GC
Sbjct: 235 RRFLVQANARELAAVLSNPN-SDLNTRAWVNWNP-----------HAHSNHR-HASGPGC 281

Query: 291 PLLSDFGCNVPAPEAHPASRFLAEWFAARGGTPGPGLRLCSHVGCGRPETRRHEFRRCSV 350
           PLLSDFGCNVPAPEAHPASRF+A+WFA RGG+PG GLRLCSHVGCGRPETR+HEFRRCSV
Sbjct: 282 PLLSDFGCNVPAPEAHPASRFMADWFATRGGSPGQGLRLCSHVGCGRPETRKHEFRRCSV 341

Query: 351 CGAVNYCSRACQALDWKLRHKADCAPAERWLDEEGNGDVDVDLNDAEGGGEDNVVADS 408
           CGAVNYCSRACQALDWKLRHK +CAP ERW+ E+G G          G G  NVV DS
Sbjct: 342 CGAVNYCSRACQALDWKLRHKEECAPVERWVVEDGEGG-----EAGVGDGNQNVVVDS 394




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225425418|ref|XP_002271442.1| PREDICTED: F-box protein At1g67340-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224053499|ref|XP_002297844.1| predicted protein [Populus trichocarpa] gi|222845102|gb|EEE82649.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224075553|ref|XP_002304680.1| predicted protein [Populus trichocarpa] gi|222842112|gb|EEE79659.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356512373|ref|XP_003524894.1| PREDICTED: F-box protein At1g67340-like [Glycine max] Back     alignment and taxonomy information
>gi|356525160|ref|XP_003531195.1| PREDICTED: F-box protein At1g67340-like [Glycine max] Back     alignment and taxonomy information
>gi|449435083|ref|XP_004135325.1| PREDICTED: F-box protein At1g67340-like [Cucumis sativus] gi|449494931|ref|XP_004159686.1| PREDICTED: F-box protein At1g67340-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356540140|ref|XP_003538548.1| PREDICTED: F-box protein At1g67340-like [Glycine max] Back     alignment and taxonomy information
>gi|356566106|ref|XP_003551276.1| PREDICTED: F-box protein At1g67340-like [Glycine max] Back     alignment and taxonomy information
>gi|297838467|ref|XP_002887115.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297332956|gb|EFH63374.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
TAIR|locus:2019604379 AT1G67340 "AT1G67340" [Arabido 0.833 0.897 0.745 2.6e-141
TAIR|locus:2177522336 AT5G50450 [Arabidopsis thalian 0.617 0.75 0.585 1.3e-70
ASPGD|ASPL0000075121807 AN8765 [Emericella nidulans (t 0.563 0.285 0.288 3.3e-05
UNIPROTKB|G4NGF61240 MGG_04327 "Uncharacterized pro 0.107 0.035 0.5 5.5e-05
TAIR|locus:2121959 1008 UBP16 "ubiquitin-specific prot 0.127 0.051 0.442 0.00032
UNIPROTKB|Q8E8U7484 SO_4559 "Sel1 domain-containin 0.323 0.272 0.312 0.00043
TIGR_CMR|SO_4559484 SO_4559 "conserved domain prot 0.323 0.272 0.312 0.00043
UNIPROTKB|Q74B01213 GSU2395 "Uncharacterized prote 0.372 0.713 0.257 0.00061
TIGR_CMR|GSU_2395213 GSU_2395 "conserved hypothetic 0.372 0.713 0.257 0.00061
TAIR|locus:2019604 AT1G67340 "AT1G67340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1382 (491.5 bits), Expect = 2.6e-141, P = 2.6e-141
 Identities = 267/358 (74%), Positives = 298/358 (83%)

Query:    49 PDVAGKSDLFDALPDDLVVSILCKLSSTARCPSDFVNVLITCKRMNGLALNSLVLSKASK 108
             P+    +DL D++PDDLV+SILCKL ST+RCP+DF+NVL+TCKR+ GLA+N +VLS+ S 
Sbjct:    35 PENTTGADLLDSIPDDLVISILCKLGSTSRCPADFINVLLTCKRLKGLAMNPIVLSRLSP 94

Query:   109 KTFAIKANNWSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHA 168
             K  A+KA+NWSE +HRFLK C DAG++EACYTLGMIRFYCLQNRG+GASLMAKAAISSHA
Sbjct:    95 KAIAVKAHNWSEYSHRFLKRCVDAGSLEACYTLGMIRFYCLQNRGNGASLMAKAAISSHA 154

Query:   169 QALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIA 228
              ALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGH+DALRELGHCLQDGYGV QN++
Sbjct:   155 PALYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHVDALRELGHCLQDGYGVPQNVS 214

Query:   229 EGRRFLVQANARELAAVLSSAACQGISTRSWLTWNPLSQPHPAPHPRNQNPNHNGHVTGI 288
             EGRRFLVQANARELAAVLSS    GI  RS  TW  LSQP P P      PNH G  T  
Sbjct:   215 EGRRFLVQANARELAAVLSS----GIQARS--TWLSLSQP-PPPVV----PNH-GQQT-- 260

Query:   289 GCPLLSDFGCNVPAPEAHPASRFLAEWFAARGGT-PGPGLRLCSHVGCGRPETRRHEFRR 347
              CPLLSDFGCNVPAPE HPA+RFLA+WFA RGG  PG GLRLCSH GCGRPETR+HEFRR
Sbjct:   261 -CPLLSDFGCNVPAPETHPANRFLADWFAVRGGDCPGDGLRLCSHAGCGRPETRKHEFRR 319

Query:   348 CSVCGAVNYCSRACQALDWKLRHKADCAPAERWLDEEGNGDVDVDLNDAEGGGEDNVV 405
             CSVCG VNYCSRACQALDWKLRHK DCAP +RWL+E   G+ +V + D  G G DNV+
Sbjct:   320 CSVCGVVNYCSRACQALDWKLRHKMDCAPVQRWLEEGDGGEGNVQI-DGNGNG-DNVL 375




GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
TAIR|locus:2177522 AT5G50450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000075121 AN8765 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NGF6 MGG_04327 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2121959 UBP16 "ubiquitin-specific protease 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8E8U7 SO_4559 "Sel1 domain-containing protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4559 SO_4559 "conserved domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q74B01 GSU2395 "Uncharacterized protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2395 GSU_2395 "conserved hypothetical protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FYF9FB76_ARATHNo assigned EC number0.74570.81370.8759yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0008009901
hypothetical protein (403 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 7e-11
pfam0175339 pfam01753, zf-MYND, MYND finger 9e-08
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 7e-05
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 3e-04
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 0.003
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
 Score = 62.4 bits (151), Expect = 7e-11
 Identities = 30/137 (21%), Positives = 58/137 (42%), Gaps = 7/137 (5%)

Query: 114 KANNWSESAHRFLKLCADAGNVEACYTLGMIRFY---CLQNRGSGASLMAKAAISSHAQA 170
            + + +++A  + +  A  G  EA + LG++         +         KAA   + +A
Sbjct: 89  VSRDKTKAAD-WYRCAAADGLAEALFNLGLMYANGRGVPLDLVKALKYYEKAAKLGNVEA 147

Query: 171 ---LYSLAVIQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNI 227
              +Y L +   +G        D +  + L  +AA LG+ DA   LG   + G GV +++
Sbjct: 148 ALAMYRLGLAYLSGLQALAVAYDDKKALYLYRKAAELGNPDAQLLLGRMYEKGLGVPRDL 207

Query: 228 AEGRRFLVQANARELAA 244
            +  R+  +A  +   A
Sbjct: 208 KKAFRWYKKAAEQGDGA 224


Length = 292

>gnl|CDD|201954 pfam01753, zf-MYND, MYND finger Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 408
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 99.84
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 99.75
KOG1550552 consensus Extracellular protein SEL-1 and related 99.73
KOG1550552 consensus Extracellular protein SEL-1 and related 99.62
KOG4014248 consensus Uncharacterized conserved protein (conta 99.46
KOG4014248 consensus Uncharacterized conserved protein (conta 99.43
PF0175337 zf-MYND: MYND finger; InterPro: IPR002893 Zinc fin 98.71
smart0067136 SEL1 Sel1-like repeats. These represent a subfamil 98.48
PF0823839 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r 98.43
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 98.33
smart0067136 SEL1 Sel1-like repeats. These represent a subfamil 98.32
PF0823839 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r 98.26
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.23
PRK10370198 formate-dependent nitrite reductase complex subuni 98.16
PRK15359144 type III secretion system chaperone protein SscB; 98.07
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.87
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.84
PRK12370553 invasion protein regulator; Provisional 97.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.79
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 97.77
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.76
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 97.69
KOG2003840 consensus TPR repeat-containing protein [General f 97.68
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.67
PRK11189296 lipoprotein NlpI; Provisional 97.63
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.62
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.57
PRK15359144 type III secretion system chaperone protein SscB; 97.56
PRK12370553 invasion protein regulator; Provisional 97.56
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.52
PRK11788389 tetratricopeptide repeat protein; Provisional 97.48
PRK11189296 lipoprotein NlpI; Provisional 97.46
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.35
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.33
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.33
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.33
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.28
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.26
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.25
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.23
KOG2003840 consensus TPR repeat-containing protein [General f 97.22
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.2
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.18
PRK11788389 tetratricopeptide repeat protein; Provisional 97.18
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.17
KOG1126638 consensus DNA-binding cell division cycle control 97.16
PF12688120 TPR_5: Tetratrico peptide repeat 97.03
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 96.97
KOG1125579 consensus TPR repeat-containing protein [General f 96.97
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.94
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.89
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.88
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.84
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.77
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.73
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.59
PRK10803263 tol-pal system protein YbgF; Provisional 96.56
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.54
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.52
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.46
PRK10370198 formate-dependent nitrite reductase complex subuni 96.44
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.44
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.41
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.39
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.37
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 96.36
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 96.32
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.27
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.26
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.26
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.23
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.21
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.16
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.14
PRK11906458 transcriptional regulator; Provisional 96.08
KOG1126638 consensus DNA-binding cell division cycle control 96.05
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.02
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.01
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 95.98
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.89
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 95.85
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 95.75
KOG1129478 consensus TPR repeat-containing protein [General f 95.74
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.5
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.25
cd05804355 StaR_like StaR_like; a well-conserved protein foun 95.13
smart0025641 FBOX A Receptor for Ubiquitination Targets. 95.01
PRK10747398 putative protoheme IX biogenesis protein; Provisio 95.01
cd00189100 TPR Tetratricopeptide repeat domain; typically con 94.98
PRK10803263 tol-pal system protein YbgF; Provisional 94.97
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 94.91
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 94.64
PRK14574 822 hmsH outer membrane protein; Provisional 94.64
PRK14574 822 hmsH outer membrane protein; Provisional 94.58
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 94.47
PF12688120 TPR_5: Tetratrico peptide repeat 94.46
PRK14720 906 transcript cleavage factor/unknown domain fusion p 94.44
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 94.42
PRK11906458 transcriptional regulator; Provisional 94.37
PF1342844 TPR_14: Tetratricopeptide repeat 94.1
PRK15331165 chaperone protein SicA; Provisional 94.02
KOG4162799 consensus Predicted calmodulin-binding protein [Si 93.98
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 93.97
KOG2076 895 consensus RNA polymerase III transcription factor 93.86
KOG0547606 consensus Translocase of outer mitochondrial membr 93.7
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 93.59
KOG3612588 consensus PHD Zn-finger protein [General function 93.56
KOG2061 362 consensus Uncharacterized MYND Zn-finger protein [ 93.48
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 93.44
KOG0547606 consensus Translocase of outer mitochondrial membr 93.42
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 93.3
KOG1129478 consensus TPR repeat-containing protein [General f 93.27
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 93.25
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 93.24
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.03
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 93.02
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 92.98
PF1337173 TPR_9: Tetratricopeptide repeat 92.88
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 92.81
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.8
KOG2076 895 consensus RNA polymerase III transcription factor 92.77
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 92.68
PRK10747398 putative protoheme IX biogenesis protein; Provisio 92.65
PRK15331165 chaperone protein SicA; Provisional 92.63
KOG1586288 consensus Protein required for fusion of vesicles 92.56
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.55
PF1342844 TPR_14: Tetratricopeptide repeat 92.51
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.18
COG4783484 Putative Zn-dependent protease, contains TPR repea 91.66
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 91.62
cd05804355 StaR_like StaR_like; a well-conserved protein foun 91.49
KOG4555175 consensus TPR repeat-containing protein [Function 91.46
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.43
KOG2997366 consensus F-box protein FBX9 [General function pre 91.26
PLN02789320 farnesyltranstransferase 90.97
PLN02789320 farnesyltranstransferase 90.82
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 90.26
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 89.81
KOG4555175 consensus TPR repeat-containing protein [Function 89.52
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 89.31
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 89.29
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 89.28
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 89.23
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 89.01
PRK10153517 DNA-binding transcriptional activator CadC; Provis 88.83
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.69
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 88.5
PRK14720 906 transcript cleavage factor/unknown domain fusion p 88.09
PLN03218 1060 maturation of RBCL 1; Provisional 87.99
PF1343134 TPR_17: Tetratricopeptide repeat 87.88
KOG1125579 consensus TPR repeat-containing protein [General f 87.57
PLN03158 396 methionine aminopeptidase; Provisional 87.26
COG1729262 Uncharacterized protein conserved in bacteria [Fun 86.92
KOG3060289 consensus Uncharacterized conserved protein [Funct 86.7
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 86.37
PF1382455 zf-Mss51: Zinc-finger of mitochondrial splicing su 86.25
PLN03218 1060 maturation of RBCL 1; Provisional 86.03
KOG0553304 consensus TPR repeat-containing protein [General f 85.71
PF1337173 TPR_9: Tetratricopeptide repeat 84.78
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 84.62
KOG4162799 consensus Predicted calmodulin-binding protein [Si 84.34
PF1343134 TPR_17: Tetratricopeptide repeat 84.19
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.07
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 84.01
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 83.81
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.71
KOG0553304 consensus TPR repeat-containing protein [General f 83.62
KOG1128777 consensus Uncharacterized conserved protein, conta 83.35
PF09986214 DUF2225: Uncharacterized protein conserved in bact 82.51
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.53
PF09986214 DUF2225: Uncharacterized protein conserved in bact 81.03
PF13281374 DUF4071: Domain of unknown function (DUF4071) 80.16
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
Probab=99.84  E-value=7.9e-20  Score=177.87  Aligned_cols=131  Identities=23%  Similarity=0.276  Sum_probs=121.6

Q ss_pred             hcCCHHHHHHHHHHHHHcCCHHHHHHhHHHHhh---ccCCHHHHHHHHHHHHhcCcHHH---HHHHHHHHHcC---CCCC
Q 015393          115 ANNWSESAHRFLKLCADAGNVEACYTLGMIRFY---CLQNRGSGASLMAKAAISSHAQA---LYSLAVIQFNG---SGGS  185 (408)
Q Consensus       115 ~~~~~~~A~~~l~~aAe~G~~~A~~~LG~~y~~---~~~d~~~A~~~~~kAA~~G~~~A---~~~Lg~~y~~G---~Gv~  185 (408)
                      ...+..+|+.||+.+++.|++.++++||.+|..   +.+|..+|+.||++||++|+++|   ++.||.+|..|   .++.
T Consensus        89 v~~~~~~A~~~~~~~a~~g~~~a~~~lg~~~~~G~gv~~d~~~A~~~~~~Aa~~g~~~a~~~~~~l~~~~~~g~~~~~~~  168 (292)
T COG0790          89 VSRDKTKAADWYRCAAADGLAEALFNLGLMYANGRGVPLDLVKALKYYEKAAKLGNVEAALAMYRLGLAYLSGLQALAVA  168 (292)
T ss_pred             ccccHHHHHHHHHHHhhcccHHHHHhHHHHHhcCCCcccCHHHHHHHHHHHHHcCChhHHHHHHHHHHHHHcChhhhccc
Confidence            344578999999999999999999999999994   56899999999999999999999   99999999999   7876


Q ss_pred             CCccCHHHHHHHHHHHHhCCCHHHHHHHHHHHHcCCCccccHHHHHHHHHHHHHcCCHHHHhh
Q 015393          186 KNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSS  248 (408)
Q Consensus       186 ~~~~d~~kA~~~~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~d~~~A~~w~~kAA~~G~~~A~~~  248 (408)
                      .   +..+|+.||.+|+++|++.|++.||.+|..|.||++|.++|++||.+|+++|+..+...
T Consensus       169 ~---~~~~A~~~~~~aa~~~~~~a~~~lg~~y~~G~Gv~~d~~~A~~wy~~Aa~~g~~~a~~~  228 (292)
T COG0790         169 Y---DDKKALYLYRKAAELGNPDAQLLLGRMYEKGLGVPRDLKKAFRWYKKAAEQGDGAACYN  228 (292)
T ss_pred             H---HHHhHHHHHHHHHHhcCHHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHHHCCCHHHHHH
Confidence            6   88899999999999999999999999999999999999999999999999999665554



>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF01753 zf-MYND: MYND finger; InterPro: IPR002893 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00671 SEL1 Sel1-like repeats Back     alignment and domain information
>PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00671 SEL1 Sel1-like repeats Back     alignment and domain information
>PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG3612 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2061 consensus Uncharacterized MYND Zn-finger protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03158 methionine aminopeptidase; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13824 zf-Mss51: Zinc-finger of mitochondrial splicing suppressor 51 Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 1e-14
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 6e-14
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 3e-13
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 1e-11
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 1e-10
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 1e-14
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 2e-14
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 8e-14
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 1e-13
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 1e-13
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 2e-13
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 4e-13
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 8e-08
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 6e-05
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 2e-04
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 3e-13
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 2e-10
1klx_A138 Cysteine rich protein B; structural genomics, heli 4e-12
1klx_A138 Cysteine rich protein B; structural genomics, heli 4e-08
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 6e-12
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-11
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-11
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 4e-08
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 9e-08
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-07
2od1_A60 Protein CBFA2T1; zinc finger, cross-braced topolog 2e-09
2odd_A64 Protein CBFA2T1; MYND zinc finger, cross-braced to 3e-09
2jw6_A52 Deformed epidermal autoregulatory factor 1 homolo; 1e-08
2dj8_A60 Protein CBFA2T1; zinc finger MYND domain, protein 2e-08
2d8q_A70 BLU protein, zinc finger MYND domain containing pr 4e-08
3n71_A 490 Histone lysine methyltransferase SMYD1; heart deve 1e-04
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
 Score = 72.6 bits (179), Expect = 1e-14
 Identities = 25/121 (20%), Positives = 52/121 (42%), Gaps = 6/121 (4%)

Query: 120 ESAHRFLKLCADAGNVEACYTLGMIRFYCL---QNRGSGASLMAKAAISSHAQALYSLAV 176
             A ++ +   D      C+ LG++ +      +N    AS  AKA   +++   + L  
Sbjct: 23  TQAKKYFEKACDLKENSGCFNLGVLYYQGQGVEKNLKKAASFYAKACDLNYSNGCHLLGN 82

Query: 177 IQFNGSGGSKNDKDLRAGVALCARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQ 236
           + ++G G S+N    +A +   ++A  L + +    LG    DG  V ++  +   +  +
Sbjct: 83  LYYSGQGVSQNTN--KA-LQYYSKACDLKYAEGCASLGGIYHDGKVVTRDFKKAVEYFTK 139

Query: 237 A 237
           A
Sbjct: 140 A 140


>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>2od1_A Protein CBFA2T1; zinc finger, cross-braced topology, metal binding protein; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>2odd_A Protein CBFA2T1; MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, metal binding protein; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2jw6_A Deformed epidermal autoregulatory factor 1 homolo; zinc binding domain, transcription, alternative splicing, DI mutation, DNA-binding; NMR {Homo sapiens} SCOP: g.85.1.1 Length = 52 Back     alignment and structure
>2dj8_A Protein CBFA2T1; zinc finger MYND domain, protein MTG8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.85.1.1 Length = 60 Back     alignment and structure
>2d8q_A BLU protein, zinc finger MYND domain containing protein 10; zmynd10, ZF-MYND, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.1 PDB: 2dan_A Length = 70 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.93
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.88
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.88
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.87
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.86
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.79
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.71
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.7
2d8q_A70 BLU protein, zinc finger MYND domain containing pr 98.88
2od1_A60 Protein CBFA2T1; zinc finger, cross-braced topolog 98.8
2dj8_A60 Protein CBFA2T1; zinc finger MYND domain, protein 98.8
2odd_A64 Protein CBFA2T1; MYND zinc finger, cross-braced to 98.77
2jw6_A52 Deformed epidermal autoregulatory factor 1 homolo; 98.76
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.64
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.59
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.58
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.55
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.5
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.48
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.46
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.42
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.41
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.4
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.4
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.39
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.38
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.38
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.38
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.37
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.35
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.3
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.29
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.28
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.24
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.22
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.21
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.2
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.19
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.18
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.17
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.16
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.16
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.16
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.15
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.15
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.15
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.12
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.11
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.1
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.1
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.09
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.08
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.08
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.07
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.07
3u4t_A272 TPR repeat-containing protein; structural genomics 98.06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.06
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.06
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.03
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.03
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.03
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.03
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.03
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.02
3qww_A 433 SET and MYND domain-containing protein 2; methyltr 98.02
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.01
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.01
3qwp_A 429 SET and MYND domain-containing protein 3; SMYD3,SE 97.99
3u4t_A272 TPR repeat-containing protein; structural genomics 97.98
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.97
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.97
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.96
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.96
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.95
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.95
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.94
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.94
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.94
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.93
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.92
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.92
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.91
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 97.91
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.9
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.89
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.89
3n71_A 490 Histone lysine methyltransferase SMYD1; heart deve 97.89
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.89
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.89
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.88
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.87
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.87
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.86
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.85
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.85
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.83
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.82
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.81
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.8
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.8
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.79
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.78
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.78
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.77
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.77
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.77
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.76
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.75
3k9i_A117 BH0479 protein; putative protein binding protein, 97.74
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.73
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 97.71
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.71
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 97.71
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.7
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.7
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.69
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.69
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.69
2gw1_A514 Mitochondrial precursor proteins import receptor; 97.68
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.68
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.67
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.67
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.67
2gw1_A514 Mitochondrial precursor proteins import receptor; 97.65
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 97.65
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.64
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.63
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.62
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.61
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.61
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.6
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.6
3k9i_A117 BH0479 protein; putative protein binding protein, 97.6
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.55
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.55
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.54
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.54
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.54
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.54
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.51
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.49
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.49
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.48
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.47
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.47
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.47
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.45
4g1t_A472 Interferon-induced protein with tetratricopeptide 97.45
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.44
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 97.43
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.43
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 97.42
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.41
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.4
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.39
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.39
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.32
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.29
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.18
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.17
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.12
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.03
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.99
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.94
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.89
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.87
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.76
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.71
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.5
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.47
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.43
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 96.37
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.15
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 95.86
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 95.72
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.66
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.53
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 95.28
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.25
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.14
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.13
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.82
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.5
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 93.86
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 93.56
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 93.04
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 92.99
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 92.98
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 92.7
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 92.54
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 92.43
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.25
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 91.87
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 90.91
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 90.01
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 87.38
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 86.5
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 84.41
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 83.25
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 82.76
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 82.51
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 82.31
2yqq_A56 Zinc finger HIT domain-containing protein 3; struc 82.21
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 81.63
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 80.58
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 80.38
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
Probab=99.93  E-value=7.1e-25  Score=188.79  Aligned_cols=126  Identities=18%  Similarity=0.113  Sum_probs=119.4

Q ss_pred             CHHHHHHHHHHHHHcCCHHHHHHhHHHHhhccCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHcCCCCCCCccCHHHHHHH
Q 015393          118 WSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVAL  197 (408)
Q Consensus       118 ~~~~A~~~l~~aAe~G~~~A~~~LG~~y~~~~~d~~~A~~~~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~~~~d~~kA~~~  197 (408)
                      +.++|+.||+++++.|++.|+  ||.+|.. ..+.++|++||++|++.|++.|+++||.+|..|.|+++   |+.+|++|
T Consensus        10 d~~~A~~~~~~aa~~g~~~a~--lg~~y~~-g~~~~~A~~~~~~Aa~~g~~~a~~~Lg~~y~~G~g~~~---d~~~A~~~   83 (138)
T 1klx_A           10 DLKKAIQYYVKACELNEMFGC--LSLVSNS-QINKQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKK---DLRKAAQY   83 (138)
T ss_dssp             HHHHHHHHHHHHHHTTCTTHH--HHHHTCT-TSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHCSSSCC---CHHHHHHH
T ss_pred             CHHHHHHHHHHHHcCCCHhhh--HHHHHHc-CCCHHHHHHHHHHHHcCCCHHHHHHHHHHHHcCCCCCc---cHHHHHHH
Confidence            467999999999999999999  9999984 46677899999999999999999999999999999888   99999999


Q ss_pred             HHHHHhCCCHHHHHHHHHHHHcCCCccccHHHHHHHHHHHHHcCCHHHHhhh
Q 015393          198 CARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSSA  249 (408)
Q Consensus       198 ~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~d~~~A~~w~~kAA~~G~~~A~~~~  249 (408)
                      |++|++.|++.|+++||.+|..|.||++|.++|++||++|++.|++.|+...
T Consensus        84 ~~~Aa~~g~~~a~~~Lg~~y~~G~g~~~d~~~A~~~~~~Aa~~g~~~A~~~l  135 (138)
T 1klx_A           84 YSKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDACGIL  135 (138)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHHHHHHHTTCHHHHHHC
T ss_pred             HHHHHcCCCHHHHHHHHHHHHCCCCCCcCHHHHHHHHHHHHHCCCHHHHHHH
Confidence            9999999999999999999999999999999999999999999999998764



>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2d8q_A BLU protein, zinc finger MYND domain containing protein 10; zmynd10, ZF-MYND, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.1 PDB: 2dan_A Back     alignment and structure
>2od1_A Protein CBFA2T1; zinc finger, cross-braced topology, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dj8_A Protein CBFA2T1; zinc finger MYND domain, protein MTG8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.85.1.1 Back     alignment and structure
>2odd_A Protein CBFA2T1; MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jw6_A Deformed epidermal autoregulatory factor 1 homolo; zinc binding domain, transcription, alternative splicing, DI mutation, DNA-binding; NMR {Homo sapiens} SCOP: g.85.1.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2yqq_A Zinc finger HIT domain-containing protein 3; structure genomics, ZF-HIT domain, TRIP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 408
d2jw6a138 g.85.1.1 (A:503-540) Zinc finger MYND domain-conta 2e-07
d2dj8a147 g.85.1.1 (A:8-54) Zinc finger MYND domain-containi 2e-07
d2dana147 g.85.1.1 (A:8-54) Zinc finger MYND domain-containi 6e-07
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 4e-04
>d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure

class: Small proteins
fold: HIT/MYND zinc finger-like
superfamily: HIT/MYND zinc finger-like
family: MYND zinc finger
domain: Zinc finger MYND domain-containing protein 2, MTG8
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.6 bits (105), Expect = 2e-07
 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 6/42 (14%)

Query: 333 VGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKADC 374
           V CGR          C+ C  VNYCS  CQ  DWK  H+  C
Sbjct: 3   VNCGREAMSE-----CTGCHKVNYCSTFCQRKDWK-DHQHIC 38


>d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 99.93
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.83
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 99.78
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.75
d2dana147 Zinc finger MYND domain-containing protein 10, ZMY 99.14
d2jw6a138 Zinc finger MYND domain-containing protein 2, MTG8 99.08
d2dj8a147 Zinc finger MYND domain-containing protein 2, MTG8 99.06
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.48
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.41
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.29
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.25
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.23
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.21
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.21
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.13
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.09
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.09
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.02
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.99
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 97.97
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.84
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.82
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.79
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.74
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.67
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.67
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.59
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 97.59
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.57
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.44
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.42
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.41
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 97.34
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.33
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.29
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.28
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.24
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.18
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.15
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.09
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.08
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.98
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.3
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.11
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 96.08
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.81
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 95.12
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.09
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 94.76
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.3
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 93.99
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 93.13
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.03
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 90.65
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.83
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 89.66
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 89.03
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 84.09
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: HCP-like
family: HCP-like
domain: Cysteine rich protein B (HcpB)
species: Helicobacter pylori [TaxId: 210]
Probab=99.93  E-value=1.5e-25  Score=190.07  Aligned_cols=125  Identities=18%  Similarity=0.098  Sum_probs=119.0

Q ss_pred             CHHHHHHHHHHHHHcCCHHHHHHhHHHHhhccCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHcCCCCCCCccCHHHHHHH
Q 015393          118 WSESAHRFLKLCADAGNVEACYTLGMIRFYCLQNRGSGASLMAKAAISSHAQALYSLAVIQFNGSGGSKNDKDLRAGVAL  197 (408)
Q Consensus       118 ~~~~A~~~l~~aAe~G~~~A~~~LG~~y~~~~~d~~~A~~~~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~~~~d~~kA~~~  197 (408)
                      +.++|+.||+++++.|++.|++.||..   .+.|.++|++||++|++.|++.|++.||.+|.+|.++++   |..+|++|
T Consensus         8 d~~~A~~~~~kaa~~g~~~a~~~l~~~---~~~~~~~a~~~~~~aa~~g~~~a~~~Lg~~y~~g~~~~~---d~~~A~~~   81 (133)
T d1klxa_           8 DLKKAIQYYVKACELNEMFGCLSLVSN---SQINKQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKK---DLRKAAQY   81 (133)
T ss_dssp             HHHHHHHHHHHHHHTTCTTHHHHHHTC---TTSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHCSSSCC---CHHHHHHH
T ss_pred             CHHHHHHHHHHHHHCCChhhhhhhccc---cccCHHHHHHHHhhhhcccchhhhhhHHHhhhhccccch---hhHHHHHH
Confidence            467999999999999999999999864   468999999999999999999999999999999999887   99999999


Q ss_pred             HHHHHhCCCHHHHHHHHHHHHcCCCccccHHHHHHHHHHHHHcCCHHHHhh
Q 015393          198 CARAAFLGHIDALRELGHCLQDGYGVRQNIAEGRRFLVQANARELAAVLSS  248 (408)
Q Consensus       198 ~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~d~~~A~~w~~kAA~~G~~~A~~~  248 (408)
                      |++|++.|++.|++.||.+|.+|.||++|.++|++||++|+++|+..|+..
T Consensus        82 ~~~aa~~g~~~a~~~Lg~~y~~G~gv~~d~~~A~~~~~~Aa~~G~~~A~~~  132 (133)
T d1klxa_          82 YSKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDACGI  132 (133)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             HhhhhccCcchHHHHHHHHHHcCCccCCCHHHHHHHHHHHHHCCCHHHHHh
Confidence            999999999999999999999999999999999999999999999999753



>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure