Citrus Sinensis ID: 015472

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQNLAEENEGRETKQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKASHL
ccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccHHHccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEcccccccccc
cccHHHHHHHHHHcccHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcHHHHHccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccc
MCNARAHLEEQisrqdlsdsEKFQQYMIYLKYeqssgdpgrVQLLYERaitdfpvssdlWLDYTQYLDKTLKVGNVVRDVYSratkncpwvgELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCyskrftgtgseDICHAWLRFEreygtledfdhsvqKVTPRLEELRLFRsqqeskslpesadqkEHSVKKtgrekrksdsnisyeqspakrqkhapqkpkkvhdkEKRQVQNLAeenegretkqtveeqpkkqpikdavpgrtkgftDECTAFLSNINLKASHL
mcnarahleeqisrqdlsdsEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYsratkncpwvgeLWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKrftgtgseDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSqqeskslpesadqkehsvkktgrekrksdsnisyeqspakrqkhapqkpkkvhdkekrqvqnlaeenegretkqtveeqpkkqpikdavpgrtKGFTDECTAFLSNINLKASHL
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVrsllslersraseeeISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQNLAEENEGRETKQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKASHL
**********************FQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLER******EISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKV*************************************************************************************************************DECTAFLSN********
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELR*******************************************************************************************************CTAFLSNINLK****
****************LSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFR**************************************************************************************KDAVPGRTKGFTDECTAFLSNINLKASHL
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSL****************************************************************************************FTDECTAFLSNINLK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVxxxxxxxxxxxxxxxxxxxxxQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKASHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query406 2.2.26 [Sep-21-2011]
Q15020 963 Squamous cell carcinoma a yes no 0.842 0.355 0.302 1e-38
Q5REG1 981 Squamous cell carcinoma a yes no 0.842 0.348 0.302 1e-38
Q9JLI8 962 Squamous cell carcinoma a yes no 0.647 0.273 0.326 3e-38
Q9USY2 1014 Uncharacterized RNA-bindi yes no 0.391 0.156 0.287 9e-09
Q4PB37 781 Pre-mRNA-splicing factor N/A no 0.586 0.304 0.257 3e-08
Q146901871 Protein RRP5 homolog OS=H no no 0.564 0.122 0.255 1e-05
P63155690 Crooked neck-like protein no no 0.536 0.315 0.255 1e-05
P63154690 Crooked neck-like protein no no 0.536 0.315 0.255 1e-05
Q6NS461862 Protein RRP5 homolog OS=M no no 0.564 0.122 0.240 2e-05
Q9BZJ0848 Crooked neck-like protein no no 0.534 0.255 0.249 4e-05
>sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens GN=SART3 PE=1 SV=1 Back     alignment and function desciption
 Score =  161 bits (407), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 192/373 (51%), Gaps = 31/373 (8%)

Query: 18  SDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVV 77
           +++ +  +Y  Y+ +E   GDP R+QL++ERA+ +  +  DLW+ Y+QYLD+ LKV ++V
Sbjct: 305 AEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRYSQYLDRQLKVKDLV 364

Query: 78  RDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTR 137
             V++RA +NCPW   LW R LL++ER     + IS  FEK+L   F    +Y++++   
Sbjct: 365 LSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAY 424

Query: 138 IDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQM-----KNTDGLLRLYAYWAHLE 192
           +D LRRR+ F  +    L+   +R  F RA +YL +++     ++ D    +   WA +E
Sbjct: 425 LDYLRRRVDFKQDSSKELEE--LRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIE 482

Query: 193 QSMGKDMVSARGVWERLLKISGA-MLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGT 251
             +  +M  AR +W+ ++    A     W  Y ++E         R    R    + T  
Sbjct: 483 ARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAV--QCTSD 540

Query: 252 GSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPESADQKEHSVK 311
             E +C   L  ER  G+LED+D +VQK   RL  +    ++Q  K+  + A   +   +
Sbjct: 541 YPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARV----NEQRMKAAEKEAALVQQEEE 596

Query: 312 KTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQNLAEENEGRETKQTVEEQ 371
           K  + KR            A+ +K A +K KK+   EKR     A+E++ +E     EEQ
Sbjct: 597 KAEQRKR------------ARAEKKALKKKKKIRGPEKRG----ADEDDEKEWGDDEEEQ 640

Query: 372 P-KKQPIKDAVPG 383
           P K++ +++++P 
Sbjct: 641 PSKRRRVENSIPA 653
Regulates Tat transactivation activity through direct interaction. May be a cellular factor for HIV-1 gene expression and viral replication.
Homo sapiens (taxid: 9606)
>sp|Q5REG1|SART3_PONAB Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii GN=SART3 PE=2 SV=1 Back     alignment and function description
>sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=2 SV=1 Back     alignment and function description
>sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=4 SV=1 Back     alignment and function description
>sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 Back     alignment and function description
>sp|Q14690|RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 Back     alignment and function description
>sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 Back     alignment and function description
>sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NS46|RRP5_MOUSE Protein RRP5 homolog OS=Mus musculus GN=Pdcd11 PE=2 SV=2 Back     alignment and function description
>sp|Q9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens GN=CRNKL1 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
255573806 852 Squamous cell carcinoma antigen recogniz 0.987 0.470 0.698 1e-164
359486200 838 PREDICTED: squamous cell carcinoma antig 0.987 0.478 0.656 1e-150
297739447 819 unnamed protein product [Vitis vinifera] 0.987 0.489 0.656 1e-150
449450119 800 PREDICTED: squamous cell carcinoma antig 0.975 0.495 0.602 1e-143
356541840 837 PREDICTED: squamous cell carcinoma antig 0.972 0.471 0.615 1e-143
356560763 847 PREDICTED: squamous cell carcinoma antig 0.972 0.466 0.610 1e-141
224129810 843 predicted protein [Populus trichocarpa] 0.975 0.469 0.614 1e-141
297799572 820 RNA recognition motif-containing protein 0.958 0.474 0.582 1e-132
30686462 816 protein embryo defective 140 [Arabidopsi 0.963 0.479 0.588 1e-131
30686466 817 protein embryo defective 140 [Arabidopsi 0.963 0.478 0.588 1e-131
>gi|255573806|ref|XP_002527822.1| Squamous cell carcinoma antigen recognized by T-cells, putative [Ricinus communis] gi|223532746|gb|EEF34525.1| Squamous cell carcinoma antigen recognized by T-cells, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 283/405 (69%), Positives = 337/405 (83%), Gaps = 4/405 (0%)

Query: 1   MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLW 60
           M N RA  EEQI +QD+S+ EKFQ +M YL +E+++GDP RVQ+LYERAIT+FPVSSD+W
Sbjct: 289 MYNTRAQHEEQIYKQDISEQEKFQNFMNYLNFEKTAGDPARVQVLYERAITEFPVSSDIW 348

Query: 61  LDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSL 120
           LDYT YLDKTLKVGN+V+D Y RAT+NC WVGELWVR LLSLERSRA E+EISTVFE+SL
Sbjct: 349 LDYTCYLDKTLKVGNIVKDAYFRATRNCSWVGELWVRYLLSLERSRAHEKEISTVFEESL 408

Query: 121 LCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDG 180
            C FST EEYLDLFLTR+DGLRRRILF  E EGVL+YSLI+ET Q ASDYLS Q+KNT+G
Sbjct: 409 QCLFSTAEEYLDLFLTRVDGLRRRILFGSEAEGVLNYSLIKETMQHASDYLSPQLKNTEG 468

Query: 181 LLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIY 240
           LLRL+AYWA LE ++GKD+V+ARGVWE LLKISG+MLE WQ YI+ME EL HINEARSIY
Sbjct: 469 LLRLHAYWARLELNLGKDLVAARGVWESLLKISGSMLEVWQGYITMETELGHINEARSIY 528

Query: 241 KRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLP 300
           KRCYSKRFTGTGSEDICH+WLRFERE+G LEDFDH+VQKVTPRLEEL+L+R QQESK+  
Sbjct: 529 KRCYSKRFTGTGSEDICHSWLRFEREFGALEDFDHAVQKVTPRLEELQLYRMQQESKAFV 588

Query: 301 ESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQNLAEENE 360
            SADQKE+ +K+  REKRK     + EQSPAKR+K  PQ  +K ++K K Q QNLAE  +
Sbjct: 589 ASADQKENPIKRNVREKRKGGPEYTDEQSPAKRKKQTPQ-TQKGYEKSKDQPQNLAEVTK 647

Query: 361 GRETKQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKASH 405
            +  ++T  +Q K+Q  KD   GR KG+TD+CTAFLSN++LKA++
Sbjct: 648 PK-VEKTDSKQEKQQ--KDYDSGRNKGYTDQCTAFLSNLHLKANY 689

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359486200|ref|XP_002268805.2| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739447|emb|CBI29629.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449450119|ref|XP_004142811.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356541840|ref|XP_003539380.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356560763|ref|XP_003548657.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Glycine max] Back     alignment and taxonomy information
>gi|224129810|ref|XP_002328808.1| predicted protein [Populus trichocarpa] gi|222839106|gb|EEE77457.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297799572|ref|XP_002867670.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313506|gb|EFH43929.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30686462|ref|NP_849551.1| protein embryo defective 140 [Arabidopsis thaliana] gi|332659481|gb|AEE84881.1| protein embryo defective 140 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30686466|ref|NP_194158.3| protein embryo defective 140 [Arabidopsis thaliana] gi|332659482|gb|AEE84882.1| protein embryo defective 140 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
TAIR|locus:2135892 817 EMB140 "EMBRYO DEFECTIVE 140" 0.963 0.478 0.565 1.6e-116
UNIPROTKB|E1BWJ0731 SART3 "Uncharacterized protein 0.913 0.507 0.290 1.9e-40
ZFIN|ZDB-GENE-040724-10 952 sart3 "squamous cell carcinoma 0.812 0.346 0.301 3.2e-38
UNIPROTKB|F1RGA7 959 SART3 "Uncharacterized protein 0.810 0.343 0.298 1.9e-37
UNIPROTKB|E2QXZ2 1082 SART3 "Uncharacterized protein 0.827 0.310 0.290 2e-37
RGD|1311646 960 Sart3 "squamous cell carcinoma 0.881 0.372 0.280 5.2e-37
UNIPROTKB|F1N0I9 655 SART3 "Uncharacterized protein 0.862 0.534 0.279 6.1e-37
MGI|MGI:1858230 962 Sart3 "squamous cell carcinoma 0.896 0.378 0.272 8.6e-37
UNIPROTKB|F8VV04771 SART3 "Squamous cell carcinoma 0.827 0.435 0.282 2.7e-36
UNIPROTKB|Q15020 963 SART3 "Squamous cell carcinoma 0.827 0.348 0.282 4.9e-36
TAIR|locus:2135892 EMB140 "EMBRYO DEFECTIVE 140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1148 (409.2 bits), Expect = 1.6e-116, P = 1.6e-116
 Identities = 228/403 (56%), Positives = 289/403 (71%)

Query:     1 MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLW 60
             M + RAHLEE IS+QDLSD+EKFQ++M Y+K+E++SGDP RVQ +YERA+ ++PVSSDLW
Sbjct:   272 MYSERAHLEENISKQDLSDTEKFQEFMNYIKFEKTSGDPTRVQAIYERAVAEYPVSSDLW 331

Query:    61 LDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVXXXXXXXXXXXXXXXISTVFEKSL 120
             +DYT YLDKTLKVG  +   YSRAT++CPW G+LW                I  VFEKSL
Sbjct:   332 IDYTVYLDKTLKVGKAITHAYSRATRSCPWTGDLWARYLLALERGSASEKEIYDVFEKSL 391

Query:   121 LCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDG 180
              C FS+FEEYLDL+LTR+DGLRRR+L +  +E  LDYSLIRETFQ+ASDYL+  M+NTD 
Sbjct:   392 QCTFSSFEEYLDLYLTRVDGLRRRMLSTRMLEA-LDYSLIRETFQQASDYLTPHMQNTDS 450

Query:   181 LLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIY 240
             LL L+ YWA+LE ++GKD+  ARGVW+  LK SG ML AW +YI ME+ L HI EARSIY
Sbjct:   451 LLHLHTYWANLELNIGKDLAGARGVWDSFLKKSGGMLAAWHAYIDMEVHLGHIKEARSIY 510

Query:   241 KRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLP 300
             +RCY+++F GTGSEDIC  WLRFERE+G LE FD +VQKV PRLEEL+L R QQES  + 
Sbjct:   511 RRCYTRKFDGTGSEDICKGWLRFEREHGDLEHFDLAVQKVMPRLEELQLMRLQQESTPVK 570

Query:   301 ESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQNLAEENE 360
              SA  KEHS      +KRK++ N+  E+S AKRQK   QK  +V D   +     A +N 
Sbjct:   571 PSAGLKEHS-----SQKRKAEQNVE-EESLAKRQKRKSQK--EV-DLGGQSATVPATKNV 621

Query:   361 GRETKQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKA 403
               E  +T +    K+  +DA P + K + DECTAF+SN+++KA
Sbjct:   622 KAENGKTADSD--KEETEDAKPLKPKVYRDECTAFISNLSVKA 662
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006396 "RNA processing" evidence=IEA
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
UNIPROTKB|E1BWJ0 SART3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040724-10 sart3 "squamous cell carcinoma antigen recognised by T cells 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RGA7 SART3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXZ2 SART3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1311646 Sart3 "squamous cell carcinoma antigen recognized by T-cells 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0I9 SART3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1858230 Sart3 "squamous cell carcinoma antigen recognized by T cells 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F8VV04 SART3 "Squamous cell carcinoma antigen recognized by T-cells 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q15020 SART3 "Squamous cell carcinoma antigen recognized by T-cells 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
smart0038633 smart00386, HAT, HAT (Half-A-TPR) repeats 0.003
>gnl|CDD|214642 smart00386, HAT, HAT (Half-A-TPR) repeats Back     alignment and domain information 
 Score = 34.8 bits (81), Expect = 0.003
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 37 GDPGRVQLLYERAITDFPVSSDLWLDYTQYL 67
          GD  R + +YERA+  FP S +LWL Y ++ 
Sbjct: 1  GDIERARKIYERALEKFPKSVELWLKYAEFE 31

Present in several RNA-binding proteins. Structurally and sequentially thought to be similar to TPRs. Length = 33

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 406
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 100.0
KOG1915 677 consensus Cell cycle control protein (crooked neck 100.0
KOG1915677 consensus Cell cycle control protein (crooked neck 100.0
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.89
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.88
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.88
KOG1258577 consensus mRNA processing protein [RNA processing 99.85
KOG1914656 consensus mRNA cleavage and polyadenylation factor 99.85
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.82
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.82
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.79
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.75
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.71
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 99.65
KOG1258577 consensus mRNA processing protein [RNA processing 99.64
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.63
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.61
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.51
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.5
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.46
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.45
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.45
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.4
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.38
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.36
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.33
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.33
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.3
PRK11189296 lipoprotein NlpI; Provisional 99.27
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.26
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.26
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.26
PRK11788389 tetratricopeptide repeat protein; Provisional 99.23
PRK11788389 tetratricopeptide repeat protein; Provisional 99.2
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.19
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.15
PRK12370553 invasion protein regulator; Provisional 99.12
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.12
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.12
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 99.06
PRK12370553 invasion protein regulator; Provisional 99.04
PRK11189296 lipoprotein NlpI; Provisional 99.04
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.03
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.99
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.93
KOG0547606 consensus Translocase of outer mitochondrial membr 98.91
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.89
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.85
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.84
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.84
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.76
KOG1125579 consensus TPR repeat-containing protein [General f 98.76
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.73
KOG0547606 consensus Translocase of outer mitochondrial membr 98.72
KOG1129478 consensus TPR repeat-containing protein [General f 98.7
KOG1125579 consensus TPR repeat-containing protein [General f 98.7
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.69
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.68
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.66
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.65
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.64
PLN03218 1060 maturation of RBCL 1; Provisional 98.64
PLN03218 1060 maturation of RBCL 1; Provisional 98.63
PLN02789320 farnesyltranstransferase 98.63
KOG1126638 consensus DNA-binding cell division cycle control 98.6
KOG2076 895 consensus RNA polymerase III transcription factor 98.59
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 98.57
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 98.56
KOG1126638 consensus DNA-binding cell division cycle control 98.56
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.55
PRK15359144 type III secretion system chaperone protein SscB; 98.55
PRK10370198 formate-dependent nitrite reductase complex subuni 98.52
PLN02789320 farnesyltranstransferase 98.48
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.46
PRK10370198 formate-dependent nitrite reductase complex subuni 98.44
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.43
PRK15359144 type III secretion system chaperone protein SscB; 98.4
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.31
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.31
KOG2076 895 consensus RNA polymerase III transcription factor 98.29
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.28
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.28
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.26
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.25
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.23
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.23
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 98.22
KOG2003840 consensus TPR repeat-containing protein [General f 98.21
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.19
PRK14574 822 hmsH outer membrane protein; Provisional 98.19
PLN03077857 Protein ECB2; Provisional 98.16
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.16
PRK14574 822 hmsH outer membrane protein; Provisional 98.15
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.13
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.1
KOG1128777 consensus Uncharacterized conserved protein, conta 98.02
PLN03077857 Protein ECB2; Provisional 98.02
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.0
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.97
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.96
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.96
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.95
KOG1128777 consensus Uncharacterized conserved protein, conta 97.94
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.93
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.91
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.85
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 97.85
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.83
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.8
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.77
KOG1129478 consensus TPR repeat-containing protein [General f 97.76
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 97.75
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.74
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.71
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.71
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.69
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.68
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 97.65
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.63
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.56
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.52
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 97.51
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.5
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.49
PF1342844 TPR_14: Tetratricopeptide repeat 97.45
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.44
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.44
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.43
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.41
PF1342844 TPR_14: Tetratricopeptide repeat 97.4
KOG0553304 consensus TPR repeat-containing protein [General f 97.39
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.33
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.32
PF1337173 TPR_9: Tetratricopeptide repeat 97.31
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.3
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.25
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.24
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 97.23
PF1337173 TPR_9: Tetratricopeptide repeat 97.21
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.19
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.13
KOG2003840 consensus TPR repeat-containing protein [General f 97.13
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.09
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.03
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.02
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.02
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.0
PRK11906458 transcriptional regulator; Provisional 96.93
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.93
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.9
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.87
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.85
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 96.82
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.82
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.8
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.79
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.74
KOG3785 557 consensus Uncharacterized conserved protein [Funct 96.7
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.65
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.58
PRK11906458 transcriptional regulator; Provisional 96.53
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.49
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.48
PRK10803263 tol-pal system protein YbgF; Provisional 96.45
PRK10803263 tol-pal system protein YbgF; Provisional 96.43
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.41
KOG0553304 consensus TPR repeat-containing protein [General f 96.37
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.35
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.28
PF12688120 TPR_5: Tetratrico peptide repeat 96.25
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.13
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.0
PF1343134 TPR_17: Tetratricopeptide repeat 95.98
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.69
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.66
PF12688120 TPR_5: Tetratrico peptide repeat 95.53
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.47
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.45
PF1343134 TPR_17: Tetratricopeptide repeat 95.25
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 95.17
PF13512142 TPR_18: Tetratricopeptide repeat 95.13
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.13
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.09
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.09
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 94.88
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 94.72
PRK15331165 chaperone protein SicA; Provisional 94.71
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.51
PRK15331165 chaperone protein SicA; Provisional 94.46
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.45
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 94.21
PF06552186 TOM20_plant: Plant specific mitochondrial import r 94.04
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 93.95
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.32
PRK04841903 transcriptional regulator MalT; Provisional 92.99
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.79
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 92.73
KOG4555175 consensus TPR repeat-containing protein [Function 92.62
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 92.43
PF13512142 TPR_18: Tetratricopeptide repeat 92.42
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 92.16
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.14
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.02
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.9
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.89
KOG4555175 consensus TPR repeat-containing protein [Function 91.69
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 91.56
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 91.49
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.34
PRK04841 903 transcriptional regulator MalT; Provisional 91.16
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 90.77
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 90.75
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 90.65
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.64
KOG2376 652 consensus Signal recognition particle, subunit Srp 90.51
COG0457291 NrfG FOG: TPR repeat [General function prediction 89.2
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 88.45
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 88.44
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.34
KOG4234271 consensus TPR repeat-containing protein [General f 88.07
COG4700251 Uncharacterized protein conserved in bacteria cont 87.97
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 86.02
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 85.6
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 84.72
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.62
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 84.34
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 83.05
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.08
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 81.01
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 80.82
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=9e-34  Score=285.81  Aligned_cols=373  Identities=31%  Similarity=0.481  Sum_probs=274.0

Q ss_pred             HHHHHHhcCCCCChhhHHHHHHHHHHHHhcCChhHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcchhhhHHHHHHHHHH
Q 015472            7 HLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATK   86 (406)
Q Consensus         7 ~yE~~L~~~~~~~~~~~~~w~~Yi~~E~~~g~~~~~~~lyEral~~~P~~~~lW~~Y~~~l~~~~~~~e~a~~vyerA~~   86 (406)
                      .||..+...+    ...+.|+.||+||+..|++.++..+|||++..++.+.++|+.|..|+...++.++.+..+|-||++
T Consensus       300 ~~e~~~q~~~----~~~q~~~~yidfe~~~G~p~ri~l~~eR~~~E~~~~~~~wi~y~~~~d~eLkv~~~~~~~~~ra~R  375 (881)
T KOG0128|consen  300 KFERLVQKEP----IKDQEWMSYIDFEKKSGDPVRIQLIEERAVAEMVLDRALWIGYGVYLDTELKVPQRGVSVHPRAVR  375 (881)
T ss_pred             HHHHHhhhhH----HHHHHHHHHHHHHHhcCCchHHHHHHHHHHHhccccHHHHhhhhhhcccccccccccccccchhhc
Confidence            4555555544    468899999999999999999999999999999999999999999999888889999999999999


Q ss_pred             hCCCCHHHHHHHHHHHHHccCCHHHHHHHHHHHHhCccccHHHHHHHHHHHHHHHHHHHhccccchhhhhHHHHHHHHHH
Q 015472           87 NCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQR  166 (406)
Q Consensus        87 ~~P~~~~lW~~y~~~lE~~~~~~e~ar~if~~al~~~~~~~~~~~~l~~~~~~~l~Rr~~~~~~~e~~~~~~~~r~~f~~  166 (406)
                      +|||.+.||..|+..|++.......+-..+.+++..+..       ++   .+++.+|...... ....+++.+|.+|+.
T Consensus       376 ~cp~tgdL~~rallAleR~re~~~vI~~~l~~~ls~~~~-------l~---~~~~~~rr~~~~~-~~s~~~s~lr~~F~~  444 (881)
T KOG0128|consen  376 SCPWTGDLWKRALLALERNREEITVIVQNLEKDLSMTVE-------LH---NDYLAYRRRCTNI-IDSQDYSSLRAAFNH  444 (881)
T ss_pred             CCchHHHHHHHHHHHHHhcCcchhhHHHHHHHHHHHHHH-------HH---HHHHHHHHhhccc-chhhhHHHHHHHHHH
Confidence            999999999999999998888888899999988876442       11   1222211111111 123567889999999


Q ss_pred             HHHHHhhhhcC-CchHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhccchHH-HHHHHHHHHHHcccHHHHHHHHHHHH
Q 015472          167 ASDYLSEQMKN-TDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLE-AWQSYISMEIELDHINEARSIYKRCY  244 (406)
Q Consensus       167 a~~~l~~~~~~-~~~~~~l~~~~a~~e~~~~~d~~~Ar~ife~al~~~~~~~~-lW~~y~~~E~~~g~~~~ar~l~~ral  244 (406)
                      |..+|...+.. .++.+.+...||++|..++++++.+|.||...+...+.+.. .|+.|+++|..+|+...||.++.+|+
T Consensus       445 A~~eLt~~~~~~~Dt~~~~~q~wA~~E~sl~~nmd~~R~iWn~imty~~~~iag~Wle~~~lE~~~g~~~~~R~~~R~ay  524 (881)
T KOG0128|consen  445 AWEELTELYGDQLDTRTEVLQLWAQVEASLLKNMDKAREIWNFIMTYGGGSIAGKWLEAINLEREYGDGPSARKVLRKAY  524 (881)
T ss_pred             HHHHHHHHhhhhhhhHHHHHHHHHHHHHHHhhchhhhhHhhhccccCCcchHHHHHHHHHhHHHHhCCchhHHHHHHHHH
Confidence            99999888877 78889999999999999988999999999999998666665 99999999999999999999999999


Q ss_pred             hcccCCCChHHHHHHHHHHHHHhCCHHHHHHHHHhhchhHHHHHHHHhhhhhccCCCchhhhhhhhhhcccccccCCCCc
Q 015472          245 SKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPESADQKEHSVKKTGREKRKSDSNI  324 (406)
Q Consensus       245 ~~~~~~~~~~~i~~~~i~fE~~~G~~e~~~~a~~k~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~krk~~~~~  324 (406)
                      ...+.......+++.|..||+++|+++.+..|..+.+||.....++++++++....     ++...+...+.++|.....
T Consensus       525 ~~~~~~~~~~ev~~~~~r~Ere~gtl~~~~~~~~~~~pr~~~~~~~~~e~~s~~v~-----p~~~~ke~~~~~~k~~~~v  599 (881)
T KOG0128|consen  525 SQVVDPEDALEVLEFFRRFEREYGTLESFDLCPEKVLPRVYEAPLERREKESTNVY-----PEQQKKEIQRRQFKGEGNV  599 (881)
T ss_pred             hcCcCchhHHHHHHHHHHHHhccccHHHHhhhHHhhcchhhhhhhhhhhhcccCCC-----cchhhHHhhHHHhhccccc
Confidence            86554444678999999999999999999999999999999888887777654322     1112221222233333222


Q ss_pred             cccCCcccccccCCCCC-----cccchhhHHHHhhhhhh-hhccccc-cccccCCCCCCcccCCCCCCCCCCCccceeee
Q 015472          325 SYEQSPAKRQKHAPQKP-----KKVHDKEKRQVQNLAEE-NEGRETK-QTVEEQPKKQPIKDAVPGRTKGFTDECTAFLS  397 (406)
Q Consensus       325 ~~~~~~~k~~k~~~~~~-----~~~~~~~~~~~~~~~~~-~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~  397 (406)
                      ..-.-|.++.|.-.+.-     +...+.+.      ..+ ..|..+. ...++..++.+..+..+..++.+++.||+|+|
T Consensus       600 ekv~~p~~g~k~h~q~~~~~~~s~~~~~es------at~pa~~~~a~~~~av~~ad~~~~~~~~kvs~n~~R~~~~~fvs  673 (881)
T KOG0128|consen  600 EKVNGPKRGFKAHEQPQQQKVQSKHGSAES------ATVPAGGALANRSAAVGLADAEEKEENFKVSPNEIRDLIKIFVS  673 (881)
T ss_pred             ccccCccccccccccchhhhhhccccchhh------cccccccccCCccccCCCCCchhhhhccCcCchHHHHHHHHHHh
Confidence            22122222333321100     00111101      111 1111111 12112211113347788899999999999999


Q ss_pred             cccccccC
Q 015472          398 NINLKASH  405 (406)
Q Consensus       398 n~~~~~~~  405 (406)
                      ||++.+.+
T Consensus       674 nl~~~~~~  681 (881)
T KOG0128|consen  674 NLSPKMSE  681 (881)
T ss_pred             hcchhhcC
Confidence            99998764

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 5e-30
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 5e-07
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-27
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-09
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-07
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-25
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 2e-24
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-13
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
 Score =  121 bits (303), Expect = 5e-30
 Identities = 42/351 (11%), Positives = 109/351 (31%), Gaps = 20/351 (5%)

Query: 9   EEQISRQDLSDSEKFQQYMIYLKYE-------QSSGDPGRVQLLYERAITDFPVSSDLWL 61
           E  + + +  D ++   ++ ++++E              R+  +Y +A      + ++W 
Sbjct: 288 ESNLPKPNEYDVQQLLIWLEWIRWESDNKLELSDDLHKARMTYVYMQAAQHVCFAPEIWF 347

Query: 62  DYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEE--EISTVFEKS 119
           +   Y  +      V+        +  P    L        E +    E           
Sbjct: 348 NMANYQGEKNTDSTVITKYLKLGQQCIPNSAVLAFSLSEQYELNTKIPEIETTILSCIDR 407

Query: 120 LLCAFSTFEEYLDLFLTRIDGLRRR-----ILFSGEVEGVLDYSLIRETFQRASDYLSEQ 174
           +    +   E      + I+ L+ +      ++   ++ +   +  R+ F +        
Sbjct: 408 IHLDLAALMEDDPTNESAINQLKSKLTYVYCVYMNTMKRIQGLAASRKIFGKCRRLKKLV 467

Query: 175 MKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHIN 234
             +       Y   A++E  + KD  +A  V E  LK      E    Y+   I ++  +
Sbjct: 468 TPDI------YLENAYIEYHISKDTKTACKVLELGLKYFATDGEYINKYLDFLIYVNEES 521

Query: 235 EARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQ 294
           + +S+++    K       + I    + FE + G+L       ++   +  E+       
Sbjct: 522 QVKSLFESSIDKISDSHLLKMIFQKVIFFESKVGSLNSVRTLEKRFFEKFPEVNKLEEFT 581

Query: 295 ESKSLPESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVH 345
               + +    +   +    R+       +    +  KR     +  +   
Sbjct: 582 NKYKVLDVNYLQRLELDYMVRDVMPEAIALDRGSNNLKRTMREEEDGQAFK 632
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.97
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.95
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.95
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.94
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.91
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.9
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.66
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.66
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.64
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.63
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.62
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.62
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.6
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.59
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.58
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.57
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.56
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.56
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.55
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.55
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.55
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.54
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.52
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.5
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.5
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.49
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.49
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.47
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.47
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.45
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.45
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.45
3u4t_A272 TPR repeat-containing protein; structural genomics 99.43
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.42
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.42
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.4
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.39
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.39
3u4t_A272 TPR repeat-containing protein; structural genomics 99.38
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.37
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.36
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.36
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.36
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.32
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.32
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.29
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.27
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.22
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.2
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.2
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.18
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.18
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.17
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.15
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.11
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.11
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.08
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.06
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.05
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.03
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.03
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.02
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.02
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.01
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.99
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.98
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.95
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.94
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.91
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.91
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.9
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.88
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.84
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.84
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.83
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.82
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.81
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.81
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.75
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.75
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.72
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.72
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.71
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.71
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.7
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.68
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.66
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.65
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.65
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.64
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.64
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.63
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.62
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.62
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.62
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.61
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.61
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.6
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.59
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.59
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.56
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.55
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.54
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.51
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.51
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.51
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.51
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.49
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.48
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 98.48
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.46
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.45
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.45
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.43
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.42
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 98.42
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.41
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.4
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.4
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 98.39
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.36
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.36
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.34
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.33
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.33
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.32
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.32
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.31
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.3
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.3
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.29
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.27
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 98.25
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.23
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.22
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.21
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.19
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.18
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.17
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.15
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.13
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.13
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.12
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.11
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.1
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.1
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.08
3k9i_A117 BH0479 protein; putative protein binding protein, 98.08
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.07
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.06
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.03
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.02
3k9i_A117 BH0479 protein; putative protein binding protein, 98.01
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.99
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.97
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.95
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.94
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.9
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.9
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.89
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.88
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.88
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.87
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.87
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.85
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.84
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 97.81
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.81
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 97.8
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.79
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.75
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.75
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.74
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.71
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.7
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.68
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.67
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.66
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.65
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.64
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.64
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.61
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.6
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.54
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.54
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.52
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.51
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.46
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 97.42
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.39
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.33
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.24
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.23
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.15
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 97.15
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.09
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.08
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.06
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.0
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 96.99
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.88
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.73
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.73
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.56
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.53
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.49
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.34
1klx_A138 Cysteine rich protein B; structural genomics, heli 94.52
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.52
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.97
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.96
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.45
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.03
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 92.74
1klx_A138 Cysteine rich protein B; structural genomics, heli 92.05
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 83.75
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.43
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
Probab=99.97  E-value=1.5e-29  Score=265.66  Aligned_cols=241  Identities=15%  Similarity=0.208  Sum_probs=198.2

Q ss_pred             hhHHHHHHHHHHHHhcC-------ChhHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcchhhhHH-HHHHHHHHhCCCCH
Q 015472           21 EKFQQYMIYLKYEQSSG-------DPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVR-DVYSRATKNCPWVG   92 (406)
Q Consensus        21 ~~~~~w~~Yi~~E~~~g-------~~~~~~~lyEral~~~P~~~~lW~~Y~~~l~~~~~~~e~a~-~vyerA~~~~P~~~   92 (406)
                      ..+.+|..|++||+..+       ...+++.+|++||..+|.++++|+.|+.|+...+ ..+.++ .+|+||+.+||.+.
T Consensus       300 ~ql~lW~~yi~fEk~~~~~l~~~~~~~Rv~~~Ye~aL~~~p~~~~lW~~ya~~~~~~~-~~~~a~r~il~rAi~~~P~s~  378 (679)
T 4e6h_A          300 QQLLIWLEWIRWESDNKLELSDDLHKARMTYVYMQAAQHVCFAPEIWFNMANYQGEKN-TDSTVITKYLKLGQQCIPNSA  378 (679)
T ss_dssp             HHHHHHHHHHHHHHTCTTCCCHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHS-CCTTHHHHHHHHHHHHCTTCH
T ss_pred             HHHHHHHHHHHHHHhCCccccchhhHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhcC-cHHHHHHHHHHHHHHhCCCCH
Confidence            45789999999999875       2467889999999999999999999999998876 346675 99999999999999


Q ss_pred             HHHHHHHHHHHHccCCHHHHHHHHHHHHhCccccH------------------HHHHHHHHHHHHHHHHHHhccccchhh
Q 015472           93 ELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTF------------------EEYLDLFLTRIDGLRRRILFSGEVEGV  154 (406)
Q Consensus        93 ~lW~~y~~~lE~~~~~~e~ar~if~~al~~~~~~~------------------~~~~~l~~~~~~~l~Rr~~~~~~~e~~  154 (406)
                      .||..|+.+.+ ..++++.|+.+|++++...+...                  .....+|+.++...+ |.         
T Consensus       379 ~Lwl~~a~~ee-~~~~~e~aR~iyek~l~~l~~~~~~~~~~~p~~~~~~~~~~~~~~~vWi~y~~~er-R~---------  447 (679)
T 4e6h_A          379 VLAFSLSEQYE-LNTKIPEIETTILSCIDRIHLDLAALMEDDPTNESAINQLKSKLTYVYCVYMNTMK-RI---------  447 (679)
T ss_dssp             HHHHHHHHHHH-HTTCHHHHHHHHHHHHHHHHHHHHHHHHHSTTCHHHHHHHHHHHHHHHHHHHHHHH-HH---------
T ss_pred             HHHHHHHHHHH-HhCCHHHHHHHHHHHHHHHHHHhhhhhhccCcchhhhhhhccchHHHHHHHHHHHH-Hc---------
Confidence            99999998555 57889999999999998532100                  012345655554443 33         


Q ss_pred             hhHHHHHHHHHHHHHHHhhhhcCCchHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhccchHHHHHHHHHHHHHcccHH
Q 015472          155 LDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHIN  234 (406)
Q Consensus       155 ~~~~~~r~~f~~a~~~l~~~~~~~~~~~~l~~~~a~~e~~~~~d~~~Ar~ife~al~~~~~~~~lW~~y~~~E~~~g~~~  234 (406)
                      ++++.+|.+|.+|++.+.      +....+|+.+|.+|...++++++||.||+++++.+|+++.+|+.|++|+...|+.+
T Consensus       448 ~~l~~AR~vf~~A~~~~~------~~~~~lyi~~A~lE~~~~~d~e~Ar~ife~~Lk~~p~~~~~w~~y~~fe~~~~~~~  521 (679)
T 4e6h_A          448 QGLAASRKIFGKCRRLKK------LVTPDIYLENAYIEYHISKDTKTACKVLELGLKYFATDGEYINKYLDFLIYVNEES  521 (679)
T ss_dssp             HCHHHHHHHHHHHHHTGG------GSCTHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTCHH
T ss_pred             CCHHHHHHHHHHHHHhcC------CCChHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHCCCchHHHHHHHHHHHhCCCHH
Confidence            345689999999987631      12356899999999998767999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcccC-CCChHHHHHHHHHHHHHhCCHHHHHHHHHhh
Q 015472          235 EARSIYKRCYSKRFT-GTGSEDICHAWLRFEREYGTLEDFDHSVQKV  280 (406)
Q Consensus       235 ~ar~l~~ral~~~~~-~~~~~~i~~~~i~fE~~~G~~e~~~~a~~k~  280 (406)
                      +||.+|++|+.. ++ ...+..||..|+.||..+|+++++..+.+++
T Consensus       522 ~AR~lferal~~-~~~~~~~~~lw~~~~~fE~~~G~~~~~~~v~~R~  567 (679)
T 4e6h_A          522 QVKSLFESSIDK-ISDSHLLKMIFQKVIFFESKVGSLNSVRTLEKRF  567 (679)
T ss_dssp             HHHHHHHHHTTT-SSSTTHHHHHHHHHHHHHHHTCCSHHHHHHHHHH
T ss_pred             HHHHHHHHHHHh-cCCHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHH
Confidence            999999999985 44 2357899999999999999999987765554
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 406
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 5e-19
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 84.6 bits (208), Expect = 5e-19
 Identities = 51/291 (17%), Positives = 101/291 (34%), Gaps = 46/291 (15%)

Query: 19  DSEKFQQYMIYLKYEQS--------SGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKT 70
           ++++   +  Y+++E+S        +    RV   YE+ +       D+W +  QYL+++
Sbjct: 4   EAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQS 63

Query: 71  LKV-------------GNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFE 117
            K+              +   ++Y RA         L   +    E SR   E++ +++ 
Sbjct: 64  SKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYN 123

Query: 118 KSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKN 177
           + L             +                    + ++   E  +       +  ++
Sbjct: 124 RLLAIEDIDPTLVYIQY--------------------MKFARRAEGIKSGRMIFKKARED 163

Query: 178 TDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEAR 237
                 +Y   A +E    KD   A  ++E  LK  G + E   +YI     L+  N  R
Sbjct: 164 ARTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTR 223

Query: 238 SIYKRCYSK-RFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEEL 287
            +++R  +        S +I   +L FE   G L     S+ KV  R    
Sbjct: 224 VLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLA----SILKVEKRRFTA 270

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.98
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.91
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.56
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.54
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.51
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.33
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.29
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.17
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.06
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.05
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.84
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.5
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.46
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.44
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.36
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.35
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.35
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.22
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.22
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.17
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.12
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.03
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.97
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.93
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.92
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.9
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.8
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.76
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.71
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.7
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.67
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.58
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.57
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.52
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.51
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.39
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.24
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.22
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.2
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.03
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.68
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.59
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.58
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.14
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.87
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.47
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 87.28
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 87.06
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 83.41
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.98  E-value=9.6e-31  Score=247.97  Aligned_cols=237  Identities=22%  Similarity=0.277  Sum_probs=192.5

Q ss_pred             hhhHHHHHHHHHHHHhcC--------ChhHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcc-------------hhhhHH
Q 015472           20 SEKFQQYMIYLKYEQSSG--------DPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLK-------------VGNVVR   78 (406)
Q Consensus        20 ~~~~~~w~~Yi~~E~~~g--------~~~~~~~lyEral~~~P~~~~lW~~Y~~~l~~~~~-------------~~e~a~   78 (406)
                      ...+++|+.|++||++++        ..++|..+|+|||..+|.++++|+.|+.|+...++             ..+.++
T Consensus         5 ~~~~~~W~~yi~~E~~~~~~~~~~~~~~~Rv~~vyerAl~~~~~~~~lW~~y~~~~~~~~~~~~~~~~~~~~~~~~~~a~   84 (308)
T d2onda1           5 AQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAA   84 (308)
T ss_dssp             HHHHHHHHHHHHHHHTCTTCCCCHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHTSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhCcccccccchhHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHcCchHHHHHHHhhcccchHHHH
Confidence            456789999999999875        24689999999999999999999999999876432             246799


Q ss_pred             HHHHHHHHh-CCCCHHHHHHHHHHHHHccCCHHHHHHHHHHHHhCccccHHHHHHHHHHHHHHHHHHHhccccchhhhhH
Q 015472           79 DVYSRATKN-CPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDY  157 (406)
Q Consensus        79 ~vyerA~~~-~P~~~~lW~~y~~~lE~~~~~~e~ar~if~~al~~~~~~~~~~~~l~~~~~~~l~Rr~~~~~~~e~~~~~  157 (406)
                      .+|+||+.. +|.+..+|..|+.+ +...++++.++.+|++++...+...   ..+|..++..+++ .         +++
T Consensus        85 ~i~~ral~~~~p~~~~l~~~ya~~-~~~~~~~~~a~~i~~~~l~~~~~~~---~~~w~~~~~~~~~-~---------~~~  150 (308)
T d2onda1          85 NIYERAISTLLKKNMLLYFAYADY-EESRMKYEKVHSIYNRLLAIEDIDP---TLVYIQYMKFARR-A---------EGI  150 (308)
T ss_dssp             HHHHHHHTTTTTTCHHHHHHHHHH-HHHTTCHHHHHHHHHHHHTSSSSCT---HHHHHHHHHHHHH-H---------HCH
T ss_pred             HHHHHHHHHcCCCCHHHHHHHHHH-HHhcccHHHHHHHHHHHHHHhcCCh---HHHHHHHHHHHHH-c---------CCh
Confidence            999999985 68889999999985 4568999999999999999766421   1223333333322 1         345


Q ss_pred             HHHHHHHHHHHHHHhhhhcCCchHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhccchHHHHHHHHHHHHHcccHHHHH
Q 015472          158 SLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEAR  237 (406)
Q Consensus       158 ~~~r~~f~~a~~~l~~~~~~~~~~~~l~~~~a~~e~~~~~d~~~Ar~ife~al~~~~~~~~lW~~y~~~E~~~g~~~~ar  237 (406)
                      ..++.+|++|+..       ++....+|+.++.++....++++.|+.+|++++..+|+++.+|+.|++|+..+|++++||
T Consensus       151 ~~ar~i~~~al~~-------~~~~~~~~~~~a~~e~~~~~~~~~a~~i~e~~l~~~p~~~~~w~~y~~~~~~~g~~~~aR  223 (308)
T d2onda1         151 KSGRMIFKKARED-------ARTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTR  223 (308)
T ss_dssp             HHHHHHHHHHHTS-------TTCCTHHHHHHHHHHHHTSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCCHHHHH
T ss_pred             HHHHHHHHHHHHh-------CCCcHHHHHHHHHHHHHhccCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHcCChHHHH
Confidence            5788899888765       344567899999998876559999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcccCCC--ChHHHHHHHHHHHHHhCCHHHHHHHHH
Q 015472          238 SIYKRCYSKRFTGT--GSEDICHAWLRFEREYGTLEDFDHSVQ  278 (406)
Q Consensus       238 ~l~~ral~~~~~~~--~~~~i~~~~i~fE~~~G~~e~~~~a~~  278 (406)
                      .+|++|+.. ++.+  ....||..|+.||+.||+++++..+.+
T Consensus       224 ~~fe~ai~~-~~~~~~~~~~iw~~~~~fE~~~G~~~~~~~~~~  265 (308)
T d2onda1         224 VLFERVLTS-GSLPPEKSGEIWARFLAFESNIGDLASILKVEK  265 (308)
T ss_dssp             HHHHHHHHS-SSSCGGGCHHHHHHHHHHHHHHSCHHHHHHHHH
T ss_pred             HHHHHHHHh-CCCChHHHHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            999999984 4432  346799999999999999998876443
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure