Citrus Sinensis ID: 015694

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--

MAVQEGSPAPSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFRFVEENESLENNSDSVVNETAPTANVTEAPEPAHDQDHIPADRAIVIEGEDLDNGPEVCDPSDKEEGSVVEDEIVEPPSNSVQNEVHASVDSAPVAQGDAPEKKSYASIVKVMKGYNISSAAYVPARKARPTPPNADQQSPAMAKPAPVPEASALSSDGAPENSNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNKQGYCFGFVAFETPGSVQSALEVLSLISLSLIIKIVLGVYIISRTFIEVQILVEPLECALFGT

cccccccccccHHHHHHHHHHHHHHHHcccccHHHHccccccEEEcccccccccEEccHHHHHHHHHcccccccEEEEEEEEEEEcccccEEEEEEEEEEccccccEEEEEEEEEEEcccccEEEEccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHcccEEEcEEEEEEcccccEEEEEEEccHHHHHHHHHHcccccccEEEEEEEcEEEEEEEEEEEEEEEEccccccccc

cccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHcccccEEEcccccccccEEccHHHHHHHHHcccccccEEEEEEEEccccccccEEEEEEEEEEcccccccEEEEEEEEcccccccEEEEccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHccccccccEEEEccccccEEEEEEEccHHHHHHHHHccccHHHEEEEEEEEEEEEEEHcEEEEEEEEccHHHHHccc

mavqegspapsaqvvgNAFVEQYYHILhqspglvhrfyqdssllsrpdsngsmtTVTTMKAINDRILSLNYEDYTAEiktadaqdsyeKGVIVLVTGCltgkdnvkkKFTQTfflapqdkggyfvlNDVFRFVEeneslennsdsvvnetaptanvteapepahdqdhipadraiviegedldngpevcdpsdkeegsvvedeiveppsnsvqnevhasvdsapvaqgdapekkSYASIVKVMKGynissaayvparkarptppnadqqspamakpapvpeasalssdgapensnvneeaegCSIYVRNLAFTTTSTELEEAFKIfgpikkngvqvrsnkqgycfgfvafetpgsvQSALEVLSLISLSLIIKIVLGVYIISRTFIEVQILVEplecalfgt

mavqegspapsaqVVGNAFVEQYYHILHQSPGLVHRFYQDSSLlsrpdsngsmTTVTTMKAINDRILSLNYEDYTAEIktadaqdsyekGVIVLVTGCLTGKDNVKKKFTQTFflapqdkggyFVLNDVFRFVEENEslennsdsvvnETAPTANVteapepahdqdhiPADRAIVIEGEDLDNGPEVCDPSDKEEGSVVEDEIVEPPSNSVQNEVHASVdsapvaqgdapeKKSYASIVKVMKGYNISSAAYVPARKARPTPPNADQQSPAMAKPAPVPEASALSSDGAPENSNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNKQGYCFGFVAFETPGSVQSALEVLSLISLSLIIKIVLGVYIISRTFIEVQILVEPLECALFGT

MAVQEGSPAPSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFRFveeneslennsdsvvneTAPTANVTEAPEPAHDQDHIPADRAIVIEGEDLDNGPEVCDPSDKEEGSVVEDEIVEPPSNSVQNEVHASVDSAPVAQGDAPEKKSYASIVKVMKGYNISSAAYVPARKARPTPPNADQQSPAMAKPAPVPEASALSSDGAPENSNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNKQGYCFGFVAFETPGSVQsalevlslislsliikivlGVYIISRTFIEVQILVEPLECALFGT

*************VVGNAFVEQYYHILHQSPGLVHRFYQD**************TVTTMKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFRFVE******************************************************************************************************ASIVKVMKGYNISSAAY************************************************GCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNKQGYCFGFVAFETPGSVQSALEVLSLISLSLIIKIVLGVYIISRTFIEVQILVEPLECALF**

************QVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFRFVEENESLEN********************************************************************************************************************************************ASALSS******SNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNKQGYCFGFVAFETPGSVQSALEVLSLISLSLIIKIVLGVYIISRTFIEVQILVEPLECALFG*

***********AQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFRFVEENE*************APTANVTEAPEPAHDQDHIPADRAIVIEGEDLDNGP***************DEIVEPPSNSVQNEVHASVDSA***********SYASIVKVMKGYNISSAAYVPAR*****************************************EAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNKQGYCFGFVAFETPGSVQSALEVLSLISLSLIIKIVLGVYIISRTFIEVQILVEPLECALFGT

********APSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFRFVEEN*******************************************************************************************************************************************************************AEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNKQGYCFGFVAFETPGSVQSALEVLSLISLSLIIKIVLGVYIISRTFIEVQILVEPLECALFGT

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		402	2.2.26 [Sep-21-2011]
O94260		434	Putative G3BP-like protei	yes	no	0.726	0.672	0.277	8e-20
P97855		465	Ras GTPase-activating pro	yes	no	0.313	0.270	0.366	8e-18
Q13283		466	Ras GTPase-activating pro	yes	no	0.313	0.270	0.366	1e-17
Q5RB87		466	Ras GTPase-activating pro	yes	no	0.313	0.270	0.366	1e-17
Q32LC7		465	Ras GTPase-activating pro	yes	no	0.313	0.270	0.366	2e-17
P97379		482	Ras GTPase-activating pro	no	no	0.313	0.261	0.358	8e-16
Q5R9L3		482	Ras GTPase-activating pro	no	no	0.313	0.261	0.358	8e-16
Q9UN86		482	Ras GTPase-activating pro	no	no	0.313	0.261	0.358	8e-16
Q96VN3		125	Nuclear transport factor	no	no	0.288	0.928	0.341	5e-09
Q86HW7		127	Nuclear transport factor	yes	no	0.293	0.929	0.301	4e-08

>sp\|O94260\|G3BP_SCHPO Putative G3BP-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nxt3 PE=1 SV=1	Back alignment and function desciption

 Score = 98.6 bits (244), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 97/349 (27%), Positives = 151/349 (43%), Gaps = 57/349 (16%)

Query: 15  VGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLNYEDY 74
           +G  FV++YY  L++ P  +H FY   S L   D   S++     + I+++IL L++++ 
Sbjct: 18  IGWMFVQEYYTYLNKEPNRLHCFYTKKSTLIHGDEGESISLCHGQQEIHNKILDLDFQNC 77

Query: 75  TAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFRFVE 134
              I   D+  S   G+++ V G ++ K  + +KF QTFFLA Q   GYFVLND+FRF+ 
Sbjct: 78  KVLISNVDSLASSNGGIVIQVLGEMSNKGKLSRKFAQTFFLAEQ-PNGYFVLNDIFRFLR 136

Query: 135 EN-------------ESLENNSDSVVNETAPTANVTEAPEPAHDQDHIP-----ADRAIV 176
           E+             E  +  S+  VN      ++  A E  H QD        A  A++
Sbjct: 137 EDVEEEEESPDAVEKEKKDVASEPYVNGVQSQEHLPSAKEEGHYQDPAATENNFATAALI 196

Query: 177 IEGEDLDNGPEVCDPSDK----EEGSVVEDEIVEPPSNSVQNEVHASVDSAPVAQGD--- 229
               D  N   +  P +      E SV     V    N +Q+E   S      A G    
Sbjct: 197 SNETDSLNQATLAVPEEPVIQVTEASV--PSFVSQQENQLQDEALTSNSKNADAIGASDA 254

Query: 230 --APEKKSYASIV-----KVMKGYNISSAAYVPARKARPTPPNADQ-QSPAMAKPAPVPE 281
             A   KS+A ++      V    ++SS A    +  +    NADQ Q P     AP  +
Sbjct: 255 NVATAPKSWADLIARNHPDVKSQASVSSTASTTGQTVKGV--NADQTQQPT----APYTQ 308

Query: 282 ASALSSDGAPENSNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIK 330
           ++ L                  S++V+N+   T+   L+ A  IFGP+K
Sbjct: 309 SNELLE---------------TSVFVKNIPPETSDVSLKSAMSIFGPVK 342

Probable scaffold protein that may be involved in mRNA transport.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)

>sp\|P97855\|G3BP1_MOUSE Ras GTPase-activating protein-binding protein 1 OS=Mus musculus GN=G3bp1 PE=1 SV=1	Back alignment and function description

>sp\|Q13283\|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens GN=G3BP1 PE=1 SV=1	Back alignment and function description

>sp\|Q5RB87\|G3BP1_PONAB Ras GTPase-activating protein-binding protein 1 OS=Pongo abelii GN=G3BP1 PE=2 SV=1	Back alignment and function description

>sp\|Q32LC7\|G3BP1_BOVIN Ras GTPase-activating protein-binding protein 1 OS=Bos taurus GN=G3BP PE=2 SV=1	Back alignment and function description

>sp\|P97379\|G3BP2_MOUSE Ras GTPase-activating protein-binding protein 2 OS=Mus musculus GN=G3bp2 PE=1 SV=2	Back alignment and function description

>sp\|Q5R9L3\|G3BP2_PONAB Ras GTPase-activating protein-binding protein 2 OS=Pongo abelii GN=G3BP2 PE=2 SV=1	Back alignment and function description

>sp\|Q9UN86\|G3BP2_HUMAN Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens GN=G3BP2 PE=1 SV=2	Back alignment and function description

>sp\|Q96VN3\|NTF2_EMENI Nuclear transport factor 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ntf2 PE=3 SV=1	Back alignment and function description

>sp\|Q86HW7\|NTF2_DICDI Nuclear transport factor 2 OS=Dictyostelium discoideum GN=nutf2 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		402
224130028		393	predicted protein [Populus trichocarpa]	0.885	0.905	0.630	1e-120
449440854		472	PREDICTED: ras GTPase-activating protein	0.895	0.762	0.624	1e-117
449525281		472	PREDICTED: LOW QUALITY PROTEIN: ras GTPa	0.895	0.762	0.621	1e-116
255547171		464	RNA binding protein, putative [Ricinus c	0.895	0.775	0.618	1e-116
297734068		500	unnamed protein product [Vitis vinifera]	0.885	0.712	0.619	1e-116
356562630		460	PREDICTED: putative G3BP-like protein-li	0.885	0.773	0.6	1e-114
359491760		469	PREDICTED: LOW QUALITY PROTEIN: putative	0.880	0.754	0.606	1e-114
356511786		462	PREDICTED: putative G3BP-like protein-li	0.885	0.770	0.594	1e-111
147854968		1124	hypothetical protein VITISV_043950 [Viti	0.828	0.296	0.530	1e-96
30697452		459	nuclear transport factor 2 and RNA recog	0.860	0.753	0.581	5e-96

>gi\|224130028\|ref\|XP_002328636.1\| predicted protein [Populus trichocarpa] gi\|222838812\|gb\|EEE77163.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 235/373 (63%), Positives = 282/373 (75%), Gaps = 17/373 (4%)

Query: 1   MAVQEGSPA--PSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTT 58
           MA QE +PA  PSA+VVGNAFVEQYYHILH+SP LVHRFYQDSS LSRP+++G MTTVTT
Sbjct: 1   MATQETAPASGPSAEVVGNAFVEQYYHILHESPELVHRFYQDSSSLSRPNTDGFMTTVTT 60

Query: 59  MKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQ 118
           M+AIND+ILSLNY+DYTAEIKTADAQ+S+EKGVIVLVTGCLTGKD+VKKKFTQTFFLAPQ
Sbjct: 61  MQAINDKILSLNYKDYTAEIKTADAQESHEKGVIVLVTGCLTGKDDVKKKFTQTFFLAPQ 120

Query: 119 DKGGYFVLNDVFRFVEENESLENNSDSVVN---ETAPTANVTEA-------PEPAHDQDH 168
           +K GYFVLNDVFRFV ENE + N S ++ N   E+AP A   E+       P+P    DH
Sbjct: 121 EK-GYFVLNDVFRFVGENEPMPNTS-ALANGIVESAPPALTAESGWDDVVEPDPTQATDH 178

Query: 169 IPADRAIVIEGEDLDNGPEVCDPSDKEEGSVVEDEIVEPPSNSVQNEVHASVDSAPVAQG 228
           +  D A   E EDL+NG EVCD SDKE+GSV++ E+VEP ++S QNE+ A++++AP +  
Sbjct: 179 LTVDPATSFEEEDLNNGSEVCDHSDKEDGSVIDIEVVEPVTDSTQNEILATINAAPASLE 238

Query: 229 DAPEKKSYASIVKVMKGYNISSAAYVPARKARPTPPNADQQSPAMAKPAPVPEASALSSD 288
           DAP K SYASI+KVMKG N     +    K R  P + +QQS   AK A  PEA A +  
Sbjct: 239 DAP-KISYASILKVMKG-NTPHPVHFSMTKMRAAPISIEQQSANSAKSA-APEALASAGS 295

Query: 289 GAPENSNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNKQGYCFGFV 348
            A E S+V+EEAEG SI+V+NL F  T  +LEEAFK FGPIK  G+QVRS+KQG+CFGFV
Sbjct: 296 SAGETSDVHEEAEGHSIFVKNLPFDATVEQLEEAFKHFGPIKHGGIQVRSSKQGFCFGFV 355

Query: 349 AFETPGSVQSALE 361
            FET  S+Q ALE
Sbjct: 356 EFETMSSMQGALE 368

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449440854\|ref\|XP_004138199.1\| PREDICTED: ras GTPase-activating protein-binding protein 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449525281\|ref\|XP_004169646.1\| PREDICTED: LOW QUALITY PROTEIN: ras GTPase-activating protein-binding protein 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255547171\|ref\|XP_002514643.1\| RNA binding protein, putative [Ricinus communis] gi\|223546247\|gb\|EEF47749.1\| RNA binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|297734068\|emb\|CBI15315.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356562630\|ref\|XP_003549572.1\| PREDICTED: putative G3BP-like protein-like [Glycine max]	Back alignment and taxonomy information

>gi\|359491760\|ref\|XP_003634318.1\| PREDICTED: LOW QUALITY PROTEIN: putative G3BP-like protein-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356511786\|ref\|XP_003524604.1\| PREDICTED: putative G3BP-like protein-like [Glycine max]	Back alignment and taxonomy information

>gi\|147854968\|emb\|CAN80261.1\| hypothetical protein VITISV_043950 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|30697452\|ref\|NP_851235.1\| nuclear transport factor 2 and RNA recognition motif domain-containing protein [Arabidopsis thaliana] gi\|332010023\|gb\|AED97406.1\| nuclear transport factor 2 and RNA recognition motif domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		402
TAIR\|locus:2173567		460	AT5G60980 [Arabidopsis thalian	0.855	0.747	0.578	8.7e-95
TAIR\|locus:2152566		458	AT5G48650 [Arabidopsis thalian	0.813	0.713	0.352	1.3e-36
TAIR\|locus:2023854		428	AT1G13730 [Arabidopsis thalian	0.716	0.672	0.335	6.7e-33
TAIR\|locus:2172472		450	AT5G43960 [Arabidopsis thalian	0.689	0.615	0.324	1.7e-27
TAIR\|locus:2026423		427	AT1G69250 [Arabidopsis thalian	0.634	0.597	0.303	3.5e-27
TAIR\|locus:2098555		1294	AT3G07250 [Arabidopsis thalian	0.283	0.088	0.398	3.8e-23
ZFIN\|ZDB-GENE-030131-7452		477	g3bp1 "GTPase activating prote	0.305	0.257	0.382	8.2e-21
UNIPROTKB\|E1C769		482	G3BP2 "Uncharacterized protein	0.694	0.578	0.255	2.5e-20
UNIPROTKB\|E2QYY6		449	G3BP2 "Uncharacterized protein	0.815	0.730	0.282	1.5e-19
POMBASE\|SPBP8B7.11		434	nxt3 "ubiquitin protease cofac	0.786	0.728	0.262	3.3e-19

TAIR\|locus:2173567 AT5G60980 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 943 (337.0 bits), Expect = 8.7e-95, P = 8.7e-95
 Identities = 209/361 (57%), Positives = 247/361 (68%)

Query:     1 MAVQEGSPAPSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMK 60
             MA QE SP+P A+VVG AFVEQYYHILHQSPGLVHRFYQDSS L+RPD  G++TTVTTM+
Sbjct:     1 MAQQEASPSPGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSFLTRPDVTGAVTTVTTMQ 60

Query:    61 AINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDK 120
             AIND+ILSL YEDYTAEI+TADAQ+S+E+GVIVLVTG LTG DNV+KKF+Q+FFLAPQDK
Sbjct:    61 AINDKILSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQSFFLAPQDK 120

Query:   121 GGYFVLNDVFRFXXXXXXXXXXXXXXXXXTAPTANVTEAPEP---AHDQDHIPADRAIVI 177
             G YFVLNDVFRF                 T         PE    +H+ +  P   A  I
Sbjct:   121 G-YFVLNDVFRFLEEKEVTAQARSVPINGTTRDVQAPIEPERVVVSHEPEVEPEPVAS-I 178

Query:   178 EGEDLDNGPEVCDPSDKEEGSVVEDEIVEPPSNSVQNEVHASVDSAPVAQGDAPEKKSYA 237
             E EDLDN  EV DPSDK+EG VV+ E +EPP+    NE+ +      V QGDAP K SYA
Sbjct:   179 EEEDLDNVAEVYDPSDKDEGVVVDVEPIEPPTQISHNEILS------VPQGDAP-KHSYA 231

Query:   238 SIVKVMKGYNISSAAYVPARKARPTPPNADQQSPAMAKPAPVPEASALSSDGAPENSNVN 297
             SI+K MK  + +   +V   K RP P N    +P  A+PA  PEASA   +  P +S+V+
Sbjct:   232 SILKQMKS-SPAPTTHVARNKPRPAPVNQKLTAPP-AEPAARPEASA--HENVPNSSHVD 287

Query:   298 EEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNKQ-GYCFGFVAFETPGSV 356
              E +G SIYVRNL F +T T+LEE FK FG IK  G+QVRSNKQ G+CFGFV FET    
Sbjct:   288 VEDDGHSIYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNKQQGFCFGFVEFETSSGK 347

Query:   357 Q 357
             Q
Sbjct:   348 Q 348

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0003723 "RNA binding" evidence=ISS

GO:0005622 "intracellular" evidence=IEA

GO:0006810 "transport" evidence=IEA

GO:0006913 "nucleocytoplasmic transport" evidence=ISS

GO:0009737 "response to abscisic acid stimulus" evidence=IDA

TAIR\|locus:2152566 AT5G48650 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2023854 AT1G13730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2172472 AT5G43960 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2026423 AT1G69250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2098555 AT3G07250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-7452 g3bp1 "GTPase activating protein (SH3 domain) binding protein 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C769 G3BP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QYY6 G3BP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

POMBASE\|SPBP8B7.11 nxt3 "ubiquitin protease cofactor Glp1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	5.3.3.1	LOW CONFIDENCE prediction!
3rd Layer	5.3.3	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		402
cd00780		119	cd00780, NTF2, Nuclear transport factor 2 (NTF2) d	9e-45
pfam02136		116	pfam02136, NTF2, Nuclear transport factor 2 (NTF2)	1e-30
cd00531		124	cd00531, NTF2_like, Nuclear transport factor 2 (NT	2e-15
smart00360		73	smart00360, RRM, RNA recognition motif	2e-10
cd00590		72	cd00590, RRM_SF, RNA recognition motif (RRM) super	2e-09
pfam00076		70	pfam00076, RRM_1, RNA recognition motif	2e-09
pfam14259		69	pfam14259, RRM_6, RNA recognition motif (a	2e-09
cd12318		82	cd12318, RRM5_RBM19_like, RNA recognition motif 5	5e-09
cd12298		78	cd12298, RRM3_Prp24, RNA recognition motif 3 in fu	8e-09
cd12413		79	cd12413, RRM1_RBM28_like, RNA recognition motif 1	9e-09
COG0724		306	COG0724, COG0724, RNA-binding proteins (RRM domain	1e-07
cd12639		79	cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2	2e-07
cd12316		74	cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot	2e-07
cd12674		79	cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye	1e-06
cd12382		80	cd12382, RRM_RBMX_like, RNA recognition motif in h	3e-06
cd12320		76	cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot	4e-06
cd12240		78	cd12240, RRM_NCBP2, RNA recognition motif found in	4e-06
cd12380		80	cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou	5e-06
TIGR01628		562	TIGR01628, PABP-1234, polyadenylate binding protei	5e-06
cd12571		79	cd12571, RRM6_RBM19, RNA recognition motif 6 in RN	6e-06
cd12306		73	cd12306, RRM_II_PABPs, RNA recognition motif in ty	7e-06
cd12450		77	cd12450, RRM1_NUCLs, RNA recognition motif 1 found	1e-05
cd12370		76	cd12370, RRM1_PUF60, RNA recognition motif 1 in (U	1e-05
cd12254		73	cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit	2e-05
cd12326		79	cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou	2e-05
cd12242		73	cd12242, RRM_SLIRP, RNA recognition motif found in	2e-05
cd12319		84	cd12319, RRM4_MRD1, RNA recognition motif 4 in yea	2e-05
cd12395		73	cd12395, RRM2_RBM34, RNA recognition motif 2 in RN	2e-05
cd12381		79	cd12381, RRM4_I_PABPs, RNA recognition motif 4 in	2e-05
cd12449		80	cd12449, RRM_CIRBP_RBM3, RNA recognition motif in	3e-05
cd12399		78	cd12399, RRM_HP0827_like, RNA recognition motif in	4e-05
cd12373		73	cd12373, RRM_SRSF3_like, RNA recognition motif in	5e-05
cd12614		74	cd12614, RRM1_PUB1, RNA recognition motif 1 in yea	5e-05
cd12640		79	cd12640, RRM3_Bruno_like, RNA recognition motif 3	5e-05
cd12229		81	cd12229, RRM_G3BP, RNA recognition motif (RRM) in	7e-05
cd12379		77	cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou	8e-05
TIGR01628		562	TIGR01628, PABP-1234, polyadenylate binding protei	9e-05
cd12623		91	cd12623, RRM_PPARGC1A, RNA recognition motif in pe	9e-05
cd12551		77	cd12551, RRM_II_PABPN1L, RNA recognition motif in	1e-04
cd12237		93	cd12237, RRM_snRNP35, RNA recognition motif found	1e-04
cd12384		76	cd12384, RRM_RBM24_RBM38_like, RNA recognition mot	2e-04
cd12415		82	cd12415, RRM3_RBM28_like, RNA recognition motif 3	2e-04
cd12387		72	cd12387, RRM3_hnRNPM_like, RNA recognition motif 3	2e-04
cd12645		81	cd12645, RRM_SRSF3, RNA recognition motif in verte	3e-04
cd12570		76	cd12570, RRM5_MRD1, RNA recognition motif 5 in yea	3e-04
cd12357		89	cd12357, RRM_PPARGC1A_like, RNA recognition motif	3e-04
cd12336		75	cd12336, RRM_RBM7_like, RNA recognition motif in R	4e-04
cd12251		72	cd12251, RRM3_hnRNPR_like, RNA recognition motif 3	5e-04
cd12392		81	cd12392, RRM2_SART3, RNA recognition motif 2 in sq	5e-04
cd12312		84	cd12312, RRM_SRSF10_SRSF12, RNA recognition motif	6e-04
cd12284		73	cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2	8e-04
cd12356		79	cd12356, RRM_PPARGC1B, RNA recognition motif in pe	8e-04
cd12391		72	cd12391, RRM1_SART3, RNA recognition motif 1 in sq	0.001
cd12567		79	cd12567, RRM3_RBM19, RNA recognition motif 3 in RN	0.001
cd12354		73	cd12354, RRM3_TIA1_like, RNA recognition motif 2 i	0.001
cd12313		84	cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti	0.002
cd12333		80	cd12333, RRM2_p54nrb_like, RNA recognition motif 2	0.002
cd12338		72	cd12338, RRM1_SRSF1_like, RNA recognition motif 1	0.002
cd12362		73	cd12362, RRM3_CELF1-6, RNA recognition motif 3 in	0.002
cd12325		72	cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition	0.002
cd12646		77	cd12646, RRM_SRSF7, RNA recognition motif in verte	0.003
cd12590		80	cd12590, RRM2_PSF, RNA recognition motif 2 in vert	0.004
cd12375		77	cd12375, RRM1_Hu_like, RNA recognition motif 1 in	0.004

>gnl\|CDD\|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus	Back alignment and domain information

 Score =  150 bits (381), Expect = 9e-45
 Identities = 58/124 (46%), Positives = 79/124 (63%), Gaps = 5/124 (4%)

Query: 11  SAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLN 70
           SA+ V  AFV+QYY I   +   +HR Y D+S+LSR      M  VT   AI +++ SL 
Sbjct: 1   SAEDVAKAFVQQYYSIFDNNREGLHRLYGDTSMLSREG----MKQVTGRDAIVEKLSSLP 56

Query: 71  YEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVF 130
           ++    +I T D+Q +   GVIV+VTG L   +   +KF+QTF LAPQ+ GGYFVLND+F
Sbjct: 57  FQKTKHKITTVDSQPTPSGGVIVMVTGSLKLDEQPPRKFSQTFVLAPQN-GGYFVLNDIF 115

Query: 131 RFVE 134
           RFV+
Sbjct: 116 RFVD 119

This bi-directional transport of macromolecules across the nuclear envelope requires many soluble factors that includes GDP-binding protein Ran (RanGDP). RanGDP is required for both import and export of proteins and poly(A) RNA. RanGDP also has been implicated in cell cycle control, specifically in mitotic spindle assembly. In interphase cells, RanGDP is predominately nuclear and thought to be GTP bound, but it is also present in the cytoplasm, probably in the GDP-bound state. NTF2 mediates the nuclear import of RanGDP. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. Length = 119

>gnl\|CDD\|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain	Back alignment and domain information

>gnl\|CDD\|238296 cd00531, NTF2_like, Nuclear transport factor 2 (NTF2-like) superfamily	Back alignment and domain information

>gnl\|CDD\|214636 smart00360, RRM, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily	Back alignment and domain information

>gnl\|CDD\|215696 pfam00076, RRM_1, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|222631 pfam14259, RRM_6, RNA recognition motif (a	Back alignment and domain information

>gnl\|CDD\|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins	Back alignment and domain information

>gnl\|CDD\|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1)	Back alignment and domain information

>gnl\|CDD\|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1)	Back alignment and domain information

>gnl\|CDD\|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>gnl\|CDD\|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants	Back alignment and domain information

>gnl\|CDD\|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins	Back alignment and domain information

>gnl\|CDD\|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins	Back alignment and domain information

>gnl\|CDD\|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>gnl\|CDD\|241067 cd12623, RRM_PPARGC1A, RNA recognition motif in peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1alpha, or PPARGC-1-alpha) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2)	Back alignment and domain information

>gnl\|CDD\|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3)	Back alignment and domain information

>gnl\|CDD\|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators	Back alignment and domain information

>gnl\|CDD\|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240802 cd12356, RRM_PPARGC1B, RNA recognition motif in peroxisome proliferator-activated receptor gamma coactivator 1-beta (PGC-1-beta) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1	Back alignment and domain information

>gnl\|CDD\|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family	Back alignment and domain information

>gnl\|CDD\|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins	Back alignment and domain information

>gnl\|CDD\|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7)	Back alignment and domain information

>gnl\|CDD\|241034 cd12590, RRM2_PSF, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF)	Back alignment and domain information

>gnl\|CDD\|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		402
KOG0116		419	consensus RasGAP SH3 binding protein rasputin, con	100.0
KOG2104		126	consensus Nuclear transport factor 2 [Intracellula	100.0
cd00780		119	NTF2 Nuclear transport factor 2 (NTF2) domain play	99.98
PF02136		118	NTF2: Nuclear transport factor 2 (NTF2) domain; In	99.93
KOG4353		139	consensus RNA export factor NXT1 [RNA processing a	99.89
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	99.6
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.52
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	99.49
KOG0149		247	consensus Predicted RNA-binding protein SEB4 (RRM	99.48
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.44
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.43
KOG0125		376	consensus Ataxin 2-binding protein (RRM superfamil	99.41
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	99.38
PLN03120		260	nucleic acid binding protein; Provisional	99.37
KOG0121		153	consensus Nuclear cap-binding protein complex, sub	99.36
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	99.33
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.32
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.31
KOG0122		270	consensus Translation initiation factor 3, subunit	99.31
KOG0113		335	consensus U1 small nuclear ribonucleoprotein (RRM	99.29
PLN03121		243	nucleic acid binding protein; Provisional	99.27
smart00362		72	RRM_2 RNA recognition motif.	99.25
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	99.25
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.24
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.24
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.22
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	99.22
PLN03213		759	repressor of silencing 3; Provisional	99.22
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.2
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	99.2
KOG0126		219	consensus Predicted RNA-binding protein (RRM super	99.2
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	99.19
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	99.19
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	99.19
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.17
KOG4207		256	consensus Predicted splicing factor, SR protein su	99.17
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	99.17
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	99.16
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.16
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	99.15
smart00360		71	RRM RNA recognition motif.	99.15
COG0724		306	RNA-binding proteins (RRM domain) [General functio	99.15
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	99.13
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	99.13
KOG0111		298	consensus Cyclophilin-type peptidyl-prolyl cis-tra	99.07
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.07
KOG0130		170	consensus RNA-binding protein RBM8/Tsunagi (RRM su	99.06
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.05
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	99.05
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	99.04
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.04
KOG0108		435	consensus mRNA cleavage and polyadenylation factor	99.03
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	98.95
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	98.92
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	98.92
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	98.92
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	98.88
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	98.86
smart00361		70	RRM_1 RNA recognition motif.	98.86
KOG0415		479	consensus Predicted peptidyl prolyl cis-trans isom	98.85
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	98.78
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	98.78
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	98.76
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	98.7
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	98.67
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	98.66
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	98.65
KOG0132		894	consensus RNA polymerase II C-terminal domain-bind	98.65
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	98.65
KOG0153		377	consensus Predicted RNA-binding protein (RRM super	98.63
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	98.61
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	98.57
KOG4661		940	consensus Hsp27-ERE-TATA-binding protein/Scaffold	98.56
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	98.55
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	98.54
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	98.54
KOG4208		214	consensus Nucleolar RNA-binding protein NIFK [Gene	98.46
KOG0151		877	consensus Predicted splicing regulator, contains R	98.4
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	98.4
cd00531		124	NTF2_like Nuclear transport factor 2 (NTF2-like) s	98.38
KOG0533		243	consensus RRM motif-containing protein [RNA proces	98.37
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	98.3
PF10429		166	Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int	98.24
KOG1548		382	consensus Transcription elongation factor TAT-SF1	98.24
KOG4209		231	consensus Splicing factor RNPS1, SR protein superf	98.2
KOG0226		290	consensus RNA-binding proteins [General function p	98.18
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	98.12
KOG4660		549	consensus Protein Mei2, essential for commitment t	97.96
KOG4454		267	consensus RNA binding protein (RRM superfamily) [G	97.94
KOG1457		284	consensus RNA binding protein (contains RRM repeat	97.83
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	97.6
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	97.59
PF15008		262	DUF4518: Domain of unknown function (DUF4518)	97.56
COG5175		480	MOT2 Transcriptional repressor [Transcription]	97.56
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	97.52
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	97.52
PF08777		105	RRM_3: RNA binding motif; InterPro: IPR014886 This	97.46
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	97.43
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	97.24
KOG1457		284	consensus RNA binding protein (contains RRM repeat	97.19
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	97.03
KOG0129		520	consensus Predicted RNA-binding protein (RRM super	96.96
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	96.92
PF11608		90	Limkain-b1: Limkain b1; InterPro: IPR024582 This e	96.89
KOG1995		351	consensus Conserved Zn-finger protein [General fun	96.68
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	96.65
KOG0129		520	consensus Predicted RNA-binding protein (RRM super	96.61
KOG4210		285	consensus Nuclear localization sequence binding pr	96.6
PF13474		121	SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE	96.25
TIGR02246		128	conserved hypothetical protein. This family consis	96.24
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	96.09
KOG2193		584	consensus IGF-II mRNA-binding protein IMP, contain	96.01
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	95.99
KOG4307		944	consensus RNA binding protein RBM12/SWAN [General	95.94
PF08952		146	DUF1866: Domain of unknown function (DUF1866) ; In	95.83
PF14534		107	DUF4440: Domain of unknown function (DUF4440); PDB	95.67
KOG1855		484	consensus Predicted RNA-binding protein [General f	95.37
KOG3152		278	consensus TBP-binding protein, activator of basal	95.35
KOG2068		327	consensus MOT2 transcription factor [Transcription	95.3
KOG1548		382	consensus Transcription elongation factor TAT-SF1	95.27
KOG0115		275	consensus RNA-binding protein p54nrb (RRM superfam	95.23
PF05172		100	Nup35_RRM: Nup53/35/40-type RNA recognition motif;	95.11
PF14605		53	Nup35_RRM_2: Nup53/35/40-type RNA recognition moti	95.08
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	94.98
KOG2314		698	consensus Translation initiation factor 3, subunit	94.72
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	94.67
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	94.65
KOG4849		498	consensus mRNA cleavage factor I subunit/CPSF subu	94.63
KOG0128		881	consensus RNA-binding protein SART3 (RRM superfami	94.39
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	94.37
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	94.34
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	94.29
KOG0128		881	consensus RNA-binding protein SART3 (RRM superfami	93.74
KOG1996		378	consensus mRNA splicing factor [RNA processing and	93.7
KOG4307		944	consensus RNA binding protein RBM12/SWAN [General	93.62
PF12680		102	SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8	93.23
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	93.17
PF12893		116	Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL	93.16
PF10309		62	DUF2414: Protein of unknown function (DUF2414); In	92.55
KOG2416		718	consensus Acinus (induces apoptotic chromatin cond	91.64
KOG4676		479	consensus Splicing factor, arginine/serine-rich [R	91.12
KOG2202		260	consensus U2 snRNP splicing factor, small subunit,	90.37
PF15023		166	DUF4523: Protein of unknown function (DUF4523)	90.19
cd00781		122	ketosteroid_isomerase ketosteroid isomerase: Many	89.59
KOG2253		668	consensus U1 snRNP complex, subunit SNU71 and rela	88.13
PF03467		176	Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120	87.39
KOG4285		350	consensus Mitotic phosphoprotein [Cell cycle contr	85.73
KOG2591		684	consensus c-Mpl binding protein, contains La domai	84.54
PF08675		87	RNA_bind: RNA binding domain; InterPro: IPR014789	83.18
PF08332		128	CaMKII_AD: Calcium/calmodulin dependent protein ki	82.7
KOG4210		285	consensus Nuclear localization sequence binding pr	82.47
KOG2135		526	consensus Proteins containing the RNA recognition	81.83
PF11767		66	SET_assoc: Histone lysine methyltransferase SET as	80.78

>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=4.2e-57  Score=449.86  Aligned_cols=357  Identities=39%  Similarity=0.606  Sum_probs=233.4

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHccCcccccccccCCCeeeccCCCCccceeccHHHHHHHHhcCCCCcceEEEee
Q 015694            1 MAVQEGSPAPSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLNYEDYTAEIKT   80 (402)
Q Consensus         1 ma~~~~~~~~~~~~vg~~FV~~YY~~l~~~p~~L~~fY~~~S~l~~~~~~~~~~~~~g~~~I~~~i~sl~~~~~~~~I~~   80 (402)
                      |+++..++.++++.||++||+|||++|++.|+.||+||.++|.|+|.|.||+|..++|.++|+++||+|+|..|+++|.+
T Consensus         2 ~~~~~~~~~~~~~~vg~~Fv~qYY~~L~~~P~~lhrfY~~~S~ltr~~~dg~m~s~t~~~~I~~~i~sld~~~~s~eI~t   81 (419)
T KOG0116|consen    2 DAQAMLSPVPTPQLVGNEFVRQYYNVLQNSPSKLHRFYMDDSVLTRPGLDGKMVSVTGLEAIHEKIMSLDYEVCSVEIST   81 (419)
T ss_pred             CccccccCCCCHHHHHHHHHHHHHHHHhhChHHHHHHhhccceeeccCCCCceEEEecHHHhhhheeecCCCceeEEEEE
Confidence            44455556899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEeeeeCCCcEEEEEEEEEEeCCCcccceeEEEEeeEcCCCcEEEEeceEEeecccccccCCCCCCCCCCCCCCCCCCCC
Q 015694           81 ADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFRFVEENESLENNSDSVVNETAPTANVTEAP  160 (402)
Q Consensus        81 ~d~q~s~~~~vlv~V~G~l~~~~~~~r~F~qtF~L~~~~~~~y~V~nDifr~~~~~~~~~~~~~~~~~~~~~~~~~~~ep  160 (402)
                      +|+|.|+++||+|+|+|.|++++.++|+|+|||||+||++ +|||+||||||+|+.+..+.+...   +.        ++
T Consensus        82 vdsQ~S~~~GvvI~VtG~lt~~~~~rRkF~QtFfLapq~~-~yfVlNDiFRfvde~~~~e~~~~~---vp--------~~  149 (419)
T KOG0116|consen   82 VDSQASLEKGVVIMVTGYLTNKDGPRRKFSQTFFLAPQEK-GYFVLNDIFRFVDEEFEPEANTDE---VP--------EA  149 (419)
T ss_pred             EehhhhccCCeEEEEEEEEEeCCCcceEEEEEEEEeecCC-ceEEEechhhhccccccccccccc---CC--------CC
Confidence            9999999999999999999999999999999999999999 999999999999988611111000   00        00


Q ss_pred             CCCCCCCCCCcCcccccccCCCCCCCCcCCCCCCCCCCcccc--CCCCC-CCCCCCCCC---CCCCCCCCCCCCCCCCcc
Q 015694          161 EPAHDQDHIPADRAIVIEGEDLDNGPEVCDPSDKEEGSVVED--EIVEP-PSNSVQNEV---HASVDSAPVAQGDAPEKK  234 (402)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~e--~~~e~-~~~~~~~~~---~~~~~~~~~~~~~~p~k~  234 (402)
                      .+.......    .++...+.+...+...++....+..|..+  ...+. ...+.+.+.   ......+..++.+.+ ++
T Consensus       150 ~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~V~~~~~~~~~~~~~~~~~ee~v~~~~~~~~p~~~~~~~~-~~  224 (419)
T KOG0116|consen  150 NPAVVVSVE----KASQLVEAVVESEPEPEPEPKAEDEVEVPEEATVEDEAKEKTKEELVIQQTVSEAPAAPQGDAP-KK  224 (419)
T ss_pred             Ccceeeccc----ccccccccccccCCCCcccccccCceeccccccccccccccCchhhcccccccCCCcccccccc-ch
Confidence            000000000    00000000000000000000000000000  00000 011100000   001111222267888 99


Q ss_pred             chhhhhhhcccCCCCCcccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCcEEEEccCCCC
Q 015694          235 SYASIVKVMKGYNISSAAYVPARKARPTPPNADQQSPAMAKPAPVPEASALSSDG-APENSNVNEEAEGCSIYVRNLAFT  313 (402)
Q Consensus       235 S~Asi~~~~~~~~~p~~~~~p~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~lfVgnLp~~  313 (402)
                      |||+++.+++....+......+...  .+..+....+.   +.....+..+-+.. ..+.++.....++..|||+|||++
T Consensus       225 s~asv~~~~~~~~~~~~~~~~p~~~--~~~~~p~~~~~---~~~~s~~~~p~~~~~~~n~~~~~~~~~~~~i~V~nlP~d  299 (419)
T KOG0116|consen  225 SFASVVKVLKKSAAVQQSKGSPPQI--QPQQQPSTKPQ---AERQSKPPSPVRESKSGNSNNQEPRADGLGIFVKNLPPD  299 (419)
T ss_pred             hhhhhhhhcccccccceeccCCCcc--ccccCCccCcc---hhhccCCCCccccccccccCCcceeecccceEeecCCCC
Confidence            9999999877655542222211111  01000000010   00000001110111 112344444556677999999999


Q ss_pred             CCHHHHHHHhhcCCCeeEEEEEEcCCC-CcccEEEEEeCCHHHHHHHHHhCCCccCCEEEEEEEeee
Q 015694          314 TTSTELEEAFKIFGPIKKNGVQVRSNK-QGYCFGFVAFETPGSVQSALEVLSLISLSLIIKIVLGVY  379 (402)
Q Consensus       314 vte~~L~~~F~~fG~I~~~~v~~~~~~-~~~gfgFVeF~~~~~a~~Al~~~~~~i~Gr~i~V~~~~~  379 (402)
                      ++..+|+++|++||.|+..+|..+..+ +..|||||+|.+.++++.||++.++.|++|++.|..-..
T Consensus       300 a~~~~l~~~Fk~FG~Ik~~~I~vr~~~~~~~~fgFV~f~~~~~~~~~i~Asp~~ig~~kl~Veek~~  366 (419)
T KOG0116|consen  300 ATPAELEEVFKQFGPIKEGGIQVRSPGGKNPCFGFVEFENAAAVQNAIEASPLEIGGRKLNVEEKRP  366 (419)
T ss_pred             CCHHHHHHHHhhcccccccceEEeccCCCcCceEEEEEeecchhhhhhhcCccccCCeeEEEEeccc
Confidence            999999999999999999999887733 455999999999999999999999999999999876433

>KOG2104 consensus Nuclear transport factor 2 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus	Back alignment and domain information

>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein	Back alignment and domain information

>KOG4353 consensus RNA export factor NXT1 [RNA processing and modification]	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only]	Back alignment and domain information

>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily	Back alignment and domain information

>KOG0533 consensus RRM motif-containing protein [RNA processing and modification]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0226 consensus RNA-binding proteins [General function prediction only]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>PF15008 DUF4518: Domain of unknown function (DUF4518)	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes	Back alignment and domain information

>KOG1995 consensus Conserved Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B	Back alignment and domain information

>TIGR02246 conserved hypothetical protein	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]	Back alignment and domain information

>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function	Back alignment and domain information

>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A	Back alignment and domain information

>KOG1855 consensus Predicted RNA-binding protein [General function prediction only]	Back alignment and domain information

>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription]	Back alignment and domain information

>KOG2068 consensus MOT2 transcription factor [Transcription]	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT []	Back alignment and domain information

>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification]	Back alignment and domain information

>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1996 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]	Back alignment and domain information

>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C	Back alignment and domain information

>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function	Back alignment and domain information

>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification]	Back alignment and domain information

>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification]	Back alignment and domain information

>PF15023 DUF4523: Protein of unknown function (DUF4523)	Back alignment and domain information

>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon	Back alignment and domain information

>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification]	Back alignment and domain information

>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons	Back alignment and domain information

>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms]	Back alignment and domain information

>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN)	Back alignment and domain information

>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only]	Back alignment and domain information

>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		402
3ujm_A		120	Crystal Structure Of The Ntf2-Like Domain Of The Dr		1e-18
3q90_A		140	Crystal Structure Of The Ntf2 Domain Of Ras Gtpase-		3e-17
1zo2_A		129	Structure Of Nuclear Transport Factor 2 (Ntf2) From		3e-10
1gy7_A		125	N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125		5e-06

>pdb|3UJM|A Chain A, Crystal Structure Of The Ntf2-Like Domain Of The Drosophila Melanogaster Rasputin Protein Length = 120

Back alignment and structure

Iteration: 1

Score = 90.5 bits (223), Expect = 1e-18, Method: Composition-based stats. Identities = 50/123 (40%), Positives = 71/123 (57%), Gaps = 6/123 (4%) Query: 11 SAQVVGNAFVEQYYHILHQSPGLVHRFY-QDSSLLSRPDSNGSMTTVTTMKAINDRILSL 69 S VG FV QYY +L+++P +HRFY +SS + +G V + I++RI L Sbjct: 2 SHMSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYI-----HGESKLVVGQREIHNRIQQL 56 Query: 70 NYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDV 129 N+ D A+I DAQ + GV+V VTG L+ ++FTQTF LA Q Y+V ND+ Sbjct: 57 NFNDCHAKISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHNDI 116 Query: 130 FRF 132 FR+ Sbjct: 117 FRY 119

PyMOL of 3ujm

>pdb|3Q90|A Chain A, Crystal Structure Of The Ntf2 Domain Of Ras Gtpase-Activating Protein- Binding Protein 1 Length = 140

Back alignment and structure

>pdb|1ZO2|A Chain A, Structure Of Nuclear Transport Factor 2 (Ntf2) From Cryptosporidium Parvum Length = 129

Back alignment and structure

>pdb|1GY7|A Chain A, N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		402
3q90_A		140	RAS GTPase-activating protein-binding protein 1; s	1e-51
3ujm_A		120	Rasputin; NTF2-like fold, RAS signaling, signaling	2e-48
1gy6_A		127	Nuclear transport factor 2; 1.6A {Rattus norvegicu	2e-45
1zo2_A		129	NTF2, nuclear transport factor 2; structural genom	5e-45
1gy7_A		125	Nuclear transport factor 2; protein transport; 1.6	1e-42
2qiy_A		154	UBP3-associated protein BRE5; deubiquitylation, ub	3e-41
1jkg_A		140	P15; NTF2-like domain, transport protein; 1.90A {H	1e-36
3nv0_B		154	NTF2-related export protein; NTF2-like domain, bet	8e-35
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	2e-12
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	3e-12
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	3e-12
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	1e-11
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	3e-11
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	4e-11
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	4e-11
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	5e-11
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	5e-08
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	1e-10
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	2e-10
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	2e-10
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	2e-10
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	3e-10
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	3e-10
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	3e-10
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	3e-10
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	3e-10
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	3e-10
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	4e-10
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	4e-10
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	4e-10
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	4e-10
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	7e-10
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	7e-10
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	7e-10
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	8e-10
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	1e-09
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	1e-09
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	1e-09
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	1e-09
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	1e-09
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens} Len	1e-09
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	1e-09
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	2e-09
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	2e-09
1x4e_A		85	RNA binding motif, single-stranded interacting pro	2e-09
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	2e-09
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	2e-07
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	2e-06
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	3e-09
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	3e-09
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	3e-09
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	4e-09
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	4e-09
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	4e-09
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	4e-09
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	4e-09
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	4e-09
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	6e-09
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	6e-09
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	6e-09
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	7e-09
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	9e-08
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	1e-07
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	7e-09
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	7e-09
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	7e-09
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	1e-08
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	1e-08
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	1e-08
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	1e-08
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	2e-08
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	3e-07
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	2e-08
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	2e-08
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	2e-08
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	2e-08
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	2e-08
1x5o_A		114	RNA binding motif, single-stranded interacting pro	2e-08
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	3e-08
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	1e-07
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	3e-08
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	3e-08
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	3e-08
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	3e-08
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	3e-08
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	1e-06
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	3e-08
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	4e-08
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	4e-08
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	4e-08
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	4e-08
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	4e-08
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	5e-08
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	5e-08
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	6e-08
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	6e-08
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	7e-08
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	7e-08
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	8e-08
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	3e-05
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	1e-07
1x5p_A		97	Negative elongation factor E; structure genomics,	1e-07
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	1e-07
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	1e-07
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	1e-07
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	1e-06
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	1e-07
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	5e-07
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	1e-07
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	2e-07
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	2e-07
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	2e-07
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	2e-07
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	2e-07
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	2e-07
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	2e-07
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	2e-07
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	3e-07
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	1e-04
2dis_A		109	Unnamed protein product; structural genomics, RRM	4e-07
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	4e-07
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	4e-07
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	5e-07
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	5e-07
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	6e-07
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	6e-07
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	7e-07
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	7e-07
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	7e-07
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	1e-05
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	8e-07
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	1e-06
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	1e-06
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	1e-06
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	1e-06
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	1e-06
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	1e-06
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	1e-06
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	1e-06
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	1e-06
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	8e-05
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	1e-06
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	2e-06
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	2e-05
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	2e-06
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	2e-06
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	8e-05
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	2e-06
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	2e-06
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	2e-06
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	4e-05
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	2e-06
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	2e-06
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	2e-06
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	2e-06
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	3e-06
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	3e-06
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	3e-06
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	2e-05
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	4e-06
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	4e-06
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	4e-06
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	4e-06
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	5e-06
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	6e-06
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	2e-05
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	6e-06
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	7e-06
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	2e-05
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	8e-06
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	8e-06
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	1e-05
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	1e-05
2div_A		99	TRNA selenocysteine associated protein; structural	1e-05
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	1e-05
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	2e-05
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	2e-05
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	3e-05
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	3e-05
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	3e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-05
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	3e-05
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	4e-05
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	6e-05
1jkg_B		250	TAP; NTF2-like domain, transport protein; 1.90A {H	7e-05
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	8e-05
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	8e-05
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	1e-04
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	1e-04
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	2e-04
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	2e-04
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	7e-04
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	7e-04

>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140	Back alignment and structure

 Score =  168 bits (427), Expect = 1e-51
 Identities = 44/135 (32%), Positives = 73/135 (54%), Gaps = 5/135 (3%)

Query: 7   SPAPSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSM---TTVTTMKAIN 63
              PS  +VG  FV QYY +L+Q+P ++HRFY  +S       + +      V   K I+
Sbjct: 4   MEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIH 63

Query: 64  DRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDK--G 121
            +++S N+ +   +I+  DA  +   GV+V V G L+  +   ++F QTF LAP+     
Sbjct: 64  RKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVAN 123

Query: 122 GYFVLNDVFRFVEEN 136
            ++V ND+FR+ +E 
Sbjct: 124 KFYVHNDIFRYQDEV 138

PyMOL of 3q90

>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120	Back alignment and structure

>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127	Back alignment and structure

>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129	Back alignment and structure

>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125	Back alignment and structure

>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140	Back alignment and structure

>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87	Back alignment and structure

>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Length = 250	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		402
3q90_A		140	RAS GTPase-activating protein-binding protein 1; s	100.0
3ujm_A		120	Rasputin; NTF2-like fold, RAS signaling, signaling	100.0
1zo2_A		129	NTF2, nuclear transport factor 2; structural genom	100.0
1gy6_A		127	Nuclear transport factor 2; 1.6A {Rattus norvegicu	100.0
1gy7_A		125	Nuclear transport factor 2; protein transport; 1.6	100.0
2qiy_A		154	UBP3-associated protein BRE5; deubiquitylation, ub	100.0
3nv0_B		154	NTF2-related export protein; NTF2-like domain, bet	100.0
1jkg_A		140	P15; NTF2-like domain, transport protein; 1.90A {H	99.98
1jkg_B		250	TAP; NTF2-like domain, transport protein; 1.90A {H	99.87
1of5_A		221	MRNA export factor MEX67; nuclear protein, repeat,	99.84
1q40_B		219	MEX67, mRNA export factor MEX67; NTF2-fold, nuclea	99.83
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	99.75
3nv0_A		205	Nuclear RNA export factor 2; NTF2-like domain, bet	99.7
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	99.7
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	99.69
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	99.68
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	99.68
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	99.68
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	99.67
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	99.66
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	99.66
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	99.66
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	99.66
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.66
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	99.66
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	99.66
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	99.65
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	99.65
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	99.65
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	99.65
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	99.65
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	99.65
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	99.65
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	99.65
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	99.64
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	99.64
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	99.64
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	99.64
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	99.64
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	99.64
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	99.64
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	99.64
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.64
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	99.64
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	99.64
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	99.64
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	99.64
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	99.64
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	99.63
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	99.63
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	99.63
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	99.63
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	99.63
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	99.63
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	99.63
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	99.63
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	99.63
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	99.62
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	99.62
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	99.62
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	99.62
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	99.62
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	99.62
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	99.62
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	99.61
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	99.61
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	99.61
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	99.61
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	99.61
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	99.61
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	99.61
2div_A		99	TRNA selenocysteine associated protein; structural	99.61
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	99.61
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	99.61
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	99.61
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	99.61
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	99.61
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	99.61
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	99.61
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	99.61
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	99.6
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	99.6
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	99.6
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	99.6
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	99.6
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	99.6
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	99.6
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	99.6
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.6
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	99.59
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.59
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	99.59
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	99.59
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	99.59
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	99.58
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	99.58
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	99.58
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	99.58
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.58
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	99.58
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	99.58
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	99.57
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	99.57
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	99.57
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	99.56
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	99.56
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	99.56
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	99.56
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	99.56
1x4e_A		85	RNA binding motif, single-stranded interacting pro	99.56
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	99.56
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	99.56
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	99.56
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	99.56
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	99.56
1x5o_A		114	RNA binding motif, single-stranded interacting pro	99.56
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	99.55
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	99.55
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	99.55
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	99.55
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	99.55
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	99.55
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	99.55
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	99.55
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	99.55
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	99.55
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	99.55
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.55
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	99.54
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	99.54
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.54
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	99.54
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	99.54
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	99.54
2dis_A		109	Unnamed protein product; structural genomics, RRM	99.54
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	99.53
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	99.53
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	99.53
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	99.53
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	99.53
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	99.53
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	99.52
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	99.52
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	99.52
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	99.52
1q42_A		201	MTR2, mRNA transport regulator MTR2; NTF2-fold, nu	99.52
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	99.51
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	99.51
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	99.51
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	99.5
1x5p_A		97	Negative elongation factor E; structure genomics,	99.5
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	99.25
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	99.5
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	99.49
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	99.49
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	99.48
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	99.48
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	99.48
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	99.48
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	99.47
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.47
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	99.47
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	99.46
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	99.46
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	99.46
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	99.46
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	99.46
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	99.46
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	99.45
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.45
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	99.45
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	99.45
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	99.44
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	99.42
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	99.42
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	99.42
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	99.42
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	99.41
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	99.41
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	99.41
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	99.41
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	99.4
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	99.4
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	99.4
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	99.39
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	99.38
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	99.38
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	99.37
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	99.36
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	99.36
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	99.36
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	99.36
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	99.35
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	99.34
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	99.33
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	99.31
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	99.29
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	99.29
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	99.28
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	99.28
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.28
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	99.28
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	99.26
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	99.25
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.23
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	99.22
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.2
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	99.2
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	99.19
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	99.18
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	99.18
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.17
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	99.16
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	99.13
1of5_B		184	MTR2, YKL186C, mRNA transport regulator MTR2; nucl	99.11
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	99.1
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	98.98
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	98.89
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	98.87
2dnr_A		91	Synaptojanin-1; RRM domain, RBD, structural genomi	98.69
1ufw_A		95	Synaptojanin 2; RNP domain, structural genomics, r	98.45
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	98.43
2l9w_A		117	U4/U6 snRNA-associated-splicing factor PRP24; RRM,	97.7
2dhx_A		104	Poly (ADP-ribose) polymerase family, member 10 var	97.63
4i4k_A		143	Uncharacterized protein SGCJ; structural genomics,	97.08
3gzr_A		146	Uncharacterized protein with A NTF2-like fold; str	96.53
3cu3_A		172	Domain of unknown function with A cystatin-like F;	96.51
1wey_A		104	Calcipressin 1; structural genomics, RRM domain, r	96.43
3hx8_A		129	MLR2180 protein, putative ketosteroid isomerase; s	96.41
3d9r_A		135	Ketosteroid isomerase-like protein; YP_049581.1, s	96.11
2gxf_A		142	Hypothetical protein YYBH; alpha-beta protein., st	95.75
1whv_A		100	Poly(A)-specific ribonuclease; RNA recognition mot	95.58
1uw4_A		91	UPF3X; nonsense mediated mRNA decay protein, RNA-b	95.36
3rob_A		139	Uncharacterized conserved protein; structural geno	95.08
3h51_A		156	Putative calcium/calmodulin dependent protein KIN	95.02
3b7c_A		122	Uncharacterized protein; NTF-2 like protein, struc	94.98
1wwh_A		119	Nucleoporin 35, nucleoporin; structural genomics,	94.96
3ctr_A		101	Poly(A)-specific ribonuclease PARN; protein-RNA-co	94.63
3gwr_A		144	Putative calcium/calmodulin-dependent protein KIN	94.51
2ux0_A		143	Calcium-calmodulin dependent protein kinase (CAM I	93.79
3pq1_A		464	Poly(A) RNA polymerase; nucleotidyl transferase, R	93.71
3f7s_A		142	Uncharacterized NTF2-like protein; structural geno	93.24
1tp6_A		128	Hypothetical protein PA1314; structural genomics,	93.03
3soy_A		145	NTF2-like superfamily protein; structural genomics	92.78
2rcd_A		129	Uncharacterized protein; structural genomics, join	92.1
3jum_A		185	Phenazine biosynthesis protein A/B; chirality, dru	91.99
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	91.16
2owp_A		129	Hypothetical protein BXE_B1374; cystatin-like fold	91.09
3bb9_A		148	Putative orphan protein; structural genomics, join	90.88
3p3d_A		132	Nucleoporin 53; structural genomics, PSI-2, protei	90.81
3ff0_A		163	Phenazine biosynthesis protein PHZB 2; cystatin-li	90.8
3duk_A		125	NTF2-like protein of unknown function; structural	90.53
3dm8_A		143	Uncharacterized protein RPA4348; siras, putative i	90.32
2r4i_A		123	Uncharacterized protein; NTF2-like protein, struct	89.08
3f14_A		112	Uncharacterized NTF2-like protein; YP_680363.1, NT	88.3
2rfr_A		155	Uncharacterized protein; structural genomics, join	87.93
3mg1_A		323	OCP, orange carotenoid protein; carotenoid binding	87.15
3b8l_A		163	Uncharacterized protein; putative aromatic ring hy	87.04
3h3h_A		122	Uncharacterized snoal-like protein; structural gen	86.7
3er7_A		131	Uncharacterized NTF2-like protein; YP_001812677.1,	86.18
2l08_A		97	Regulator of nonsense transcripts 3A; NESG, nonsen	86.14
3gzb_A		154	Putative snoal-like polyketide cyclase; YP_0011826	85.26
3cnx_A		170	Uncharacterized protein; putative dehydratase, NTF	85.09
2chc_A		170	Protein RV3472; hypothetical protein; 1.69A {Mycob	84.67
1nww_A		149	Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R	84.39
3fsd_A		134	NTF2-like protein of unknown function in nutrient;	84.39
3blz_A		128	NTF2-like protein of unknown function; structural	84.32
3a76_A		176	Gamma-hexachlorocyclohexane dehydrochlorinase; bar	84.27
3fka_A		120	Uncharacterized NTF-2 like protein; structural gen	83.7
3dxo_A		121	Uncharacterized snoal-like protein; putative isome	83.06
4h3u_A		158	Hypothetical protein; structural genomics, PSI-bio	82.9
3en8_A		128	Uncharacterized NTF-2 like protein; YP_553245.1, N	82.24
3fh1_A		129	Uncharacterized NTF2-like protein; structural geno	81.57
1ohp_A		125	Steroid delta-isomerase; inhibitor; HET: ESR; 1.53	81.36
3ff2_A		117	Uncharacterized cystatin fold protein (YP_497570.	81.05
3hk4_A		136	MLR7391 protein; NTF2-like protein, structural gen	80.74
3k0z_A		159	Putative polyketide cyclase; structural genomics,	80.57
1s5a_A		150	Hypothetical protein YESE; structural genomics, PS	80.51

>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0	Back alignment and structure

Probab=100.00  E-value=9.9e-39  Score=276.48  Aligned_cols=129  Identities=36%  Similarity=0.668  Sum_probs=113.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHccCcccccccccCCCeeeccCC--CCccc-eeccHHHHHHHHhcCCCCcceEEEeeeEeee
Q 015694            9 APSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDS--NGSMT-TVTTMKAINDRILSLNYEDYTAEIKTADAQD   85 (402)
Q Consensus         9 ~~~~~~vg~~FV~~YY~~l~~~p~~L~~fY~~~S~l~~~~~--~~~~~-~~~g~~~I~~~i~sl~~~~~~~~I~~~d~q~   85 (402)
                      +|++++||++||+|||++|+++|+.||+||+++|+|+|.+.  +|++. .+.|+++|.++|++||+++|+++|.++|||+
T Consensus         6 ~p~~~~vg~~Fv~~YY~~ld~~r~~L~~~Y~~~S~l~~~~~~~ng~~~~~~~G~~~I~~~l~~Lp~~~~~~~I~tvD~Qp   85 (140)
T 3q90_A            6 KPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHA   85 (140)
T ss_dssp             --CHHHHHHHHHHHHHHHHHHCGGGGGGGEEEEEEEC----------CCCEEHHHHHHHHHHHTCCCSCEEEEEEEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHhcCHHHHHhhcccCceEEEEccCCCCceeecccCHHHHHHHHHhCCCccceEEEEeEEEEE
Confidence            58999999999999999999999999999999999999654  46554 6899999999999999999999999999999


Q ss_pred             eCCCcEEEEEEEEEEeCCCcccceeEEEEeeEcC--CCcEEEEeceEEeecccc
Q 015694           86 SYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQD--KGGYFVLNDVFRFVEENE  137 (402)
Q Consensus        86 s~~~~vlv~V~G~l~~~~~~~r~F~qtF~L~~~~--~~~y~V~nDifr~~~~~~  137 (402)
                      ++++||||+|+|.|+.++++.|+|+|+|+|+|++  +++|||+||||||+|+++
T Consensus        86 s~~~gilI~V~G~l~~~~~~~~~F~QtF~L~p~~~~~~~y~V~nDifR~~de~~  139 (140)
T 3q90_A           86 TLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVF  139 (140)
T ss_dssp             CGGGCEEEEEEEEEECTTCCCEEEEEEEEEEECSSSTTCEEEEEEEEEEGGGC-
T ss_pred             eCCCCEEEEEEEEEecCCCCccEEEEEEEEeecCCCCCCEEEEEEEeEeehhhc
Confidence            9999999999999999999999999999999997  359999999999999986

PyMOL of 3q90

>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster}	Back alignment and structure

>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2	Back alignment and structure

>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A	Back alignment and structure

>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A	Back alignment and structure

>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A	Back alignment and structure

>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans}	Back alignment and structure

>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A	Back alignment and structure

>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A	Back alignment and structure

>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2	Back alignment and structure

>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans}	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus}	Back alignment and structure

>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides}	Back alignment and structure

>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28	Back alignment and structure

>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti}	Back alignment and structure

>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27	Back alignment and structure

>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22	Back alignment and structure

>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A*	Back alignment and structure

>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4	Back alignment and structure

>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus}	Back alignment and structure

>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV}	Back alignment and structure

>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16	Back alignment and structure

>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens}	Back alignment and structure

>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259}	Back alignment and structure

>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A*	Back alignment and structure

>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens}	Back alignment and structure

>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440}	Back alignment and structure

>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12	Back alignment and structure

>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp}	Back alignment and structure

>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18	Back alignment and structure

>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A*	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18	Back alignment and structure

>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16	Back alignment and structure

>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii}	Back alignment and structure

>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0	Back alignment and structure

>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20	Back alignment and structure

>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15	Back alignment and structure

>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A*	Back alignment and structure

>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264}	Back alignment and structure

>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24	Back alignment and structure

>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens}	Back alignment and structure

>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A*	Back alignment and structure

>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17	Back alignment and structure

>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25	Back alignment and structure

>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A*	Back alignment and structure

>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0	Back alignment and structure

>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14	Back alignment and structure

>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis}	Back alignment and structure

>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19	Back alignment and structure

>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila}	Back alignment and structure

>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20	Back alignment and structure

>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A	Back alignment and structure

>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti}	Back alignment and structure

>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus}	Back alignment and structure

>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		402
d1zo2a1		117	d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT	8e-44
d1gy6a_		125	d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R	6e-42
d1gy7a_		121	d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B	2e-37
d2qiya1		139	d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B	5e-35
d1jkga_		139	d.17.4.2 (A:) NTF2-related export protein 1 (p15)	5e-33
d1b7fa2		85	d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil	6e-11
d1h2vz_		93	d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro	5e-10
d1uawa_		77	d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax	9e-10
d1no8a_		78	d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu	1e-09
d2cpha1		94	d.58.7.1 (A:454-547) Probable RNA-binding protein	2e-09
d1x0fa1		75	d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0	2e-09
d1x4ba1		103	d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle	6e-09
d1cvja1		80	d.58.7.1 (A:11-90) Poly(A)-binding protein {Human	8e-09
d1fxla2		85	d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho	1e-08
d2cpfa1		85	d.58.7.1 (A:362-446) Probable RNA-binding protein	3e-08
d1x5ua1		93	d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu	6e-08
d1hd0a_		75	d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot	7e-08
d2f9da1		114	d.58.7.1 (A:12-125) Pre-mRNA branch site protein p	9e-08
d2cqca1		83	d.58.7.1 (A:109-191) Arginine/serine-rich splicing	1e-07
d2cqga1		90	d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD	2e-07
d1x5ta1		83	d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu	2e-07
d1wf2a_		98	d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot	2e-07
d2disa1		96	d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {	4e-07
d1b7fa1		82	d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil	5e-07
d2cpza1		102	d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin	5e-07
d1rk8a_		88	d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr	7e-07
d1wf0a_		88	d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {	9e-07
d1l3ka1		84	d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN	9e-07
d2cq4a1		101	d.58.7.1 (A:132-232) RNA binding protein 23 {Human	2e-06
d2msta_		75	d.58.7.1 (A:) Neural RNA-binding protein Musashi-1	2e-06
d1zh5a2		85	d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo	2e-06
d1fxla1		82	d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom	3e-06
d2cpja1		86	d.58.7.1 (A:65-150) Non-POU domain-containing octa	5e-06
d2cq0a1		90	d.58.7.1 (A:231-320) Eukaryotic translation initia	5e-06
d1x4ga1		96	d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s	5e-06
d2cpea1		101	d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma	6e-06
d2cqia1		90	d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa	8e-06
d1cvja2		89	d.58.7.1 (A:91-179) Poly(A)-binding protein {Human	1e-05
d1x4aa1		95	d.58.7.1 (A:9-103) Splicing factor, arginine/serin	1e-05
d1whwa_		99	d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm	2e-05
d2cq3a1		93	d.58.7.1 (A:110-202) RNA-binding protein 9 {Human	2e-05
d2cqba1		89	d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer	2e-05
d1x4ha1		98	d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (	2e-05
d1u1qa_		183	d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1	2e-05
d1x5oa1		101	d.58.7.1 (A:8-108) RNA-binding motif, single-stran	3e-05
d2u2fa_		85	d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit	3e-05
d2ghpa1		81	d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici	6e-05
d1fjca_		96	d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice	6e-05
d2cqda1		103	d.58.7.1 (A:1-103) RNA-binding region containing p	7e-05
d1weza_		102	d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot	9e-05
d2adba1		108	d.58.7.1 (A:177-284) Polypyrimidine tract-binding	1e-04
d2cqha1		80	d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is	1e-04
d1l3ka2		79	d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1	1e-04
d1fjeb1		91	d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc	1e-04
d1x4ea1		72	d.58.7.1 (A:8-79) RNA-binding motif, single-strand	3e-04
d1u6fa1		139	d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa	3e-04
d1wela1		112	d.58.7.1 (A:412-523) RNA-binding protein 12 {Human	3e-04
d1nu4a_		91	d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo	4e-04
d2cqpa1		86	d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous	4e-04
d2ghpa2		75	d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin	4e-04
d2ghpa3		86	d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici	6e-04
d1wexa_		104	d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot	8e-04
d2cpxa1		102	d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41	0.001
d1u2fa_		90	d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit	0.002
d2cpda1		86	d.58.7.1 (A:223-308) APOBEC1 stimulating protein {	0.002
d1x5sa1		90	d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote	0.003
d2cpya1		103	d.58.7.1 (A:536-638) RNA-binding protein 12 {Human	0.004

>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Cryptosporidium parvum [TaxId: 5807]

 Score =  146 bits (370), Expect = 8e-44
 Identities = 37/119 (31%), Positives = 53/119 (44%), Gaps = 5/119 (4%)

Query: 13  QVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLNYE 72
             +G  FV+ YY     +   +   Y   S+L+  D+            I ++  SLN++
Sbjct: 2   DQIGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWEDT-----QFQGQANIVNKFNSLNFQ 56

Query: 73  DYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFR 131
               EI   D Q S   G IV VTG +   D    KF+Q F L P   GG+ + ND+FR
Sbjct: 57  RVQFEITRVDCQPSPNNGSIVFVTGDVRIDDGQPLKFSQVFNLMPSGNGGFMIFNDLFR 115

PyMOL of d1zo2a1

>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125	Back information, alignment and structure

>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121	Back information, alignment and structure

>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139	Back information, alignment and structure

>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		402
d1gy6a_		125	Nuclear transport factor-2 (NTF2) {Rat (Rattus nor	100.0
d1zo2a1		117	Nuclear transport factor-2 (NTF2) {Cryptosporidium	100.0
d1gy7a_		121	Nuclear transport factor-2 (NTF2) {Baker's yeast (	100.0
d1jkga_		139	NTF2-related export protein 1 (p15) {Human (Homo s	99.97
d2qiya1		139	UBP3-associated protein BRE5 {Baker's yeast (Sacch	99.97
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	99.74
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.74
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	99.73
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	99.72
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.72
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	99.72
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	99.72
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	99.72
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.72
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.71
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	99.71
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	99.71
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	99.71
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.71
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.71
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	99.71
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	99.71
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	99.71
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.7
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	99.7
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.7
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	99.7
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	99.7
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.7
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.69
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.69
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	99.68
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	99.68
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	99.68
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.68
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.67
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.66
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.66
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.66
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.66
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	99.65
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	99.65
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	99.65
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	99.65
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	99.64
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	99.64
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.64
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.63
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	99.63
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	99.62
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	99.62
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	99.62
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	99.61
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	99.61
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.61
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	99.6
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	99.6
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.59
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.59
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	99.59
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	99.59
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	99.59
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	99.59
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	99.57
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.57
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	99.57
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.56
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	99.54
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	99.54
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	99.54
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	99.53
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.52
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.51
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	99.51
d1q40b_		205	NTF2-like domain of mRNA export factor MEX67 {Yeas	99.51
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	99.51
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.5
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	99.5
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.49
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	99.49
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	99.48
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	99.46
d1jkgb_		186	NTF2-like domain of Tip associating protein, TAP {	99.46
d1of5a_		221	NTF2-like domain of mRNA export factor MEX67 {Bake	99.44
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.44
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.42
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	99.36
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.36
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.3
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	99.3
d1of5b_		165	mRNA transport regulator MTR2 {Baker's yeast (Sacc	99.3
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.25
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	99.19
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	99.09
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	99.05
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	98.97
d1q42a_		174	mRNA transport regulator MTR2 {Yeast (Candida albi	97.6
d1m98a2		142	Orange carotenoid protein, C-terminal domain {Cyan	96.5
d1ufwa_		95	Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]	96.24
d3d9ra1		132	Uncharacterized protein ECA1476 {Pectobacterium at	96.03
d2dgxa1		73	Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960	95.97
d3cu3a1		162	Uncharacterized protein NpunR1993 {Nostoc punctifo	95.91
d2gxfa1		128	Hypothetical protein YybH {Bacillus subtilis [TaxI	95.87
d2owpa1		128	Hypothetical protein BxeB1374 {Burkholderia xenovo	95.71
d3b7ca1		121	Uncharacterized protein SO0125 {Shewanella oneiden	95.61
d1uw4a_		91	RNA processing protein UPF3x, RRM domain {Human (H	95.58
d3en8a1		127	Uncharacterized protein BxeB2092 {Burkholderia xen	94.78
d2rcda1		127	Uncharacterized protein ECA3500 {Pectobacterium at	94.43
d3bb9a1		121	Uncharacterized protein Sfri1973 {Shewanella frigi	94.43
d2ux0a1		135	Association domain of calcium/calmodulin-dependent	93.26
d2f86b1		129	Association domain of calcium/calmodulin-dependent	92.87
d1z1sa1		129	Uncharacterized protein PA3332 {Pseudomonas aerugi	91.95
d3dm8a1		135	Uncharacterized protein Rpa4348 {Rhodopseudomonas	91.7
d2bnga1		132	Uncharacterized protein Mb2760 {Mycobacterium tube	90.2
d3dmca1		133	Uncharacterized protein Ava2261 {Anabaena variabil	89.99
d1oh0a_		125	Delta-5-3-ketosteroid isomerase, steroid delta-iso	89.29
d3cnxa1		153	Uncharacterized protein SAV4671 {Streptomyces aver	88.62
d1nwwa_		145	Limonene-1,2-epoxide hydrolase {Rhodococcus erythr	87.78
d2a15a1		132	Hypothetical protein Rv0760c {Mycobacterium tuberc	86.96
d2rgqa1		133	Uncharacterized protein NpunR3134 {Nostoc punctifo	86.89
d2r4ia1		122	Uncharacterized protein CHU142 {Cytophaga hutchins	86.79
d1whva_		100	Poly(A)-specific ribonuclease PARN {Mouse (Mus mus	86.57
d1s5aa_		139	Hypothetical protein YesE {Bacillus subtilis [TaxI	85.66
d3ebta1		131	Uncharacterized protein BPSS0132 {Burkholderia pse	84.5
d1tuha_		131	Hypothetical protein egc068 from a soil-derived mo	84.28
d3ec9a1		130	Uncharacterized protein BTHI0051 {Burkholderia tha	81.64
d3blza1		124	Uncharacterized protein Sbal0622 {Shewanella balti	81.57
d3dxoa1		117	Uncharacterized protein Atu0744 {Agrobacterium tum	81.36

>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=1.6e-36  Score=255.68  Aligned_cols=123  Identities=24%  Similarity=0.429  Sum_probs=118.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHccCcccccccccCCCeeeccCCCCccceeccHHHHHHHHhcCCCCcceEEEeeeEeeeeCC
Q 015694            9 APSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNGSMTTVTTMKAINDRILSLNYEDYTAEIKTADAQDSYE   88 (402)
Q Consensus         9 ~~~~~~vg~~FV~~YY~~l~~~p~~L~~fY~~~S~l~~~~~~~~~~~~~g~~~I~~~i~sl~~~~~~~~I~~~d~q~s~~   88 (402)
                      +|.+++||++||++||++|+++|+.|++||.++|+|+|+|.     .+.|.++|.++|++|++++|+++|.++|||++.+
T Consensus         2 ~p~~e~ig~~Fv~~YY~~l~~~r~~L~~~Y~~~S~l~~~g~-----~~~G~~~I~~~l~~lp~~~~~~~i~~~D~Q~~~~   76 (125)
T d1gy6a_           2 KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQ-----QFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPD   76 (125)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHGGGGGGGEEEEEEEEETTE-----EEESHHHHHHHHHHCSCSCEEEEEEEEEEEECTT
T ss_pred             CCCHHHHHHHHHHHHHHHHhCCHHHHHHHcCCCcEEEECCc-----cccCHHHHHHHHHcCCCcccEEEEeEEEEEEcCC
Confidence            68899999999999999999999999999999999999997     7999999999999999999999999999999999


Q ss_pred             CcEEEEEEEEEEeCCCcccceeEEEEeeEcCCCcEEEEeceEEeecccc
Q 015694           89 KGVIVLVTGCLTGKDNVKKKFTQTFFLAPQDKGGYFVLNDVFRFVEENE  137 (402)
Q Consensus        89 ~~vlv~V~G~l~~~~~~~r~F~qtF~L~~~~~~~y~V~nDifr~~~~~~  137 (402)
                      ++|||+|+|.|+.++++.|+|+|+|+|+++++ +|||+||||||+.+++
T Consensus        77 ~~ili~V~G~~~~~~~~~~~F~qtF~L~~~~~-~y~I~NDiFR~v~~~~  124 (125)
T d1gy6a_          77 SCIISMVVGQLKADEDPIMGFHQMFLLKNIND-AWVCTNDMFRLALHNF  124 (125)
T ss_dssp             SCEEEEEEEEEEETTSCCEEEEEEEEEEEETT-EEEEEEEEEEECCCCC
T ss_pred             CCEEEEEEEEEEECCCCCcceEEEEEEeccCC-EEEEEeeEEEEEeccC
Confidence            99999999999999999999999999999986 9999999999999876

PyMOL of d1gy6a_

>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]}	Back information, alignment and structure

>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q42a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]}	Back information, alignment and structure

>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]}	Back information, alignment and structure

>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]}	Back information, alignment and structure

>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]}	Back information, alignment and structure

>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}	Back information, alignment and structure

>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]}	Back information, alignment and structure

>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]}	Back information, alignment and structure

>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]}	Back information, alignment and structure

>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]}	Back information, alignment and structure

>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]}	Back information, alignment and structure

>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure