Citrus Sinensis ID: 015899

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MEGLVSPKTTPRILFPTLNRRPSKFSIVRSVPASAMDAHRRNGVGFTPIRAQKAETKDGSATISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQFRIQNEGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKDISV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHcccEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEEEcccccccccccccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHccccccEEEEccccccccEEcHHHHHHHHHcccccccccccEEEEEccccccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHcccccc
ccccEcccccccccccccccccccccEEccccccccccHccccccccccccccccccccEEEEEEcccccEEEEEEEEEEEccHHHHHHHHcccEEEEccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHccccccEEEEEEccEEcccEEccccccHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHccccEEEEEHHHccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHccccEEEEEcEccccccEccHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHccccEEEEEHHHHccccHHHHHHHHHcccccc
meglvspkttprilfptlnrrpskfsivrsvpasamdahrrngvgftpiraqkaetkdgsaTISSVMEDAETALKAKEWEVGMLINEVAAsqgikirrrpptgpplhyvgpfqfriqnegntprnILEEIVWHKdvevtqlkqrrplSMLKNaldnappaRDFIGALMAANQRTGLPALIAEVKkaspsrgilredfdpvEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAgvkcpllcKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDEREMDRVLGIEGIELiginnrnletfevdnsntkkllegergeiirqkniivvgesglftpddIAYVQEAGVKAVLVGEsivkqddpgkgitglfgkdisv
meglvspkttprilfptlnrrpskfsivrsvpasamdahrrngvgftpiraqkaetkdgsatisSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQFRIQNEGNTPRNILEEIVWHKDVEvtqlkqrrplSMLKNALDNAPPARDFIGALMAANQRTGLPALIAEvkkaspsrgilredfdPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDEREMDRVLGIEGIEliginnrnletfevdnsntkkllegergeiirqkniivVGESGLFTPDDIAYVQEAGVKAVLVgesivkqddpgkgitglfgkdisv
MEGLVSPKTTPRILFPTLNRRPSKFSIVRSVPASAMDAHRRNGVGFTPIRAQKAETKDGSATISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQFRIQNEGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDEREMDRVlgiegieliginnrnleTFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKDISV
*************************************************************************LKAKEWEVGMLINEVAASQGIKIRR****GPPLHYVGPFQFRIQNEGNTPRNILEEIVWHKDVEVTQLKQ****************ARDFIGALMAANQRTGLPALIAEVK******GILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPDDIAYVQEAGVKAVLVGESIVKQ******IT*********
**********************************************************************************************************HYVG**QFRI****NTPRNILEEIVWHKDVEVTQLKQRRPL*MLK***D*APPARDFIGALMAANQRTGLPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKD***
********TTPRILFPTLNRRPSKFSIVRSVPASAMDAHRRNGVGFTPIRAQK*********ISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQFRIQNEGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKDISV
*****S*KTTPRILFPTLNRRPSKFSIVRSVPASAMDAHRRNGVGFTPIRAQKAETKDGSATISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQFRIQNEGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGLVSPKTTPRILFPTLNRRPSKFSIVRSVPASAMDAHRRNGVGFTPIRAQKAETKDGSATISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQFRIQNEGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKDISV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query398 2.2.26 [Sep-21-2011]
P49572402 Indole-3-glycerol phospha no no 0.994 0.985 0.673 1e-152
B7K0H0293 Indole-3-glycerol phospha yes no 0.736 1.0 0.566 5e-91
Q55508295 Indole-3-glycerol phospha N/A no 0.738 0.996 0.561 1e-89
B0JTM2296 Indole-3-glycerol phospha yes no 0.733 0.986 0.591 1e-88
B1WQE4294 Indole-3-glycerol phospha yes no 0.736 0.996 0.54 3e-86
B8HP79302 Indole-3-glycerol phospha yes no 0.703 0.927 0.562 3e-82
Q10ZM7297 Indole-3-glycerol phospha yes no 0.746 1.0 0.509 6e-82
Q3AL94295 Indole-3-glycerol phospha yes no 0.733 0.989 0.508 5e-80
B0CEU2303 Indole-3-glycerol phospha yes no 0.706 0.927 0.531 2e-79
A5GRL0294 Indole-3-glycerol phospha yes no 0.736 0.996 0.506 4e-79
>sp|P49572|TRPC_ARATH Indole-3-glycerol phosphate synthase, chloroplastic OS=Arabidopsis thaliana GN=At2g04400 PE=2 SV=2 Back     alignment and function desciption
 Score =  538 bits (1387), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 270/401 (67%), Positives = 326/401 (81%), Gaps = 5/401 (1%)

Query: 1   MEGLVSPKTTP-RILFPTLNRRPSKFSIVRSVPASAMD--AHRRNGVGFTPIRAQKAETK 57
           MEGLV  +  P ++  P+L R  +  SI RS+   AMD   + R    F+ IRAQ+++ K
Sbjct: 1   MEGLVPVQRLPIKVASPSLYRCNNSVSIRRSISGFAMDRKINFRAPSQFS-IRAQQSDLK 59

Query: 58  DGSATISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQFRIQ 117
           +  A  SS +ED    L+ KEWEV M   E+A SQGI+IRR+PP+  PL Y GPF+ R+ 
Sbjct: 60  ESLAVSSSSVEDKGNVLRIKEWEVEMYQEELAISQGIRIRRKPPSKAPLGYSGPFELRLH 119

Query: 118 N-EGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGL 176
           N + ++PRNILEEI W+KDVEV+++K+  PL +LK A+++APP RDF+GAL  A++RTG 
Sbjct: 120 NNDADSPRNILEEITWYKDVEVSRMKELNPLDVLKKAVEDAPPTRDFVGALRMAHKRTGF 179

Query: 177 PALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSA 236
           P LIAEVKKASPSRGIL+E+FDPVEIA++YEKGGAACLS+LTD+KYF+G FENLEA+RSA
Sbjct: 180 PGLIAEVKKASPSRGILKENFDPVEIAQAYEKGGAACLSVLTDQKYFQGGFENLEAIRSA 239

Query: 237 GVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVH 296
           GVKCPLLCKEF+VD WQIYYARTKGADAVLLIAAVL DL+I ++ KICK L L ALVEVH
Sbjct: 240 GVKCPLLCKEFVVDPWQIYYARTKGADAVLLIAAVLADLEITFLLKICKKLSLAALVEVH 299

Query: 297 DEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLF 356
           DEREM RVLGIEGIEL+GINNR+LETFEVD SNTKKLLEGE G  IR++++IVVGESGLF
Sbjct: 300 DEREMGRVLGIEGIELVGINNRSLETFEVDISNTKKLLEGEHGRQIRERDMIVVGESGLF 359

Query: 357 TPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKDIS 397
           TPDDIAYVQ AGVKAVLVGESIVKQ+DP KGI GLFG++IS
Sbjct: 360 TPDDIAYVQAAGVKAVLVGESIVKQNDPEKGIAGLFGRNIS 400

Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 8
>sp|B7K0H0|TRPC_CYAP8 Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain PCC 8801) GN=trpC PE=3 SV=1 Back     alignment and function description
>sp|Q55508|TRPC_SYNY3 Indole-3-glycerol phosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpC PE=3 SV=1 Back     alignment and function description
>sp|B0JTM2|TRPC_MICAN Indole-3-glycerol phosphate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=trpC PE=3 SV=1 Back     alignment and function description
>sp|B1WQE4|TRPC_CYAA5 Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=trpC PE=3 SV=1 Back     alignment and function description
>sp|B8HP79|TRPC_CYAP4 Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=trpC PE=3 SV=1 Back     alignment and function description
>sp|Q10ZM7|TRPC_TRIEI Indole-3-glycerol phosphate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=trpC PE=3 SV=1 Back     alignment and function description
>sp|Q3AL94|TRPC_SYNSC Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9605) GN=trpC PE=3 SV=1 Back     alignment and function description
>sp|B0CEU2|TRPC_ACAM1 Indole-3-glycerol phosphate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=trpC PE=3 SV=1 Back     alignment and function description
>sp|A5GRL0|TRPC_SYNR3 Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain RCC307) GN=trpC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query398
225447502396 PREDICTED: indole-3-glycerol phosphate s 0.987 0.992 0.780 0.0
255582874389 tryptophan biosynthesis protein, trpc, p 0.974 0.997 0.768 1e-175
296085050363 unnamed protein product [Vitis vinifera] 0.912 1.0 0.815 1e-175
449453616411 PREDICTED: indole-3-glycerol phosphate s 1.0 0.968 0.739 1e-174
449511794411 PREDICTED: indole-3-glycerol phosphate s 1.0 0.968 0.737 1e-173
356554619392 PREDICTED: indole-3-glycerol phosphate s 0.982 0.997 0.768 1e-173
356501182393 PREDICTED: indole-3-glycerol phosphate s 0.984 0.997 0.758 1e-171
357492951391 Indole-3-glycerol phosphate synthase [Me 0.982 1.0 0.751 1e-171
388519367391 unknown [Medicago truncatula] 0.982 1.0 0.751 1e-171
297791991375 hypothetical protein ARALYDRAFT_494873 [ 0.914 0.970 0.720 1e-159
>gi|225447502|ref|XP_002265275.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/401 (78%), Positives = 350/401 (87%), Gaps = 8/401 (1%)

Query: 1   MEGLVSPKTTPRILFPTL---NRRPSKFSIVRSVPASAMDAHRRNGVGFTPIRAQKAETK 57
           MEGL S + TPR+L PT+   N +P KFSI      + M+  +   +    +RAQ++E+K
Sbjct: 1   MEGLFSLRATPRVLVPTVSAPNHKP-KFSI----SGTRMEVQKSKKLSVACVRAQQSESK 55

Query: 58  DGSATISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQFRIQ 117
           DGSAT+S + +  E ALK KEWEVG   +E+AA+QGI+IRRRPPTGPPLHYVGPF+FR+Q
Sbjct: 56  DGSATVSPLSDSQENALKIKEWEVGRFQDEIAATQGIRIRRRPPTGPPLHYVGPFEFRLQ 115

Query: 118 NEGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLP 177
           NEGNTPRNILEEIVW+KD EV+QLK+R+PL MLK AL+NAPP RDFI AL A+N RTG P
Sbjct: 116 NEGNTPRNILEEIVWNKDKEVSQLKERKPLGMLKKALENAPPNRDFIAALRASNLRTGFP 175

Query: 178 ALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAG 237
            LIAEVKKASPSRGILREDFDPVEIAR+YEKGGAACLS+LTDEKYFKGSFENLE +R+AG
Sbjct: 176 GLIAEVKKASPSRGILREDFDPVEIARAYEKGGAACLSVLTDEKYFKGSFENLELIRNAG 235

Query: 238 VKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHD 297
           VKCPLLCKEF+VDAWQIYYARTKGADA+LLIAAVLPDLDIRYMTKICK+LGL ALVEVHD
Sbjct: 236 VKCPLLCKEFVVDAWQIYYARTKGADAILLIAAVLPDLDIRYMTKICKMLGLAALVEVHD 295

Query: 298 EREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFT 357
           EREMDRVLGIEGIELIGINNRNL TFEVD SNTKKLLEGERGEIIRQK+IIVVGESGLFT
Sbjct: 296 EREMDRVLGIEGIELIGINNRNLATFEVDISNTKKLLEGERGEIIRQKDIIVVGESGLFT 355

Query: 358 PDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKDISV 398
           P D+AYVQEAGVKA+LVGESIVKQ DP  GITGLFGKDISV
Sbjct: 356 PADVAYVQEAGVKAILVGESIVKQKDPRSGITGLFGKDISV 396

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255582874|ref|XP_002532209.1| tryptophan biosynthesis protein, trpc, putative [Ricinus communis] gi|223528105|gb|EEF30178.1| tryptophan biosynthesis protein, trpc, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296085050|emb|CBI28465.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449453616|ref|XP_004144552.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449511794|ref|XP_004164055.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356554619|ref|XP_003545642.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356501182|ref|XP_003519406.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357492951|ref|XP_003616764.1| Indole-3-glycerol phosphate synthase [Medicago truncatula] gi|355518099|gb|AES99722.1| Indole-3-glycerol phosphate synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388519367|gb|AFK47745.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297791991|ref|XP_002863880.1| hypothetical protein ARALYDRAFT_494873 [Arabidopsis lyrata subsp. lyrata] gi|297309715|gb|EFH40139.1| hypothetical protein ARALYDRAFT_494873 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query398
TAIR|locus:2164768379 AT5G48220 [Arabidopsis thalian 0.864 0.907 0.718 2.3e-133
TAIR|locus:2058294402 AT2G04400 [Arabidopsis thalian 0.994 0.985 0.635 7.6e-128
TIGR_CMR|GSU_2380266 GSU_2380 "Indole-3-glycerol ph 0.660 0.988 0.397 2.5e-42
TIGR_CMR|CHY_1584264 CHY_1584 "indole-3-glycerol ph 0.638 0.962 0.373 1.8e-39
TIGR_CMR|DET_1484259 DET_1484 "indole-3-glycerol ph 0.620 0.953 0.396 8.9e-38
TIGR_CMR|SPO_2151270 SPO_2151 "indole-3-glycerol ph 0.623 0.918 0.387 1.5e-37
TIGR_CMR|CJE_0606258 CJE_0606 "indole-3-glycerol ph 0.638 0.984 0.369 4.4e-36
UNIPROTKB|P0A632272 trpC "Indole-3-glycerol phosph 0.643 0.941 0.372 1.7e-34
TIGR_CMR|CPS_3525 480 CPS_3525 "indole-3-glycerol ph 0.610 0.506 0.363 4.7e-32
UNIPROTKB|P00909 452 trpC "indole-3-glycerol phosph 0.605 0.533 0.366 9.8e-32
TAIR|locus:2164768 AT5G48220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1307 (465.1 bits), Expect = 2.3e-133, P = 2.3e-133
 Identities = 253/352 (71%), Positives = 291/352 (82%)

Query:    46 FTPIRAQKAETKDGSATISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPP 105
             + P+RAQK+   +GS        D+    K  E EVGM  NEV  SQGI+IRRRPPTGPP
Sbjct:    35 YAPLRAQKSGITEGS--------DSALEAKVSEQEVGMYQNEVVESQGIRIRRRPPTGPP 86

Query:   106 LHYVGPFQFRIQNEGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIG 165
             LHYVGPF+FR+QNEGNTPRNILEEIVWHKD EV Q+K+R+PL  LK ALDN PPA+DFIG
Sbjct:    87 LHYVGPFEFRLQNEGNTPRNILEEIVWHKDKEVAQMKERKPLYSLKKALDNVPPAKDFIG 146

Query:   166 ALMAANQRTGLPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKG 225
             AL +A+QRTGLP LIAEVKKASPSRGILREDF+PVEIA++YEKGGAACLS+LTD+KYFKG
Sbjct:   147 ALRSAHQRTGLPGLIAEVKKASPSRGILREDFNPVEIAQAYEKGGAACLSVLTDDKYFKG 206

Query:   226 SFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICK 285
             S+ENL+A+  AGVKCPLL KEFIV+AWQIYY R+KGADAVLLIA+VLPDLDI+YM KICK
Sbjct:   207 SYENLQAIMEAGVKCPLLLKEFIVEAWQIYYGRSKGADAVLLIASVLPDLDIKYMIKICK 266

Query:   286 LLGLTALVEVHDEREMDRVXXXXXXXXXXXXXXXXXTFEVDNSNTKKLLEGERGEIIRQK 345
             +LG+  LVEVHDEREMDRV                 TFEVD   TKKLLEGERGE+IRQK
Sbjct:   267 ILGMATLVEVHDEREMDRVLAIEGVELIGINNRNLETFEVDLGITKKLLEGERGELIRQK 326

Query:   346 NIIVVGESGLFTPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKDIS 397
             +I+VVGESGLFTP+DIA+VQEAGVKAVLVGES++KQ DPGK I+ LFG+D+S
Sbjct:   327 DILVVGESGLFTPEDIAFVQEAGVKAVLVGESLIKQSDPGKAISTLFGRDVS 378
GO:0003824 "catalytic activity" evidence=IEA
GO:0004425 "indole-3-glycerol-phosphate synthase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006568 "tryptophan metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
TAIR|locus:2058294 AT2G04400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2380 GSU_2380 "Indole-3-glycerol phosphate synthase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1584 CHY_1584 "indole-3-glycerol phosphate synthase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1484 DET_1484 "indole-3-glycerol phosphate synthase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2151 SPO_2151 "indole-3-glycerol phosphate synthase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0606 CJE_0606 "indole-3-glycerol phosphate synthase" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
UNIPROTKB|P0A632 trpC "Indole-3-glycerol phosphate synthase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3525 CPS_3525 "indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P00909 trpC "indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B1WQE4TRPC_CYAA54, ., 1, ., 1, ., 4, 80.540.73610.9965yesno
Q0IC57TRPC_SYNS34, ., 1, ., 1, ., 4, 80.50670.73110.9897yesno
Q3AL94TRPC_SYNSC4, ., 1, ., 1, ., 4, 80.50830.73360.9898yesno
Q5N575TRPC_SYNP64, ., 1, ., 1, ., 4, 80.51480.72110.9728yesno
B7K0H0TRPC_CYAP84, ., 1, ., 1, ., 4, 80.56660.73611.0yesno
B0JTM2TRPC_MICAN4, ., 1, ., 1, ., 4, 80.59190.73360.9864yesno
Q10ZM7TRPC_TRIEI4, ., 1, ., 1, ., 4, 80.50980.74621.0yesno
Q8KPR4TRPC_SYNE74, ., 1, ., 1, ., 4, 80.51480.72110.9728yesno
A5GMK4TRPC_SYNPW4, ., 1, ., 1, ., 4, 80.50330.73610.9965yesno
B0CEU2TRPC_ACAM14, ., 1, ., 1, ., 4, 80.53120.70600.9273yesno
A5GRL0TRPC_SYNR34, ., 1, ., 1, ., 4, 80.50660.73610.9965yesno
B8HP79TRPC_CYAP44, ., 1, ., 1, ., 4, 80.56250.70350.9271yesno
Q7NHI0TRPC_GLOVI4, ., 1, ., 1, ., 4, 80.52170.72860.9830yesno
A9BBR3TRPC_PROM44, ., 1, ., 1, ., 4, 80.51330.73610.9932yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.1.1.480.991
3rd Layer4.1.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029073001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (396 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00023836001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (316 aa)
• •• •• 0.999
GSVIVG00027369001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (458 aa)
•••• •• 0.999
GSVIVG00006903001
SubName- Full=Chromosome chr10 scaffold_179, whole genome shotgun sequence; (407 aa)
•••• •• 0.998
GSVIVG00029306001
RecName- Full=N-(5'-phosphoribosyl)anthranilate isomerase; EC=5.3.1.24; (262 aa)
• •  •• 0.998
GSVIVG00030640001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (141 aa)
•••  •• 0.989
GSVIVG00016051001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (389 aa)
• •• •• 0.987
GSVIVG00020704001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (430 aa)
• •• •• 0.986
GSVIVG00038137001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (483 aa)
••   •• 0.982
GSVIVG00024135001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (517 aa)
• ••  • 0.980
GSVIVG00030639001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (103 aa)
• •  •• 0.980

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query398
PLN02460338 PLN02460, PLN02460, indole-3-glycerol-phosphate sy 0.0
PRK00278260 PRK00278, trpC, indole-3-glycerol-phosphate syntha 1e-129
COG0134254 COG0134, TrpC, Indole-3-glycerol phosphate synthas 1e-104
cd00331217 cd00331, IGPS, Indole-3-glycerol phosphate synthas 1e-102
pfam00218254 pfam00218, IGPS, Indole-3-glycerol phosphate synth 1e-94
PRK09427 454 PRK09427, PRK09427, bifunctional indole-3-glycerol 5e-74
PRK13957247 PRK13957, PRK13957, indole-3-glycerol-phosphate sy 2e-44
PRK13802 695 PRK13802, PRK13802, bifunctional indole-3-glycerol 4e-43
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel protein 0.003
>gnl|CDD|215254 PLN02460, PLN02460, indole-3-glycerol-phosphate synthase Back     alignment and domain information 
 Score =  652 bits (1685), Expect = 0.0
 Identities = 281/342 (82%), Positives = 314/342 (91%), Gaps = 4/342 (1%)

Query: 55  ETKDGSATISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQF 114
            +K GSA    + +D   AL+ KEWEVGM  NE+AASQGI+IRRRPPTGPPLHYVGPFQF
Sbjct: 1   ASKSGSA----LYDDMFNALEVKEWEVGMSQNEIAASQGIRIRRRPPTGPPLHYVGPFQF 56

Query: 115 RIQNEGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRT 174
           R+QNEGNTPRNILEEIVW+KDVEV Q+K+R+PL +LK AL NAPPARDF+GAL AA++RT
Sbjct: 57  RLQNEGNTPRNILEEIVWYKDVEVAQMKERKPLYLLKKALQNAPPARDFVGALRAAHKRT 116

Query: 175 GLPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVR 234
           G P LIAEVKKASPSRG+LRE+FDPVEIA++YEKGGAACLS+LTDEKYF+GSFENLEA+R
Sbjct: 117 GQPGLIAEVKKASPSRGVLRENFDPVEIAQAYEKGGAACLSVLTDEKYFQGSFENLEAIR 176

Query: 235 SAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVE 294
           +AGVKCPLLCKEFIVDAWQIYYAR+KGADA+LLIAAVLPDLDI+YM KICK LG+ AL+E
Sbjct: 177 NAGVKCPLLCKEFIVDAWQIYYARSKGADAILLIAAVLPDLDIKYMLKICKSLGMAALIE 236

Query: 295 VHDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESG 354
           VHDEREMDRVLGIEG+ELIGINNR+LETFEVD SNTKKLLEGERGE IR+K IIVVGESG
Sbjct: 237 VHDEREMDRVLGIEGVELIGINNRSLETFEVDISNTKKLLEGERGEQIREKGIIVVGESG 296

Query: 355 LFTPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKDI 396
           LFTPDD+AYVQ AGVKAVLVGES+VKQDDPGKGI GLFGKDI
Sbjct: 297 LFTPDDVAYVQNAGVKAVLVGESLVKQDDPGKGIAGLFGKDI 338

Length = 338
>gnl|CDD|234710 PRK00278, trpC, indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|223212 COG0134, TrpC, Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|238203 cd00331, IGPS, Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>gnl|CDD|215798 pfam00218, IGPS, Indole-3-glycerol phosphate synthase Back     alignment and domain information
>gnl|CDD|236509 PRK09427, PRK09427, bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|140013 PRK13957, PRK13957, indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|184335 PRK13802, PRK13802, bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 398
PLN02460338 indole-3-glycerol-phosphate synthase 100.0
KOG4201289 consensus Anthranilate synthase component II [Amin 100.0
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 100.0
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 100.0
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 100.0
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 100.0
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 100.0
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 100.0
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 100.0
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 99.93
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 99.92
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 99.92
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 99.91
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 99.82
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 99.81
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.79
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 99.79
PRK04302223 triosephosphate isomerase; Provisional 99.76
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 99.75
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.72
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 99.64
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 99.57
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 99.56
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 99.55
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.54
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 99.53
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 99.51
PRK14024241 phosphoribosyl isomerase A; Provisional 99.51
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 99.5
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.49
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.46
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 99.45
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 99.44
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 99.42
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.42
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 99.42
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 99.42
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 99.41
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 99.41
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 99.39
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 99.39
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.39
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 99.39
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 99.38
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 99.37
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 99.35
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 99.34
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 99.34
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.33
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 99.28
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 99.24
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 99.23
PLN02591250 tryptophan synthase 99.2
PRK00208250 thiG thiazole synthase; Reviewed 99.2
PRK05581220 ribulose-phosphate 3-epimerase; Validated 99.19
PLN02334229 ribulose-phosphate 3-epimerase 99.19
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.18
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 99.18
PLN02617538 imidazole glycerol phosphate synthase hisHF 99.18
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 99.12
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 99.11
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.1
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 99.09
PRK07695201 transcriptional regulator TenI; Provisional 99.04
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 99.03
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 99.01
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 99.0
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 98.99
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 98.96
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 98.95
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 98.94
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 98.93
PLN02274 505 inosine-5'-monophosphate dehydrogenase 98.93
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 98.92
PRK07226267 fructose-bisphosphate aldolase; Provisional 98.91
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 98.9
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 98.86
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 98.83
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 98.83
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 98.82
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 98.82
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 98.81
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 98.81
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 98.77
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 98.73
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.72
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 98.71
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 98.67
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 98.66
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 98.65
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 98.64
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 98.63
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 98.62
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 98.6
PRK06806281 fructose-bisphosphate aldolase; Provisional 98.56
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 98.56
PRK08005210 epimerase; Validated 98.56
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 98.55
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 98.53
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 98.52
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.51
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 98.5
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.49
PRK08999312 hypothetical protein; Provisional 98.47
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 98.43
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 98.4
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 98.4
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 98.38
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 98.37
PRK07315293 fructose-bisphosphate aldolase; Provisional 98.36
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 98.34
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 98.33
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 98.3
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 98.26
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 98.25
PRK08091228 ribulose-phosphate 3-epimerase; Validated 98.24
cd02812219 PcrB_like PcrB_like proteins. One member of this f 98.23
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 98.22
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 98.21
PRK06852304 aldolase; Validated 98.21
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 98.2
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 98.18
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 98.16
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.15
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.15
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 98.13
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 98.13
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 98.12
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 98.1
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 98.09
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 98.08
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 98.05
PRK14057254 epimerase; Provisional 98.04
CHL00162267 thiG thiamin biosynthesis protein G; Validated 98.04
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 98.01
PRK06801286 hypothetical protein; Provisional 98.01
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 97.97
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 97.97
PRK08227264 autoinducer 2 aldolase; Validated 97.96
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 97.96
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 97.96
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 97.94
PLN02535364 glycolate oxidase 97.94
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 97.94
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 97.92
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 97.92
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 97.88
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 97.88
PRK11572248 copper homeostasis protein CutC; Provisional 97.83
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 97.79
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 97.79
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 97.77
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 97.75
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 97.74
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 97.74
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 97.73
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 97.73
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 97.73
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 97.72
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate trans 97.72
PRK09250348 fructose-bisphosphate aldolase; Provisional 97.72
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 97.71
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 97.71
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 97.71
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 97.7
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 97.69
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 97.67
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 97.67
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 97.67
TIGR01334277 modD putative molybdenum utilization protein ModD. 97.67
PRK11197381 lldD L-lactate dehydrogenase; Provisional 97.66
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 97.66
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 97.65
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 97.65
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 97.64
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 97.64
COG1411229 Uncharacterized protein related to proFAR isomeras 97.58
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 97.57
PLN02979366 glycolate oxidase 97.57
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 97.56
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 97.56
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 97.55
PRK08508279 biotin synthase; Provisional 97.55
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 97.53
PRK08185283 hypothetical protein; Provisional 97.52
PRK02083 253 imidazole glycerol phosphate synthase subunit HisF 97.51
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 97.49
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 97.49
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 97.47
TIGR00735 254 hisF imidazoleglycerol phosphate synthase, cyclase 97.47
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 97.46
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 97.45
TIGR00419205 tim triosephosphate isomerase. Triosephosphate iso 97.45
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 97.42
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 97.41
cd04731 243 HisF The cyclase subunit of imidazoleglycerol phos 97.4
KOG2335 358 consensus tRNA-dihydrouridine synthase [Translatio 97.38
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 97.35
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 97.33
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 97.33
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 97.3
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 97.3
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 97.27
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 97.27
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 97.26
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.25
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 97.24
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 97.22
PF01680208 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p 97.21
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 97.21
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.19
PRK00748 233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.19
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 97.17
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 97.17
PRK00042250 tpiA triosephosphate isomerase; Provisional 97.16
PRK13305218 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; 97.15
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 97.12
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 97.11
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 97.1
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 97.08
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.07
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 97.07
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 97.02
TIGR03572 232 WbuZ glycosyl amidation-associated protein WbuZ. T 97.02
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 97.01
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 97.01
COG3142241 CutC Uncharacterized protein involved in copper re 96.99
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 96.98
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 96.97
PRK07709285 fructose-bisphosphate aldolase; Provisional 96.97
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 96.95
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 96.94
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 96.94
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 96.91
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 96.91
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 96.9
PRK06096284 molybdenum transport protein ModD; Provisional 96.9
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 96.89
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 96.88
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 96.88
cd04732 234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 96.88
PRK00507221 deoxyribose-phosphate aldolase; Provisional 96.86
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 96.85
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 96.85
TIGR03569 329 NeuB_NnaB N-acetylneuraminate synthase. This famil 96.84
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 96.83
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 96.83
PRK14567253 triosephosphate isomerase; Provisional 96.83
PRK09016296 quinolinate phosphoribosyltransferase; Validated 96.82
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 96.82
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 96.82
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 96.81
PTZ00333255 triosephosphate isomerase; Provisional 96.8
PRK13523337 NADPH dehydrogenase NamA; Provisional 96.79
PRK01033 258 imidazole glycerol phosphate synthase subunit HisF 96.79
TIGR03586 327 PseI pseudaminic acid synthase. 96.78
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 96.76
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 96.76
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 96.73
TIGR01304 369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 96.73
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 96.73
PLN02429315 triosephosphate isomerase 96.73
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 96.69
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 96.67
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 96.66
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 96.65
PRK14565237 triosephosphate isomerase; Provisional 96.64
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 96.63
PRK00208250 thiG thiazole synthase; Reviewed 96.62
PLN02389379 biotin synthase 96.62
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 96.6
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 96.59
PRK14905355 triosephosphate isomerase/PTS system glucose/sucro 96.57
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 96.54
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 96.53
PRK07084321 fructose-bisphosphate aldolase; Provisional 96.51
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 96.51
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 96.51
PRK04128 228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.5
PRK08610286 fructose-bisphosphate aldolase; Reviewed 96.49
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 96.48
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 96.48
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 96.44
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 96.41
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 96.41
PLN02826409 dihydroorotate dehydrogenase 96.4
PLN02274505 inosine-5'-monophosphate dehydrogenase 96.4
PRK06256336 biotin synthase; Validated 96.39
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 96.39
PLN02561253 triosephosphate isomerase 96.37
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 96.36
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 96.34
COG5564276 Predicted TIM-barrel enzyme, possibly a dioxygenas 96.33
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 96.32
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 96.31
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 96.3
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 96.28
PRK14024241 phosphoribosyl isomerase A; Provisional 96.27
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 96.22
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 96.22
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 96.22
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 96.2
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 96.2
PRK02227238 hypothetical protein; Provisional 96.19
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 96.16
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 96.14
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 96.13
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 96.13
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 96.12
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 96.12
PF01645368 Glu_synthase: Conserved region in glutamate syntha 96.11
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.09
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 96.08
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 96.04
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 96.02
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 95.97
PRK13587 234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.94
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 95.94
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 95.91
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 95.9
PRK05835307 fructose-bisphosphate aldolase; Provisional 95.88
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 95.83
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 95.79
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 95.76
PRK15452 443 putative protease; Provisional 95.75
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 95.74
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 95.72
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 95.67
cd02812219 PcrB_like PcrB_like proteins. One member of this f 95.67
KOG0538363 consensus Glycolate oxidase [Energy production and 95.65
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 95.62
PRK15108345 biotin synthase; Provisional 95.52
PRK07028430 bifunctional hexulose-6-phosphate synthase/ribonuc 95.51
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 95.5
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 95.48
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 95.44
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 95.43
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 95.36
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 95.32
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 95.23
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 95.23
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 95.22
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 95.18
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 95.14
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 95.12
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 95.11
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 95.06
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 94.79
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 94.77
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 94.77
TIGR01334277 modD putative molybdenum utilization protein ModD. 94.76
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 94.76
PRK15492260 triosephosphate isomerase; Provisional 94.76
COG0826 347 Collagenase and related proteases [Posttranslation 94.76
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 94.74
cd00946345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 94.64
PRK09197350 fructose-bisphosphate aldolase; Provisional 94.61
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 94.61
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 94.6
PRK07188352 nicotinate phosphoribosyltransferase; Provisional 94.57
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 94.51
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 94.48
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 94.47
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 94.45
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 94.45
PF00977 229 His_biosynth: Histidine biosynthesis protein; Inte 94.41
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 94.41
PF00121244 TIM: Triosephosphate isomerase; InterPro: IPR00065 94.35
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 94.34
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 94.27
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 94.24
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate deca 94.23
TIGR02129 253 hisA_euk phosphoribosylformimino-5-aminoimidazole 94.2
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 94.17
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 94.16
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 94.14
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 94.13
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 94.12
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 94.06
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 93.98
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 93.91
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 93.84
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 93.82
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 93.81
PRK05265239 pyridoxine 5'-phosphate synthase; Provisional 93.8
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 93.79
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 93.77
COG2089 347 SpsE Sialic acid synthase [Cell envelope biogenesi 93.69
COG1891235 Uncharacterized protein conserved in archaea [Func 93.64
COG0107 256 HisF Imidazoleglycerol-phosphate synthase [Amino a 93.6
KOG0538363 consensus Glycolate oxidase [Energy production and 93.44
PRK07695201 transcriptional regulator TenI; Provisional 93.35
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 93.33
PRK13586 232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.3
TIGR01919 243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 93.25
PLN02535364 glycolate oxidase 93.25
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 93.24
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 93.23
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 93.21
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 93.18
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 93.16
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 93.16
PRK15447 301 putative protease; Provisional 93.12
cd06811 382 PLPDE_III_yhfX_like Type III Pyridoxal 5-phosphate 93.1
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 93.07
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 93.06
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 93.05
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 93.03
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 93.02
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 92.94
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 92.88
TIGR01520357 FruBisAldo_II_A fructose-bisphosphate aldolase, cl 92.88
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 92.84
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 92.83
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 92.8
cd08556189 GDPD Glycerophosphodiester phosphodiesterase domai 92.66
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 92.64
PRK09016296 quinolinate phosphoribosyltransferase; Validated 92.6
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 92.56
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 92.55
PRK13523337 NADPH dehydrogenase NamA; Provisional 92.54
cd08562229 GDPD_EcUgpQ_like Glycerophosphodiester phosphodies 92.51
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 92.46
PF03740239 PdxJ: Pyridoxal phosphate biosynthesis protein Pdx 92.45
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 92.37
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 92.34
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 92.32
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 92.32
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 92.28
cd01571302 NAPRTase_B Nicotinate phosphoribosyltransferase (N 92.28
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 92.27
PLN028581378 fructose-bisphosphate aldolase 92.19
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 92.16
PLN02826409 dihydroorotate dehydrogenase 92.15
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 92.12
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 92.08
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 92.04
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 92.01
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 92.01
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 92.0
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 91.94
PRK09856275 fructoselysine 3-epimerase; Provisional 91.92
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 91.88
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 91.8
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 91.78
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 91.77
PRK07094323 biotin synthase; Provisional 91.74
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 91.66
PRK04302223 triosephosphate isomerase; Provisional 91.64
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 91.63
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 91.62
PRK06096284 molybdenum transport protein ModD; Provisional 91.58
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 91.44
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 91.32
PLN02979366 glycolate oxidase 91.24
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 91.12
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 91.09
COG0106 241 HisA Phosphoribosylformimino-5-aminoimidazole carb 91.06
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 90.92
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 90.92
PLN02591250 tryptophan synthase 90.89
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 90.83
KOG4013255 consensus Predicted Cu2+ homeostasis protein CutC 90.81
PLN02446 262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 90.79
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 90.78
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 90.72
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 90.71
cd00453340 FTBP_aldolase_II Fructose/tagarose-bisphosphate al 90.68
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 90.66
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 90.48
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 90.46
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 90.42
PRK04165 450 acetyl-CoA decarbonylase/synthase complex subunit 90.35
PLN02334229 ribulose-phosphate 3-epimerase 90.33
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 90.25
PRK08091228 ribulose-phosphate 3-epimerase; Validated 90.13
cd00516281 PRTase_typeII Phosphoribosyltransferase (PRTase) t 90.05
PRK14057254 epimerase; Provisional 90.05
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 90.02
TIGR01496257 DHPS dihydropteroate synthase. This model represen 89.99
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 89.97
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 89.96
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 89.93
KOG0623541 consensus Glutamine amidotransferase/cyclase [Amin 89.86
COG4981 717 Enoyl reductase domain of yeast-type FAS1 [Lipid m 89.85
cd08579220 GDPD_memb_like Glycerophosphodiester phosphodieste 89.71
PRK05581220 ribulose-phosphate 3-epimerase; Validated 89.71
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 89.69
PRK11197381 lldD L-lactate dehydrogenase; Provisional 89.69
cd08564265 GDPD_GsGDE_like Glycerophosphodiester phosphodiest 89.62
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 89.62
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 89.58
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 89.58
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 89.53
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 89.52
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 89.33
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 89.25
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 89.21
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 89.18
PRK14566260 triosephosphate isomerase; Provisional 89.12
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information 
Probab=100.00  E-value=8.4e-99  Score=746.88  Aligned_cols=337  Identities=83%  Similarity=1.315  Sum_probs=314.3

Q ss_pred             cCCCceeeccchhhhhhHHhhhHhhhcchhhhhhhcCCeEEEeCCCCCCCcccccceeeeecCCCCCcccHHHHHHHHHH
Q 015899           56 TKDGSATISSVMEDAETALKAKEWEVGMLINEVAASQGIKIRRRPPTGPPLHYVGPFQFRIQNEGNTPRNILEEIVWHKD  135 (398)
Q Consensus        56 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~irrr~~~~~~~~~~~~~~~~~~~~~~~p~~iLe~Iv~~K~  135 (398)
                      ++++++.+    +++.|+.++++||+||++|+++++|||+|||||||+++.+.+++++|++++++++|+|||++|+|+|+
T Consensus         2 ~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~irr~~~~~~~~~~~~~~~~~~~~~~~~~~~iLe~Iv~~k~   77 (338)
T PLN02460          2 SKSGSALY----DDMFNALEVKEWEVGMSQNEIAASQGIRIRRRPPTGPPLHYVGPFQFRLQNEGNTPRNILEEIVWYKD   77 (338)
T ss_pred             Cccchhhh----hhhcchhHHHHhhccccchhccccCCceEecCCCCCcccccccccccccccccccHhHHHHHHHHHHH
Confidence            34555554    67999999999999999999999999999999999998899999999999999999999999999999


Q ss_pred             HHHHHHHhcCChHHHHHhhhcCCCCccHHHHHHhhhhcCCCceEEEEeccCCCCCCCCCCCCCHHHHHHHHHHcCCcEEE
Q 015899          136 VEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLS  215 (398)
Q Consensus       136 ~ev~~~k~~~pl~~l~~~~~~~~~~~~f~~aL~~~~~~~~~~~vIAEvKraSPSkG~i~~~~dp~~iA~aY~~~GA~aIS  215 (398)
                      .||+++++++|+.+|++.+...|++++|..||++.....++++|||||||+|||||+|++++||+++|+.|+++||+|||
T Consensus        78 ~eV~~~k~~~~l~~l~~~~~~~~~~r~f~~aL~~~~~~~g~~~vIAEvKrASPSkG~I~~~~dp~~iA~~Ye~~GA~aIS  157 (338)
T PLN02460         78 VEVAQMKERKPLYLLKKALQNAPPARDFVGALRAAHKRTGQPGLIAEVKKASPSRGVLRENFDPVEIAQAYEKGGAACLS  157 (338)
T ss_pred             HHHHHHHhcCCHHHHHHHHHhCCCCcCHHHHHHhhccccCCcceEeeeccCCCCCCccCCCCCHHHHHHHHHhCCCcEEE
Confidence            99999999999999999888888899999999863211245899999999999999999999999999999999999999


Q ss_pred             EeccCCcCCCCHHHHHHHHhcCCCCcEEeccccCCHHHHHHHHHcCcCEEEEeccCCChHHHHHHHHHHHHcCCcEEEEc
Q 015899          216 ILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEV  295 (398)
Q Consensus       216 VLTd~~~F~Gs~edL~~Ir~a~v~lPVL~KDFIid~~QI~eAr~~GADaVLLiaaiL~~~~L~~Li~~a~~LGL~~LVEV  295 (398)
                      ||||++||+||++||..||++++++||||||||+||||||+||.+|||+||||+++|++++|.+|+++|++|||++||||
T Consensus       158 VLTd~~~F~Gs~e~L~~vr~~~v~lPvLrKDFIID~yQI~eAr~~GADAVLLIaaiL~~~~L~~l~~~A~~LGme~LVEV  237 (338)
T PLN02460        158 VLTDEKYFQGSFENLEAIRNAGVKCPLLCKEFIVDAWQIYYARSKGADAILLIAAVLPDLDIKYMLKICKSLGMAALIEV  237 (338)
T ss_pred             EecCcCcCCCCHHHHHHHHHcCCCCCEeeccccCCHHHHHHHHHcCCCcHHHHHHhCCHHHHHHHHHHHHHcCCeEEEEe
Confidence            99999999999999999998548999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHhccCCCcEEeeccccCcccccChhhHHHHhhhhcccccccCCceEEEecCCCCHHHHHHHHHcCCCEEEEc
Q 015899          296 HDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPDDIAYVQEAGVKAVLVG  375 (398)
Q Consensus       296 ht~eEl~rAl~l~Ga~iIGINnRdL~tf~vDl~~t~~L~~~i~~~~i~~~~v~vVAESGI~t~eD~~~l~~~GadaVLVG  375 (398)
                      ||.+|+++|+++.|+++||||||||+||++|+++|.+|++..++..++|.++++||||||+|++|+.++.++|+||||||
T Consensus       238 H~~~ElerAl~~~ga~iIGINNRdL~Tf~vDl~~t~~L~~~~~~~~i~~~~~~~VsESGI~t~~Dv~~l~~~GadAvLVG  317 (338)
T PLN02460        238 HDEREMDRVLGIEGVELIGINNRSLETFEVDISNTKKLLEGERGEQIREKGIIVVGESGLFTPDDVAYVQNAGVKAVLVG  317 (338)
T ss_pred             CCHHHHHHHHhcCCCCEEEEeCCCCCcceECHHHHHHHhhhccccccCCCCeEEEECCCCCCHHHHHHHHHCCCCEEEEC
Confidence            99999999999658999999999999999999999999984333335457899999999999999999999999999999


Q ss_pred             ccccCCCChHHHHHhhhcCcC
Q 015899          376 ESIVKQDDPGKGITGLFGKDI  396 (398)
Q Consensus       376 eaLmk~~dp~~~i~~L~~~~~  396 (398)
                      |+||+++||++++++|++++|
T Consensus       318 EsLMr~~dp~~~l~~L~~~~~  338 (338)
T PLN02460        318 ESLVKQDDPGKGIAGLFGKDI  338 (338)
T ss_pred             HHHhCCCCHHHHHHHHhCCCC
Confidence            999999999999999999875

>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PF01680 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p is a highly conserved protein involved in growth arrest in Saccharomyces cerevisiae (Baker's yeast) [] Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>PLN02429 triosephosphate isomerase Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PLN02561 triosephosphate isomerase Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>COG5564 Predicted TIM-barrel enzyme, possibly a dioxygenase [General function prediction only] Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK15492 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK07188 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PF00121 TIM: Triosephosphate isomerase; InterPro: IPR000652 Triosephosphate isomerase (5 Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1891 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PRK15447 putative protease; Provisional Back     alignment and domain information
>cd06811 PLPDE_III_yhfX_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme yhfX Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd08556 GDPD Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd08562 GDPD_EcUgpQ_like Glycerophosphodiester phosphodiesterase domain in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase UgpQ and similar proteins Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK09856 fructoselysine 3-epimerase; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>KOG4013 consensus Predicted Cu2+ homeostasis protein CutC [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4981 Enoyl reductase domain of yeast-type FAS1 [Lipid metabolism] Back     alignment and domain information
>cd08579 GDPD_memb_like Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd08564 GDPD_GsGDE_like Glycerophosphodiester phosphodiesterase domain of putative Galdieria sulphuraria glycerophosphodiester phosphodiesterase and similar proteins Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PRK14566 triosephosphate isomerase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query398
3tsm_A272 Crystal Structure Of Indole-3-Glycerol Phosphate Sy 1e-41
3qja_A272 Crystal Structure Of The Mycobacterium Tuberculosis 5e-32
1pii_A 452 Three-Dimensional Structure Of The Bifunctional Enz 3e-31
1jcm_P259 Trpc Stability Mutant Containing An Engineered Disu 4e-31
4fb7_A275 The Apo Form Of Idole-3-Glycerol Phosphate Synthase 2e-30
1vc4_A254 Crystal Structure Of Indole-3-Glycerol Phosphate Sy 3e-25
1igs_A248 Indole-3-Glycerolphosphate Synthase From Sulfolobus 3e-24
1lbf_A247 Crystal Structure Of Indole-3-Glycerol Phosphate Sy 3e-24
2c3z_A222 Crystal Structure Of A Truncated Variant Of Indole- 3e-23
1j5t_A242 Crystal Structure Of Indole-3-glycerol Phosphate Sy 2e-20
1i4n_A251 Crystal Structure Of Indoleglycerol Phosphate Synth 3e-20
3uz5_A252 Designed Protein Ke59 R13 311H Length = 252 4e-19
3tc6_A258 Crystal Structure Of Engineered Protein. Northeast 3e-18
4ijb_A256 Crystal Structure Of Engineered Protein, Northeast 4e-18
4a29_A258 Structure Of The Engineered Retro-Aldolase Ra95.0 L 5e-18
4a2s_A258 Structure Of The Engineered Retro-aldolase Ra95.5 L 6e-18
3tc7_A258 Crystal Structure Of Engineered Protein. Northeast 7e-18
3uyc_A249 Designed Protein Ke59 R8_27A Length = 249 9e-18
4a2r_A258 Structure Of The Engineered Retro-Aldolase Ra95.5-5 1e-17
3uy7_A252 Designed Protein Ke59 R1 710H WITH G130S MUTATION L 3e-17
3uy8_A247 Designed Protein Ke59 R5_115F Length = 247 4e-17
3uxa_A252 Designed Protein Ke59 R1 710H Length = 252 4e-17
3nyz_A261 Crystal Structure Of Kemp Elimination Catalyst 1a53 5e-17
3hoj_A248 Crystal Structure Of A Novel Engineered Retroaldola 9e-17
3o6y_X258 Robust Computational Design, Optimization, And Stru 2e-14
3nxf_A258 Robust Computational Design, Optimization, And Stru 3e-14
>pdb|3TSM|A Chain A, Crystal Structure Of Indole-3-Glycerol Phosphate Synthase From Brucella Melitensis Length = 272 Back     alignment and structure 
Iteration: 1

 Score =  167 bits (423), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 156/273 (57%), Gaps = 9/273 (3%)
Query: 120 GNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPAL 179
           G+   +IL +I  +K  E+   K R  L  LK    +    R F+ AL  A +  G  AL
Sbjct: 3   GSMSTDILRKIEAYKREEIAAAKARLALDELKARTRDQSAPRGFLKAL-EAKRAAGQFAL 61
Query: 180 IAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVK 239
           IAE+KKASPS+G++R DFDP  +A++YE+GGAACLS+LTD   F+G+ E L A R A   
Sbjct: 62  IAEIKKASPSKGLIRPDFDPPALAKAYEEGGAACLSVLTDTPSFQGAPEFLTAARQA-CS 120
Query: 240 CPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDER 299
            P L K+F+ D +Q+Y AR+ GAD +L+I A + D   + +      LG+ AL+EVHDE 
Sbjct: 121 LPALRKDFLFDPYQVYEARSWGADCILIIMASVDDDLAKELEDTAFALGMDALIEVHDEA 180
Query: 300 EMDRVXXXXXXXXXXXXXXXXXTFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPD 359
           EM+R                  +FEV+ + +++L +      +   + ++VGESG+FT +
Sbjct: 181 EMERA-LKLSSRLLGVNNRNLRSFEVNLAVSERLAK------MAPSDRLLVGESGIFTHE 233
Query: 360 DIAYVQEAGVKAVLVGESIVKQDDPGKGITGLF 392
           D   ++++G+   L+GES+++Q D       L 
Sbjct: 234 DCLRLEKSGIGTFLIGESLMRQHDVAAATRALL 266
>pdb|3QJA|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Indole-3-Glycerol Phosphate Synthase (Trpc) In Apo Form Length = 272 Back     alignment and structure
>pdb|1PII|A Chain A, Three-Dimensional Structure Of The Bifunctional Enzyme Phosphoribosylanthranilate Isomerase: Indoleglycerolphosphate Synthase From Escherichia Coli Refined At 2.0 Angstroms Resolution Length = 452 Back     alignment and structure
>pdb|1JCM|P Chain P, Trpc Stability Mutant Containing An Engineered Disulphide Bridge And In Complex With A Cdrp-Related Substrate Length = 259 Back     alignment and structure
>pdb|4FB7|A Chain A, The Apo Form Of Idole-3-Glycerol Phosphate Synthase (Trpc) Form Mycobacterium Tuberculosis Length = 275 Back     alignment and structure
>pdb|1VC4|A Chain A, Crystal Structure Of Indole-3-Glycerol Phosphate Synthase (Trpc) From Thermus Thermophilus At 1.8 A Resolution Length = 254 Back     alignment and structure
>pdb|1IGS|A Chain A, Indole-3-Glycerolphosphate Synthase From Sulfolobus Solfataricus At 2.0 A Resolution Length = 248 Back     alignment and structure
>pdb|1LBF|A Chain A, Crystal Structure Of Indole-3-Glycerol Phosphate Syntase (Igps)with Reduced 1-(O-Caboxyphenylamino)-1-Deoxyribulose 5-Phosphate (Rcdrp) Length = 247 Back     alignment and structure
>pdb|2C3Z|A Chain A, Crystal Structure Of A Truncated Variant Of Indole-3- Glycerol Phosphate Synthase From Sulfolobus Solfataricus Length = 222 Back     alignment and structure
>pdb|1J5T|A Chain A, Crystal Structure Of Indole-3-glycerol Phosphate Synthase (tm0140) From Thermotoga Maritima At 3.0 A Resolution Length = 242 Back     alignment and structure
>pdb|1I4N|A Chain A, Crystal Structure Of Indoleglycerol Phosphate Synthase From Thermotoga Maritima Length = 251 Back     alignment and structure
>pdb|3UZ5|A Chain A, Designed Protein Ke59 R13 311H Length = 252 Back     alignment and structure
>pdb|3TC6|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or63 Length = 258 Back     alignment and structure
>pdb|4IJB|A Chain A, Crystal Structure Of Engineered Protein, Northeast Structural Genomics Consortium Target Or288 Length = 256 Back     alignment and structure
>pdb|4A29|A Chain A, Structure Of The Engineered Retro-Aldolase Ra95.0 Length = 258 Back     alignment and structure
>pdb|4A2S|A Chain A, Structure Of The Engineered Retro-aldolase Ra95.5 Length = 258 Back     alignment and structure
>pdb|3TC7|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or62 Length = 258 Back     alignment and structure
>pdb|3UYC|A Chain A, Designed Protein Ke59 R8_27A Length = 249 Back     alignment and structure
>pdb|4A2R|A Chain A, Structure Of The Engineered Retro-Aldolase Ra95.5-5 Length = 258 Back     alignment and structure
>pdb|3UY7|A Chain A, Designed Protein Ke59 R1 710H WITH G130S MUTATION Length = 252 Back     alignment and structure
>pdb|3UY8|A Chain A, Designed Protein Ke59 R5_115F Length = 247 Back     alignment and structure
>pdb|3UXA|A Chain A, Designed Protein Ke59 R1 710H Length = 252 Back     alignment and structure
>pdb|3NYZ|A Chain A, Crystal Structure Of Kemp Elimination Catalyst 1a53-2 Length = 261 Back     alignment and structure
>pdb|3HOJ|A Chain A, Crystal Structure Of A Novel Engineered Retroaldolase: Ra-22 Length = 248 Back     alignment and structure
>pdb|3O6Y|X Chain X, Robust Computational Design, Optimization, And Structural Characterization Of Retroaldol Enzymes Length = 258 Back     alignment and structure
>pdb|3NXF|A Chain A, Robust Computational Design, Optimization, And Structural Characterization Of Retroaldol Enzymes Length = 258 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query398
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 1e-140
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 1e-135
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 1e-125
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 1e-120
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 1e-117
3uy7_A252 KEMP eliminase KE59 R1 7/10H; structural genomics, 1e-109
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 6e-10
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} Length = 272 Back     alignment and structure
 Score =  400 bits (1029), Expect = e-140
 Identities = 110/279 (39%), Positives = 168/279 (60%), Gaps = 9/279 (3%)

Query: 120 GNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPAL 179
           G+   +IL +I  +K  E+   K R  L  LK    +    R F+ AL A  +  G  AL
Sbjct: 3   GSMSTDILRKIEAYKREEIAAAKARLALDELKARTRDQSAPRGFLKALEAK-RAAGQFAL 61

Query: 180 IAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVK 239
           IAE+KKASPS+G++R DFDP  +A++YE+GGAACLS+LTD   F+G+ E L A R A   
Sbjct: 62  IAEIKKASPSKGLIRPDFDPPALAKAYEEGGAACLSVLTDTPSFQGAPEFLTAARQA-CS 120

Query: 240 CPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEVHDER 299
            P L K+F+ D +Q+Y AR+ GAD +L+I A + D   + +      LG+ AL+EVHDE 
Sbjct: 121 LPALRKDFLFDPYQVYEARSWGADCILIIMASVDDDLAKELEDTAFALGMDALIEVHDEA 180

Query: 300 EMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPD 359
           EM+R L +    L+G+NNRNL +FEV+ + +++L +      +   + ++VGESG+FT +
Sbjct: 181 EMERALKL-SSRLLGVNNRNLRSFEVNLAVSERLAK------MAPSDRLLVGESGIFTHE 233

Query: 360 DIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKDISV 398
           D   ++++G+   L+GES+++Q D       L      +
Sbjct: 234 DCLRLEKSGIGTFLIGESLMRQHDVAAATRALLTGAEKL 272
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} Length = 272 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Length = 452 Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Length = 251 Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Length = 254 Back     alignment and structure
>3uy7_A KEMP eliminase KE59 R1 7/10H; structural genomics, israel structural proteomics center, is barrel, lyase; 1.45A {Escherichia coli} PDB: 3uxd_A* 3uxa_A* 3nyz_A 3nz1_A* 3uy8_A 3uyc_A 3uzj_A 3uz5_A 1igs_A 1juk_A 1jul_A* 3tc7_A 3tc6_A 1a53_A* 1lbf_A* 1lbl_A* 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* ... Length = 252 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} Length = 232 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query398
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 100.0
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 100.0
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 100.0
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 100.0
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 100.0
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 100.0
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 100.0
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 100.0
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 99.97
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 99.97
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 99.95
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 99.95
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 99.93
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 99.92
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 99.88
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 99.88
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 99.87
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 99.86
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 99.86
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.84
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.83
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 99.83
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 99.81
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 99.76
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 99.75
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 99.74
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 99.72
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 99.65
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 99.64
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 99.63
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 99.61
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 99.53
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 99.49
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 99.44
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 99.44
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 99.44
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 99.42
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 99.4
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 99.39
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 99.38
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 99.35
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 99.35
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 99.35
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 99.24
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 99.24
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 99.22
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 99.21
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 99.19
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 99.19
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 99.19
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 99.16
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 99.15
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 99.13
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 99.1
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 99.1
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 99.09
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 99.08
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 99.07
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 99.06
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 99.05
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 99.05
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 99.05
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 99.04
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 99.04
1ujp_A271 Tryptophan synthase alpha chain; riken structural 99.02
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 99.01
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 99.01
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.01
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 99.0
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 99.0
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 98.99
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 98.91
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 98.9
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.89
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 98.88
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 98.88
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 98.86
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 98.85
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 98.83
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 98.82
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 98.82
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 98.81
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 98.74
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 98.73
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 98.72
1viz_A240 PCRB protein homolog; structural genomics, unknown 98.69
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 98.69
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 98.69
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.67
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 98.61
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.55
3tha_A252 Tryptophan synthase alpha chain; structural genomi 98.51
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 98.44
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 98.39
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 98.34
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 98.33
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 98.31
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 98.31
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 98.22
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 98.21
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 98.21
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 98.2
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 98.16
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 98.16
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 98.15
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 98.13
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 98.11
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 98.09
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 98.08
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 98.06
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 98.02
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.96
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 97.95
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 97.89
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 97.87
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 97.86
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 97.85
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 97.82
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 97.81
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 97.8
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 97.78
3b0p_A 350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 97.77
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 97.75
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 97.74
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 97.71
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 97.7
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 97.7
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 97.68
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 97.65
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 97.65
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 97.61
3oa3_A288 Aldolase; structural genomics, seattle structural 97.61
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 97.61
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 97.56
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 97.53
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.52
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 97.5
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 97.5
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 97.49
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.47
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.47
3tdn_A 247 FLR symmetric alpha-beta TIM barrel; symmetric sup 97.43
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 97.41
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 97.41
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.41
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 97.41
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 97.4
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 97.4
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 97.32
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 97.29
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 97.28
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 97.28
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 97.27
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 97.27
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 97.26
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 97.24
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 97.22
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 97.21
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 97.19
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 97.17
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 97.17
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 97.17
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 97.13
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 97.12
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 97.11
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 97.1
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 97.03
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 97.03
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 96.96
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 96.96
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 96.95
2wqp_A 349 Polysialic acid capsule biosynthesis protein SIAC; 96.93
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 96.92
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 96.9
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 96.84
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shu 96.8
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 96.76
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 96.76
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 96.75
3g8r_A 350 Probable spore coat polysaccharide biosynthesis P; 96.74
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 96.74
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 96.73
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 96.7
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 96.69
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 96.69
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 96.63
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 96.61
3kts_A192 Glycerol uptake operon antiterminator regulatory; 96.61
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 96.61
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 96.58
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 96.57
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 96.48
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 96.47
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 96.46
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 96.43
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 96.4
1yya_A250 Triosephosphate isomerase; riken structural genomi 96.39
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 96.37
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 96.37
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 96.34
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 96.33
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 96.31
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.3
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 96.3
1r2r_A248 TIM, triosephosphate isomerase; closed loop confor 96.24
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 96.19
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerat 96.19
1mo0_A275 TIM, triosephosphate isomerase; structural genomic 96.17
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 96.16
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.14
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 96.05
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.01
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 95.97
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 95.96
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 95.96
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 95.94
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 95.93
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 95.93
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis 95.91
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 95.9
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 95.89
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 95.88
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 95.88
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 95.88
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 95.88
2yc6_A257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 95.85
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.83
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 95.82
3lmz_A257 Putative sugar isomerase; structural genomics, joi 95.8
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 95.79
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 95.78
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 95.78
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 95.76
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 95.76
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 95.75
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 95.75
1aw2_A256 Triosephosphate isomerase; psychrophilic, vibrio m 95.75
2btm_A252 TIM, protein (triosephosphate isomerase); thermoph 95.73
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 95.69
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 95.65
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 95.61
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 95.6
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 95.6
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 95.54
3m9y_A254 Triosephosphate isomerase; TIM barrel, glycolysis, 95.5
2j27_A250 Triosephosphate isomerase glycosomal; TIM, 2PG, LO 95.5
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 95.45
1tre_A255 Triosephosphate isomerase; intramolecular oxidored 95.45
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 95.42
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 95.37
1b9b_A255 TIM, protein (triosephosphate isomerase); thermoph 95.27
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 95.25
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 95.24
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 95.21
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 95.13
1viz_A240 PCRB protein homolog; structural genomics, unknown 95.0
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 94.95
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 94.95
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 94.92
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 94.92
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 94.9
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 94.86
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 94.84
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 94.82
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 94.82
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 94.82
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 94.8
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 94.76
3kws_A287 Putative sugar isomerase; structural genomics, joi 94.72
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 94.72
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 94.71
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 94.69
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 94.69
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 94.61
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 94.59
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 94.59
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 94.59
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 94.58
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 94.57
1ney_A247 TIM, triosephosphate isomerase; yeast, DHAP, dihyd 94.55
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 94.51
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 94.45
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 94.44
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 94.43
3qst_A255 Triosephosphate isomerase, putative; TIM barrel; 1 94.43
2fiq_A 420 Putative tagatose 6-phosphate kinase 1; structural 94.42
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 94.42
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 94.4
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 94.4
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 94.36
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 94.34
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 94.33
4gj1_A 243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 94.32
3th6_A249 Triosephosphate isomerase; alpha/beta barrel, embr 94.31
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 94.25
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 94.23
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 94.18
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 94.18
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 94.17
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 94.16
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 94.16
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 94.15
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 94.14
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 94.11
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 94.08
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 94.08
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 94.05
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 94.01
2v5j_A287 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; l 93.99
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 93.98
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 93.86
3kts_A192 Glycerol uptake operon antiterminator regulatory; 93.77
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 93.77
3krs_A271 Triosephosphate isomerase; ssgcid, SBRI, emerald b 93.76
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 93.76
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 93.69
2v5b_A244 Triosephosphate isomerase; TIM, unfolding, monotct 93.65
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 93.65
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; de 93.64
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 93.57
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 93.57
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 93.53
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 93.51
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 93.5
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 93.48
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 93.44
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM 93.42
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 93.41
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 93.4
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 93.36
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 93.32
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 93.27
2qgy_A391 Enolase from the environmental genome shotgun sequ 93.26
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 93.24
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 93.21
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 93.17
3pm6_A306 Putative fructose-bisphosphate aldolase; structura 93.12
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 93.1
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 93.0
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 92.99
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 92.95
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 92.92
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 92.9
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 92.87
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 92.83
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 92.8
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 92.71
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 92.63
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 92.62
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 92.59
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 92.52
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 92.5
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 92.47
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 92.44
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 92.42
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 92.35
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 92.34
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 92.34
2oz8_A389 MLL7089 protein; structural genomics, unknown func 92.19
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 92.11
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 92.11
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 92.08
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 92.06
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 92.03
2o55_A258 Putative glycerophosphodiester phosphodiesterase; 92.0
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 91.98
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 91.98
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 91.98
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 91.97
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 91.95
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 91.92
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 91.91
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 91.85
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 91.83
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 91.73
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 91.71
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 91.69
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 91.67
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 91.67
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 91.64
2gl5_A410 Putative dehydratase protein; structural genomics, 91.59
3s6d_A310 Putative triosephosphate isomerase; seattle struct 91.59
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 91.56
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 91.5
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 91.46
2o56_A407 Putative mandelate racemase; dehydratase, structur 91.45
3cny_A301 Inositol catabolism protein IOLE; xylose isomerase 91.41
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 91.4
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 91.38
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 91.33
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 91.32
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 91.29
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 91.22
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 91.13
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 91.13
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 91.06
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 91.05
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 91.0
2poz_A392 Putative dehydratase; octamer, structural genomics 90.96
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 90.93
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 90.93
1tzz_A392 Hypothetical protein L1841; structural genomics, m 90.86
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 90.82
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 90.82
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 90.81
1ujp_A271 Tryptophan synthase alpha chain; riken structural 90.79
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 90.77
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 90.75
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 90.74
2vws_A267 YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escher 90.73
3qc0_A275 Sugar isomerase; TIM barrel, structural genomics, 90.66
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 90.61
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 90.58
2zds_A340 Putative DNA-binding protein; TIM-barrel fold, str 90.54
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 90.53
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 90.5
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 90.5
3txv_A 450 Probable tagatose 6-phosphate kinase; structural g 90.49
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 90.47
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 90.46
2hk0_A309 D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00 90.37
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 90.31
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 90.31
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 90.26
3qvq_A252 Phosphodiesterase OLEI02445; structural genomics, 90.22
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 90.2
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 90.19
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 90.19
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 90.17
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 90.17
3obe_A305 Sugar phosphate isomerase/epimerase; structural ge 90.14
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 90.09
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 90.07
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 90.06
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 89.99
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 89.98
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 89.93
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 89.87
2ffc_A353 Orotidine 5-monophosphate decarboxylase; PV-PF10_0 89.78
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 89.72
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II a 89.71
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 89.68
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 89.67
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 89.65
2pz0_A252 Glycerophosphoryl diester phosphodiesterase; glyce 89.64
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 89.6
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 89.55
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 89.5
3eez_A378 Putative mandelate racemase/muconate lactonizing e 89.48
2q02_A272 Putative cytoplasmic protein; structural genomics, 89.48
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 89.46
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 89.41
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 89.31
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 88.95
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 88.9
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 88.86
3u0h_A281 Xylose isomerase domain protein; structural genomi 88.86
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 88.74
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 88.68
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 88.57
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 88.49
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 88.42
2i1o_A398 Nicotinate phosphoribosyltransferase; ZIN ION, zin 88.28
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 88.28
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 88.26
3kxq_A275 Triosephosphate isomerase; ssgcid, NIH, niaid, SBR 88.18
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 88.15
1o60_A 292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 88.13
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 88.12
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 87.97
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 87.92
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 87.91
3r0u_A379 Enzyme of enolase superfamily; structural genomics 87.91
3cqj_A295 L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre 87.88
3dx5_A286 Uncharacterized protein ASBF; beta-alpha barrel, p 87.85
3luf_A259 Two-component system response regulator/ggdef doma 87.83
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 87.78
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 87.69
1vd6_A224 Glycerophosphoryl diester phosphodiesterase; glyce 87.66
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 87.58
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 87.53
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 87.52
3l23_A303 Sugar phosphate isomerase/epimerase; structural ge 87.51
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 87.49
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 87.47
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 87.42
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 87.22
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 87.18
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 87.18
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 87.1
1vfs_A 386 Alanine racemase; TIM-barrel, greek-KEY motief, is 86.99
3ble_A337 Citramalate synthase from leptospira interrogans; 86.99
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 86.94
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 86.85
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 86.84
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 86.83
3ks6_A250 Glycerophosphoryl diester phosphodiesterase; struc 86.75
3lua_A140 Response regulator receiver protein; two-component 86.7
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 86.59
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 86.57
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
Probab=100.00  E-value=1.3e-73  Score=553.85  Aligned_cols=267  Identities=41%  Similarity=0.652  Sum_probs=251.0

Q ss_pred             CCCcccHHHHHHHHHHHHHHHHHhcCChHHHHHhhhcCCCCccHHHHHHhhhhcCCCceEEEEeccCCCCCCCCCCCCCH
Q 015899          120 GNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPALIAEVKKASPSRGILREDFDP  199 (398)
Q Consensus       120 ~~~p~~iLe~Iv~~K~~ev~~~k~~~pl~~l~~~~~~~~~~~~f~~aL~~~~~~~~~~~vIAEvKraSPSkG~i~~~~dp  199 (398)
                      ++.+++||++|+++|++||+++|+.+|+.+|+..+...+++++|.++|++... .++++|||||||+|||||+|++++||
T Consensus         3 ~~m~~~iL~~I~~~k~~ev~~~~~~~~~~~l~~~~~~~~~~~~f~~al~~~~~-~~~~~vIaE~KraSPSkG~i~~~~dp   81 (272)
T 3tsm_A            3 GSMSTDILRKIEAYKREEIAAAKARLALDELKARTRDQSAPRGFLKALEAKRA-AGQFALIAEIKKASPSKGLIRPDFDP   81 (272)
T ss_dssp             -----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCCCHHHHHHHHHH-TTCCEEEEEECSEETTTEESCSSCCH
T ss_pred             CCCchhHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHhCCCCCCHHHHHhhccc-cCCceEEEEeccCCCCCCccCCCCCH
Confidence            34456899999999999999999999999999999888999999999986532 36789999999999999999999999


Q ss_pred             HHHHHHHHHcCCcEEEEeccCCcCCCCHHHHHHHHhcCCCCcEEeccccCCHHHHHHHHHcCcCEEEEeccCCChHHHHH
Q 015899          200 VEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRY  279 (398)
Q Consensus       200 ~~iA~aY~~~GA~aISVLTd~~~F~Gs~edL~~Ir~a~v~lPVL~KDFIid~~QI~eAr~~GADaVLLiaaiL~~~~L~~  279 (398)
                      +++|+.|+++||+|||||||+.||+|+++||..||++ +++||||||||+|+|||++|+.+|||+||||++.|+++++++
T Consensus        82 ~~~A~~y~~~GA~~IsVltd~~~f~Gs~~~L~~ir~~-v~lPVl~Kdfi~d~~qi~ea~~~GAD~VlLi~a~L~~~~l~~  160 (272)
T 3tsm_A           82 PALAKAYEEGGAACLSVLTDTPSFQGAPEFLTAARQA-CSLPALRKDFLFDPYQVYEARSWGADCILIIMASVDDDLAKE  160 (272)
T ss_dssp             HHHHHHHHHTTCSEEEEECCSTTTCCCHHHHHHHHHT-SSSCEEEESCCCSTHHHHHHHHTTCSEEEEETTTSCHHHHHH
T ss_pred             HHHHHHHHHCCCCEEEEeccccccCCCHHHHHHHHHh-cCCCEEECCccCCHHHHHHHHHcCCCEEEEcccccCHHHHHH
Confidence            9999999999999999999999999999999999997 999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCcEEEEcCCHHHHHHHhccCCCcEEeeccccCcccccChhhHHHHhhhhcccccccCCceEEEecCCCCHH
Q 015899          280 MTKICKLLGLTALVEVHDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPD  359 (398)
Q Consensus       280 Li~~a~~LGL~~LVEVht~eEl~rAl~l~Ga~iIGINnRdL~tf~vDl~~t~~L~~~i~~~~i~~~~v~vVAESGI~t~e  359 (398)
                      |++.|+++||++||||||.+|+++|+++ |+++||||||||+||++|++++.+|++.+      |.++++|+||||+|++
T Consensus       161 l~~~a~~lGl~~lvevh~~eEl~~A~~~-ga~iIGinnr~l~t~~~dl~~~~~L~~~i------p~~~~vIaesGI~t~e  233 (272)
T 3tsm_A          161 LEDTAFALGMDALIEVHDEAEMERALKL-SSRLLGVNNRNLRSFEVNLAVSERLAKMA------PSDRLLVGESGIFTHE  233 (272)
T ss_dssp             HHHHHHHTTCEEEEEECSHHHHHHHTTS-CCSEEEEECBCTTTCCBCTHHHHHHHHHS------CTTSEEEEESSCCSHH
T ss_pred             HHHHHHHcCCeEEEEeCCHHHHHHHHhc-CCCEEEECCCCCccCCCChHHHHHHHHhC------CCCCcEEEECCCCCHH
Confidence            9999999999999999999999999998 99999999999999999999999999873      4578999999999999


Q ss_pred             HHHHHHHcCCCEEEEcccccCCCChHHHHHhhhcCc
Q 015899          360 DIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFGKD  395 (398)
Q Consensus       360 D~~~l~~~GadaVLVGeaLmk~~dp~~~i~~L~~~~  395 (398)
                      |+.++.++|+||||||++||+++||++++++|+..+
T Consensus       234 dv~~l~~~Ga~gvLVG~almr~~d~~~~~~~l~~g~  269 (272)
T 3tsm_A          234 DCLRLEKSGIGTFLIGESLMRQHDVAAATRALLTGA  269 (272)
T ss_dssp             HHHHHHTTTCCEEEECHHHHTSSCHHHHHHHHHHC-
T ss_pred             HHHHHHHcCCCEEEEcHHHcCCcCHHHHHHHHHhcc
Confidence            999999999999999999999999999999998754
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} SCOP: c.1.1.1 PDB: 3uwv_A* 3uwu_A* 3uww_A* 3uwy_A 3uwz_A* Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3th6_A Triosephosphate isomerase; alpha/beta barrel, embryogenesis, glycolysis; 2.40A {Rhipicephalus microplus} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic DEGR aromatic hydrocarbons catabolism; 1.60A {Escherichia coli} PDB: 2v5k_A Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>2o55_A Putative glycerophosphodiester phosphodiesterase; beta barrel, structural genomics, protein structure initiati 2; 2.81A {Galdieria sulphuraria} Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3s6d_A Putative triosephosphate isomerase; seattle structural genomics center for infectious disease, S pathogenic fungus, eukaryote; 2.20A {Coccidioides immitis RS} Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3cny_A Inositol catabolism protein IOLE; xylose isomerase-like TIM barrel, structural genomics, joint for structural genomics, JCSG; 1.85A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, 2-keto-3-deoxy SU aldolase, degradation of homoprotocatechuate; 1.39A {Escherichia coli} PDB: 2vwt_A Back     alignment and structure
>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>2zds_A Putative DNA-binding protein; TIM-barrel fold, structural genomics, NPPSFA; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3txv_A Probable tagatose 6-phosphate kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>2hk0_A D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Agrobacterium tumefaciens} PDB: 2hk1_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3qvq_A Phosphodiesterase OLEI02445; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase, hydrolase; HET: MSE G3P; 1.60A {Oleispira antarctica} Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>2ffc_A Orotidine 5-monophosphate decarboxylase; PV-PF10_0225, SGC, structural genomics, struc genomics consortium, lyase; HET: U5P; 1.70A {Plasmodium vivax} SCOP: c.1.2.3 PDB: 2guu_A* Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>2pz0_A Glycerophosphoryl diester phosphodiesterase; glycerophosphodiester phosphodiesterase, T. tengcongensis; 1.91A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3u0h_A Xylose isomerase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, gluconeogenesis, glycolysis, pentose shunt; 1.60A {Bartonella henselae} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A Back     alignment and structure
>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1vd6_A Glycerophosphoryl diester phosphodiesterase; glycerophosphod phosphodiesterase, HB8; 1.30A {Thermus thermophilus} SCOP: c.1.18.3 PDB: 1v8e_A Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>1vfs_A Alanine racemase; TIM-barrel, greek-KEY motief, isomerase; HET: KCX DCS; 1.90A {Streptomyces lavendulae} SCOP: b.49.2.2 c.1.6.1 PDB: 1vfh_A* 1vft_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>3ks6_A Glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Agrobacterium tumefaciens str} PDB: 3ks5_A* Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 398
d1vc4a_254 c.1.2.4 (A:) Indole-3-glycerophosphate synthase, I 5e-63
d1i4na_251 c.1.2.4 (A:) Indole-3-glycerophosphate synthase, I 3e-56
d1piia2254 c.1.2.4 (A:1-254) Indole-3-glycerophosphate syntha 5e-53
d1a53a_247 c.1.2.4 (A:) Indole-3-glycerophosphate synthase, I 8e-53
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 3e-19
d1y0ea_222 c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph 1e-18
d2flia1217 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimera 2e-06
d1thfd_253 c.1.2.1 (D:) Cyclase subunit (or domain) of imidaz 3e-05
d1hg3a_224 c.1.1.1 (A:) Triosephosphate isomerase {Archaeon P 3e-04
d1w0ma_226 c.1.1.1 (A:) Triosephosphate isomerase {Thermoprot 0.001
d1ka9f_251 c.1.2.1 (F:) Cyclase subunit (or domain) of imidaz 0.002
d1wv2a_243 c.1.31.1 (A:) Thiazole biosynthesis protein ThiG { 0.004
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: Tryptophan biosynthesis enzymes
domain: Indole-3-glycerophosphate synthase, IPGS
species: Thermus thermophilus [TaxId: 274]

 Score =  201 bits (511), Expect = 5e-63
 Identities = 96/278 (34%), Positives = 144/278 (51%), Gaps = 24/278 (8%)

Query: 116 IQNEGNTPRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTG 175
           ++ + +    +L EI   +  EV       P           P    F  AL+       
Sbjct: 1   MRPDLSRVPGVLGEIARKRASEVAPYPLPEP-----------PSVPSFKEALLRPG---- 45

Query: 176 LPALIAEVKKASPSRGILREDFDPVEIARSYEKGGAACLSILTDEKYFKGSFENLEAVRS 235
             ++IAEVK+ SPS G++R + DPVE A +Y +GGA  +S+LT+   F GS  +L+ VR 
Sbjct: 46  -LSVIAEVKRQSPSEGLIR-EVDPVEAALAYARGGARAVSVLTEPHRFGGSLLDLKRVRE 103

Query: 236 AGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTKICKLLGLTALVEV 295
           A V  PLL K+F+VD + +  AR  GA A LLI A+L +L   Y+ +  + LGL ALVEV
Sbjct: 104 A-VDLPLLRKDFVVDPFMLEEARAFGASAALLIVALLGELTGAYL-EEARRLGLEALVEV 161

Query: 296 HDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGL 355
           H ERE++      G E++GINNR+L T  ++     +L    R    R    ++V ESG 
Sbjct: 162 HTERELEIA-LEAGAEVLGINNRDLATLHINLETAPRLGRLAR---KRGFGGVLVAESGY 217

Query: 356 FTPDDIAYVQEAGVKAVLVGESIVKQDDPGKGITGLFG 393
              +++  + E    AVL+G S+++  D    +  L G
Sbjct: 218 SRKEELKAL-EGLFDAVLIGTSLMRAPDLEAALRELVG 254
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Length = 254 Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 247 Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Length = 217 Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 253 Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 224 Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Length = 226 Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Length = 251 Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Length = 243 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query398
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 100.0
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 100.0
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 100.0
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 100.0
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.86
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.8
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 99.53
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 99.44
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 99.37
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 99.35
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 99.32
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 99.31
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 99.29
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 99.17
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 99.16
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 99.16
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 99.15
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 99.12
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 98.87
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 98.72
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 98.63
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 98.59
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 98.54
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 98.52
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 98.4
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 98.33
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 98.31
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 98.3
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 98.3
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 98.23
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 98.11
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 98.1
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 97.91
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 97.89
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 97.88
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 97.82
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 97.81
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 97.77
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 97.74
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 97.69
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 97.58
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 97.5
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 97.47
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 97.47
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 97.27
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 97.23
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 97.23
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 97.07
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 97.01
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 96.95
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 96.87
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 96.87
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 96.85
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 96.77
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 96.75
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 96.69
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 96.68
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 96.62
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 96.55
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 96.53
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 96.5
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 96.47
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 96.41
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 96.33
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 96.33
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 96.17
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 96.0
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 95.98
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 95.89
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 95.72
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 95.68
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 95.41
d2zdra2280 Capsule biosynthesis protein SiaC, N-terminal doma 95.41
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 95.4
d1vlia2295 Spore coat polysaccharide biosynthesis protein Sps 95.39
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 95.33
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 95.16
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 95.05
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 95.01
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 94.97
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 94.95
d1thfd_ 253 Cyclase subunit (or domain) of imidazoleglycerolph 94.9
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 94.86
d1h5ya_ 252 Cyclase subunit (or domain) of imidazoleglycerolph 94.64
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 94.55
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 94.55
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 94.44
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 94.31
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 94.06
d1ka9f_ 251 Cyclase subunit (or domain) of imidazoleglycerolph 93.97
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 93.95
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 93.94
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 93.7
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 93.64
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 93.53
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 93.45
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 92.9
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 92.88
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 92.5
d1vzwa1 239 Phosphoribosylformimino-5-aminoimidazole carboxami 92.45
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 92.37
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 92.34
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 91.39
d1ofda2809 Alpha subunit of glutamate synthase, central and F 91.16
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 90.8
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 90.79
d1pvna1 362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 90.73
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 90.48
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 90.48
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 90.37
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 90.19
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 90.02
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 89.94
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 89.76
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 89.7
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 89.6
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 89.27
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 89.23
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 89.12
d1qo2a_ 241 Phosphoribosylformimino-5-aminoimidazole carboxami 89.07
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 88.94
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 88.83
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 88.75
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 88.69
d1mb3a_123 Cell division response regulator DivK {Caulobacter 88.45
d1trea_255 Triosephosphate isomerase {Escherichia coli [TaxId 88.37
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 88.21
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 88.13
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 88.01
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 87.99
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 87.97
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 87.94
d1jvna1 323 Cyclase subunit (or domain) of imidazoleglycerolph 87.75
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 87.74
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 87.69
d1i60a_278 Hypothetical protein IolI {Bacillus subtilis [TaxI 87.52
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 87.36
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 87.28
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 87.02
d2cu0a1 368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 86.95
d1s8na_190 Probable two-component system transcriptional regu 86.84
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 86.84
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 86.81
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 86.79
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 86.58
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 86.37
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 86.28
d1o1za_226 Hypothetical protein TM1621 {Thermotoga maritima [ 86.1
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 85.91
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 85.71
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 85.23
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 85.08
d1vd6a1217 Putative glycerophosphodiester phosphodiesterase T 84.71
d1vkfa_172 Glycerol uptake operon antiterminator-related prot 84.19
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 83.59
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 83.59
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 83.48
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 83.4
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 83.21
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 83.14
d1vfsa2237 Alanine racemase {Streptomyces lavendulae [TaxId: 83.12
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 82.85
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 82.2
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 82.13
d1qkka_140 Transcriptional regulatory protein DctD, receiver 81.97
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 81.84
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 81.46
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 81.27
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 80.97
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 80.94
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 80.73
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 80.73
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 80.23
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: Tryptophan biosynthesis enzymes
domain: Indole-3-glycerophosphate synthase, IPGS
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.2e-76  Score=564.95  Aligned_cols=253  Identities=38%  Similarity=0.611  Sum_probs=241.1

Q ss_pred             cccHHHHHHHHHHHHHHHHHhcCChHHHHHhhhcCCCCccHHHHHHhhhhcCCCceEEEEeccCCCCCCCCCCCCCHHHH
Q 015899          123 PRNILEEIVWHKDVEVTQLKQRRPLSMLKNALDNAPPARDFIGALMAANQRTGLPALIAEVKKASPSRGILREDFDPVEI  202 (398)
Q Consensus       123 p~~iLe~Iv~~K~~ev~~~k~~~pl~~l~~~~~~~~~~~~f~~aL~~~~~~~~~~~vIAEvKraSPSkG~i~~~~dp~~i  202 (398)
                      |.|||++|+++|++||+++|++.|+.+|+..+  .+++++|.++|++     ++++|||||||+|||+|.|++++||.++
T Consensus         1 M~~iL~~Ii~~K~~ev~~~k~~~~l~~l~~~~--~~~~~~f~~aL~~-----~~~~iIAEiKraSPSkG~i~~~~~p~~~   73 (254)
T d1piia2           1 MQTVLAKIVADKAIWVEARKQQQPLASFQNEV--QPSTRHFYDALQG-----ARTAFILECKKASPSKGVIRDDFDPARI   73 (254)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHSCGGGTGGGC--CCCCSCHHHHHCS-----SSCEEEEEECSEETTTEESCSSCCHHHH
T ss_pred             CccHHHHHHHHHHHHHHHHHhcCCHHHHHHhc--cccccCHHHHHhc-----CCCceehhhhhcccchhhhcccchhHHH
Confidence            57999999999999999999999999998765  3678999999975     4689999999999999999999999999


Q ss_pred             HHHHHHcCCcEEEEeccCCcCCCCHHHHHHHHhcCCCCcEEeccccCCHHHHHHHHHcCcCEEEEeccCCChHHHHHHHH
Q 015899          203 ARSYEKGGAACLSILTDEKYFKGSFENLEAVRSAGVKCPLLCKEFIVDAWQIYYARTKGADAVLLIAAVLPDLDIRYMTK  282 (398)
Q Consensus       203 A~aY~~~GA~aISVLTd~~~F~Gs~edL~~Ir~a~v~lPVL~KDFIid~~QI~eAr~~GADaVLLiaaiL~~~~L~~Li~  282 (398)
                      |+ |.++||+|||||||++||+||++||..||+. +++||||||||+|+||||+|+.+|||+||||+++|++++|.+|++
T Consensus        74 a~-~~~~gA~aiSVLTe~~~F~Gs~~~l~~v~~~-~~~PiLrKDFIid~~QI~ear~~GADavLLI~~~L~~~~l~~l~~  151 (254)
T d1piia2          74 AA-IYKHYASAISVLTDEKYFQGSFNFLPIVSQI-APQPILCKDFIIDPYQIYLARYYQADACLLMLSVLDDDQYRQLAA  151 (254)
T ss_dssp             HH-HHTTTCSEEEEECCSTTTCCCTTHHHHHHHH-CCSCEEEESCCCSHHHHHHHHHTTCSEEEEETTTCCHHHHHHHHH
T ss_pred             HH-HHHhccCceEEecccccCCCCHHHHHHHHhc-cccccchhcccCcHHHHHHHHhhccchhhhhHhhhcccHHHHHHH
Confidence            87 7789999999999999999999999999997 999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCcEEEEcCCHHHHHHHhccCCCcEEeeccccCcccccChhhHHHHhhhhcccccccCCceEEEecCCCCHHHHH
Q 015899          283 ICKLLGLTALVEVHDEREMDRVLGIEGIELIGINNRNLETFEVDNSNTKKLLEGERGEIIRQKNIIVVGESGLFTPDDIA  362 (398)
Q Consensus       283 ~a~~LGL~~LVEVht~eEl~rAl~l~Ga~iIGINnRdL~tf~vDl~~t~~L~~~i~~~~i~~~~v~vVAESGI~t~eD~~  362 (398)
                      +|+++||++||||||.+|+++|+++ |+++||||||||+||++|++++.+|++.+      |.++++||||||+|++|++
T Consensus       152 ~a~~lgl~~LVEvh~~~El~~a~~~-~a~iIGINnRnL~tf~vd~~~t~~L~~~i------p~~~~~VsESGI~~~~d~~  224 (254)
T d1piia2         152 VAHSLEMGVLTEVSNEEEQERAIAL-GAKVVGINNRDLRDLSIDLNRTRELAPKL------GHNVTVISESGINTYAQVR  224 (254)
T ss_dssp             HHHHTTCEEEEEECSHHHHHHHHHT-TCSEEEEESEETTTTEECTHHHHHHHHHH------CTTSEEEEESCCCCHHHHH
T ss_pred             HHHHHhhhHHHhhccHHHHHHHHhh-cccccCccccchhhhhhhhHHHHHHHHhC------CCCCEEEEcCCCCCHHHHH
Confidence            9999999999999999999999998 99999999999999999999999999874      5688999999999999999


Q ss_pred             HHHHcCCCEEEEcccccCCCChHHHHHhhh
Q 015899          363 YVQEAGVKAVLVGESIVKQDDPGKGITGLF  392 (398)
Q Consensus       363 ~l~~~GadaVLVGeaLmk~~dp~~~i~~L~  392 (398)
                      ++ ..|+|||||||+||+++||++++++|+
T Consensus       225 ~l-~~g~davLiGeslm~~~dp~~~l~~Ll  253 (254)
T d1piia2         225 EL-SHFANGFLIGSALMAHDDLHAAVRRVL  253 (254)
T ss_dssp             HH-TTTCSEEEECHHHHTCSCHHHHHHHHH
T ss_pred             HH-HcCCCEEEEChHHhCCCCHHHHHHHHh
Confidence            98 579999999999999999999999985
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o1za_ c.1.18.3 (A:) Hypothetical protein TM1621 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vd6a1 c.1.18.3 (A:8-224) Putative glycerophosphodiester phosphodiesterase TTHB141 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vkfa_ c.1.29.1 (A:) Glycerol uptake operon antiterminator-related protein TM1436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vfsa2 c.1.6.1 (A:13-249) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure