Citrus Sinensis ID: 016133

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MQVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDMTDGGQYSEFWNRDDEASGSEEDISDCDGNINLVIISRC
cHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHcccccccHHcccccHHHHHHHHHHcccccccEEcccccccccEEEEEEccccccHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEccccccccccccEEEEEcccccccHHHHHccccccccccccEEEEEEcHHcHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcc
cHHHHHHHHHHHcccccEEEEEEccHHHccHHHHHHHHHcHHHccEEEEEEEccHHHccccccccHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHcccccccEEEEccccccEEEEEEEccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHccccccHHcccccHHHHHHHHHHHHHcccEEEEEEEEEccccccccEEEEEEEcccccHHHHHHHccccccccccccEEEEccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEHHcccccHHHcccccccEccccccccccccccEEEEEEcc
mqvktkiyedldsgkpslrllyvtpeltatpgfmSKLKKIHSRGLLNLVAIdeahcisswghdfrpsyrklsslrnylpdvpilaltataapkVQKDVMESLclqnplvlkssfnrpnlfyEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFgmgidrkdvRLVCHFNIPKSMEAFYQEsgragrdqlpsksllyygmddRRRMEFILSknqsknsqsfstrersskksisDFSQMVDYCEGSGCRRKKILESfgeqipvslcknscdackhpNLLAKYLGELTSAVLQKNHFsqifissqdmtdggqysefwnrddeasgseedisdcdgninLVIISRC
mqvktkiyedldsgkpslRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPlvlkssfnrpnLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAfgmgidrkdvRLVCHFNIPKSMEAFYQEsgragrdqlpskSLLYYGMDDRRRMEFIlsknqsknsqsfstrersskksisdfsqMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDMTDGGQYSEFWNRDDEasgseedisdcdgninLVIISRC
MQVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKdllddayadlCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEFILsknqsknsqsFSTRERSSKKSISDFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDMTDGGQYSEFWNRDDEASGSEEDISDCDGNINLVIISRC
*****************LRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFY***************LLYYGM*************************************MVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISS*****************************************
**VKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEF************************SDFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDMTD*****************EEDISDCDGNINLVIISRC
MQVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEFILSK*********************DFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDMTDGGQYSEFWNRD*********ISDCDGNINLVIISRC
MQVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEFILSKN***********ERSSKKSISDFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDMTDGGQYSEFWNRDDEASGSEEDISDCDGNINLVIISRC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDMTDGGQYSEFWNRDDEASGSEEDISDCDGNINLVIISRC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query394 2.2.26 [Sep-21-2011]
Q9FT72 713 ATP-dependent DNA helicas no no 0.951 0.525 0.715 1e-163
O94762 991 ATP-dependent DNA helicas yes no 0.842 0.335 0.424 1e-77
O18017 988 Bloom syndrome protein ho yes no 0.781 0.311 0.451 5e-71
Q09811 1328 ATP-dependent DNA helicas yes no 0.743 0.220 0.423 4e-67
P35187 1447 ATP-dependent helicase SG yes no 0.758 0.206 0.385 2e-66
Q9FT73 705 Mediator of RNA polymeras no no 0.758 0.424 0.430 4e-66
P54132 1417 Bloom syndrome protein OS no no 0.791 0.220 0.428 4e-66
O88700 1416 Bloom syndrome protein ho no no 0.786 0.218 0.430 6e-66
Q9VGI8 1487 Bloom syndrome protein ho no no 0.784 0.207 0.404 2e-65
Q8L840 1188 ATP-dependent DNA helicas no no 0.802 0.265 0.406 3e-65
>sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 Back     alignment and function desciption
 Score =  574 bits (1479), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/383 (71%), Positives = 331/383 (86%), Gaps = 8/383 (2%)

Query: 2   QVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWG 61
            VK KI+EDLDSGKPS+RLLYVTPEL AT GFM KL+K+HSRGLLNL+AIDEAHCISSWG
Sbjct: 113 HVKNKIHEDLDSGKPSVRLLYVTPELIATKGFMLKLRKLHSRGLLNLIAIDEAHCISSWG 172

Query: 62  HDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFY 121
           HDFRPSYR+LS+LR+ L DVP+LALTATAAPKVQKDV++SL L+NPLVLKSSFNRPN+FY
Sbjct: 173 HDFRPSYRQLSTLRDSLADVPVLALTATAAPKVQKDVIDSLNLRNPLVLKSSFNRPNIFY 232

Query: 122 EVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLND 181
           EVRYKDLLD+AY DL ++LK+ G+ CAI+YCLERTTCD+LS +LS+ GIS AAYHAGLN 
Sbjct: 233 EVRYKDLLDNAYTDLGNLLKSCGNICAIIYCLERTTCDDLSVHLSSIGISSAAYHAGLNS 292

Query: 182 KARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQL 241
           K RS+VLDDW+SS+KQ++VATVAFGMGID+KDVR+VCHFNIPKSME+FYQESGRAGRDQL
Sbjct: 293 KMRSTVLDDWLSSKKQIIVATVAFGMGIDKKDVRMVCHFNIPKSMESFYQESGRAGRDQL 352

Query: 242 PSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCEGSGCRRK 301
           PS+S+LYYG+DDR++ME++L     +NS++  +   SSKK  SDF Q+V YCEGSGCRRK
Sbjct: 353 PSRSVLYYGVDDRKKMEYLL-----RNSENKKS--SSSKKPTSDFEQIVTYCEGSGCRRK 405

Query: 302 KILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFI-SSQDMTDGG 360
           KILESFGE+ PV  CK +CDACKHPN +A  L EL +   ++++ S+IFI SS + T+ G
Sbjct: 406 KILESFGEEFPVQQCKKTCDACKHPNQVAHCLEELMTTASRRHNSSRIFITSSNNKTNEG 465

Query: 361 QYSEFWNRDDEASGSEEDISDCD 383
           QYSEFWNR+++ S S E+ISD D
Sbjct: 466 QYSEFWNRNEDGSNSNEEISDSD 488
3'-5' DNA helicase that may play a role in the repair of DNA. Exhibits an ATP or dATP-dependent DNA-helicase activity. Can not use GTP/dGTP, CTP/dCTP or UTP/dUTP as nucleotide cofactors. Catalyzes DNA strand annealing. On nicked Holliday junctions, unwinds the lagging strand. Can not act on intact Holliday junctions.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|O94762|RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=RECQL5 PE=1 SV=2 Back     alignment and function description
>sp|O18017|BLM_CAEEL Bloom syndrome protein homolog OS=Caenorhabditis elegans GN=him-6 PE=2 SV=2 Back     alignment and function description
>sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 Back     alignment and function description
>sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FT73|MED34_ARATH Mediator of RNA polymerase II transcription subunit 34 OS=Arabidopsis thaliana GN=MED34 PE=1 SV=1 Back     alignment and function description
>sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 Back     alignment and function description
>sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 Back     alignment and function description
>sp|Q9VGI8|BLM_DROME Bloom syndrome protein homolog OS=Drosophila melanogaster GN=mus309 PE=1 SV=1 Back     alignment and function description
>sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
38230500 772 predicted protein [Populus tremula x Pop 0.982 0.501 0.771 1e-178
225444694 730 PREDICTED: ATP-dependent DNA helicase Q- 0.982 0.530 0.771 1e-174
255579791 718 DNA helicase, putative [Ricinus communis 0.969 0.532 0.771 1e-173
297738545 746 unnamed protein product [Vitis vinifera] 0.982 0.518 0.719 1e-166
356532786 732 PREDICTED: ATP-dependent DNA helicase Q- 0.959 0.516 0.746 1e-162
449446630 729 PREDICTED: ATP-dependent DNA helicase Q- 0.984 0.532 0.719 1e-161
30690466 620 ATP-dependent DNA helicase Q-like 3 [Ara 0.951 0.604 0.715 1e-161
30690461 713 ATP-dependent DNA helicase Q-like 3 [Ara 0.951 0.525 0.715 1e-161
297802358 744 hypothetical protein ARALYDRAFT_491073 [ 0.951 0.504 0.702 1e-161
357450081 776 ATP-dependent DNA helicase Q1 [Medicago 0.987 0.501 0.658 1e-161
>gi|38230500|gb|AAR14271.1| predicted protein [Populus tremula x Populus alba] Back     alignment and taxonomy information
 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 304/394 (77%), Positives = 343/394 (87%), Gaps = 7/394 (1%)

Query: 3   VKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGH 62
           V+ KI+EDLDSGKPS+RLLYVTPEL ATPGFMSKL KIH+RGLLNL+AIDEAHCISSWGH
Sbjct: 112 VRNKIHEDLDSGKPSVRLLYVTPELIATPGFMSKLTKIHTRGLLNLIAIDEAHCISSWGH 171

Query: 63  DFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYE 122
           DFRPSYRKLSSLRN+LPDVP+LALTATAAPKVQ DV+ESLCLQ+PLVLKSSFNRPN++YE
Sbjct: 172 DFRPSYRKLSSLRNHLPDVPVLALTATAAPKVQNDVIESLCLQDPLVLKSSFNRPNIYYE 231

Query: 123 VRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDK 182
           VRYKDLLDDAYADL SVLK+ GD CAIVYCLER TCD LSA+LS  GIS AAYHAGLN+K
Sbjct: 232 VRYKDLLDDAYADLPSVLKSCGDVCAIVYCLERATCDGLSAHLSKNGISSAAYHAGLNNK 291

Query: 183 ARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLP 242
            RSSVLDDWISS+ QVVVATVAFGMGIDRKDVR+VCHFNIPKSME+FYQESGRAGRDQLP
Sbjct: 292 LRSSVLDDWISSKIQVVVATVAFGMGIDRKDVRMVCHFNIPKSMESFYQESGRAGRDQLP 351

Query: 243 SKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCEGSGCRRKK 302
           SKSLLYYG+DDR++MEFIL   ++K  QS S+    SKKS++DF+ M++YCEG+GCRRKK
Sbjct: 352 SKSLLYYGVDDRKKMEFILRNAENKKLQSSSSGGELSKKSLTDFNLMIEYCEGAGCRRKK 411

Query: 303 ILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVL-QKNHFSQIFIS-SQDMTD-- 358
           ILESFGEQ+  +LCK SCDACKHPNL+AKYL ELT+++  Q+N FS++F+S S DM D  
Sbjct: 412 ILESFGEQVSATLCKKSCDACKHPNLVAKYLEELTTSIARQRNGFSRVFMSRSTDMIDEE 471

Query: 359 ---GGQYSEFWNRDDEASGSEEDISDCDGNINLV 389
                Q SEFWNRDDEA  SEEDISD D     V
Sbjct: 472 FRIDEQISEFWNRDDEAKSSEEDISDFDDETEAV 505

Source: Populus tremula x Populus alba

Species: Populus tremula x Populus alba

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225444694|ref|XP_002277754.1| PREDICTED: ATP-dependent DNA helicase Q-like 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255579791|ref|XP_002530733.1| DNA helicase, putative [Ricinus communis] gi|223529697|gb|EEF31639.1| DNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297738545|emb|CBI27790.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532786|ref|XP_003534951.1| PREDICTED: ATP-dependent DNA helicase Q-like 3-like [Glycine max] Back     alignment and taxonomy information
>gi|449446630|ref|XP_004141074.1| PREDICTED: ATP-dependent DNA helicase Q-like 3-like [Cucumis sativus] gi|449488107|ref|XP_004157941.1| PREDICTED: ATP-dependent DNA helicase Q-like 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30690466|ref|NP_849500.1| ATP-dependent DNA helicase Q-like 3 [Arabidopsis thaliana] gi|332661157|gb|AEE86557.1| ATP-dependent DNA helicase Q-like 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30690461|ref|NP_195299.2| ATP-dependent DNA helicase Q-like 3 [Arabidopsis thaliana] gi|75334307|sp|Q9FT72.1|RQL3_ARATH RecName: Full=ATP-dependent DNA helicase Q-like 3; AltName: Full=RecQ-like protein 3; Short=AtRecQ3; Short=AtRecQl3 gi|11121447|emb|CAC14867.1| DNA Helicase [Arabidopsis thaliana] gi|332661156|gb|AEE86556.1| ATP-dependent DNA helicase Q-like 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297802358|ref|XP_002869063.1| hypothetical protein ARALYDRAFT_491073 [Arabidopsis lyrata subsp. lyrata] gi|297314899|gb|EFH45322.1| hypothetical protein ARALYDRAFT_491073 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357450081|ref|XP_003595317.1| ATP-dependent DNA helicase Q1 [Medicago truncatula] gi|355484365|gb|AES65568.1| ATP-dependent DNA helicase Q1 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
TAIR|locus:2127998 713 RecQl3 "AT4G35740" [Arabidopsi 0.949 0.524 0.691 2.9e-142
UNIPROTKB|F1NWK5 1023 F1NWK5 "Uncharacterized protei 0.951 0.366 0.396 5.9e-70
UNIPROTKB|Q6P4G0 964 RECQL5 "ATP-dependent DNA heli 0.946 0.386 0.393 2.4e-69
UNIPROTKB|O94762 991 RECQL5 "ATP-dependent DNA heli 0.946 0.376 0.393 2.7e-69
UNIPROTKB|F1NT69451 F1NT69 "Uncharacterized protei 0.837 0.731 0.421 4.9e-69
UNIPROTKB|E1BKM5 987 RECQL5 "Uncharacterized protei 0.939 0.374 0.388 9.6e-69
RGD|1310823 973 Recql5 "RecQ protein-like 5" [ 0.949 0.384 0.394 1.3e-68
UNIPROTKB|F1PAG8 989 RECQL5 "Uncharacterized protei 0.946 0.377 0.400 4e-68
UNIPROTKB|J3KTQ2480 RECQL5 "ATP-dependent DNA heli 0.842 0.691 0.406 1.5e-67
WB|WBGene00001865 988 him-6 [Caenorhabditis elegans 0.786 0.313 0.450 5e-65
TAIR|locus:2127998 RecQl3 "AT4G35740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1391 (494.7 bits), Expect = 2.9e-142, P = 2.9e-142
 Identities = 264/382 (69%), Positives = 318/382 (83%)

Query:     3 VKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGH 62
             VK KI+EDLDSGKPS+RLLYVTPEL AT GFM KL+K+HSRGLLNL+AIDEAHCISSWGH
Sbjct:   114 VKNKIHEDLDSGKPSVRLLYVTPELIATKGFMLKLRKLHSRGLLNLIAIDEAHCISSWGH 173

Query:    63 DFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYE 122
             DFRPSYR+LS+LR+ L DVP+LALTATAAPKVQKDV++SL L+NPLVLKSSFNRPN+FYE
Sbjct:   174 DFRPSYRQLSTLRDSLADVPVLALTATAAPKVQKDVIDSLNLRNPLVLKSSFNRPNIFYE 233

Query:   123 VRYKXXXXXXXXXXCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDK 182
             VRYK           ++LK+ G+ CAI+YCLERTTCD+LS +LS+ GIS AAYHAGLN K
Sbjct:   234 VRYKDLLDNAYTDLGNLLKSCGNICAIIYCLERTTCDDLSVHLSSIGISSAAYHAGLNSK 293

Query:   183 ARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLP 242
              RS+VLDDW+SS+KQ++VATVAFGMGID+KDVR+VCHFNIPKSME+FYQESGRAGRDQLP
Sbjct:   294 MRSTVLDDWLSSKKQIIVATVAFGMGIDKKDVRMVCHFNIPKSMESFYQESGRAGRDQLP 353

Query:   243 SKSLLYYGMDDRRRMEFILXXXXXXXXXXFSTRERSSKKSISDFSQMVDYCEGSGCRRKK 302
             S+S+LYYG+DDR++ME++L           + +  SSKK  SDF Q+V YCEGSGCRRKK
Sbjct:   354 SRSVLYYGVDDRKKMEYLLRNSE-------NKKSSSSKKPTSDFEQIVTYCEGSGCRRKK 406

Query:   303 ILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFI-SSQDMTDGGQ 361
             ILESFGE+ PV  CK +CDACKHPN +A  L EL +   ++++ S+IFI SS + T+ GQ
Sbjct:   407 ILESFGEEFPVQQCKKTCDACKHPNQVAHCLEELMTTASRRHNSSRIFITSSNNKTNEGQ 466

Query:   362 YSEFWNRDDEASGSEEDISDCD 383
             YSEFWNR+++ S S E+ISD D
Sbjct:   467 YSEFWNRNEDGSNSNEEISDSD 488
GO:0005524 "ATP binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=ISS;IDA
GO:0008152 "metabolic process" evidence=IEA
GO:0006310 "DNA recombination" evidence=IDA
GO:0009378 "four-way junction helicase activity" evidence=IDA
GO:0036310 "annealing helicase activity" evidence=IDA
GO:0043138 "3'-5' DNA helicase activity" evidence=IDA
UNIPROTKB|F1NWK5 F1NWK5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P4G0 RECQL5 "ATP-dependent DNA helicase Q5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O94762 RECQL5 "ATP-dependent DNA helicase Q5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NT69 F1NT69 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKM5 RECQL5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1310823 Recql5 "RecQ protein-like 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAG8 RECQL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J3KTQ2 RECQL5 "ATP-dependent DNA helicase Q5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00001865 him-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.824
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
RecQl3
RecQl3; ATP binding / ATP-dependent helicase/ helicase/ nucleic acid binding; RecQl3; FUNCTIONS IN- helicase activity, ATP-dependent helicase activity, nucleic acid binding, ATP binding; INVOLVED IN- DNA recombination; LOCATED IN- cellular_component unknown; EXPRESSED IN- 18 plant structures; EXPRESSED DURING- 10 growth stages; CONTAINS InterPro DOMAIN/s- DNA/RNA helicase, DEAD/DEAH box type, N-terminal (InterPro-IPR011545), DNA helicase, ATP-dependent, RecQ type (InterPro-IPR004589), DNA helicase, ATP-dependent, RecQ type, N-terminal region (InterPro-IPR018329), DEAD-like helicase, N- [...] (713 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT3G25980
mitotic spindle checkpoint protein, putative (MAD2); mitotic spindle checkpoint protein, putati [...] (209 aa)
    •   0.806
HVT1
HVT1 (HELICASE IN VASCULAR TISSUE AND TAPETUM); ATP binding / helicase/ nucleic acid binding; H [...] (1299 aa)
      • 0.716
SNL1
SNL1 (SIN3-LIKE 1); Encodes SIN3-like 1, a homolog of the transcriptional repressor SIN3 (AT1G2 [...] (1372 aa)
      • 0.659
RNS3
RNS3 (RIBONUCLEASE 3); RNA binding / endoribonuclease/ ribonuclease T2; Encodes ribonuclease RN [...] (222 aa)
      • 0.627
AT2G01440
ATP binding / ATP-dependent DNA helicase/ ATP-dependent helicase/ helicase/ nucleic acid bindin [...] (973 aa)
      • 0.575
SWI2
SWI2 (SWITCH 2); ATP binding / DNA binding / helicase/ nucleic acid binding; SWITCH 2 (SWI2); F [...] (862 aa)
      • 0.567
SDE3
SDE3 (SILENCING DEFECTIVE); RNA helicase; Encodes a protein with similarity to RNA helicases. M [...] (1002 aa)
      • 0.506
RDR1
RDR1 (RNA-DEPENDENT RNA POLYMERASE 1); RNA-directed RNA polymerase/ nucleic acid binding; Encod [...] (1107 aa)
      • 0.500
AT5G50340
ATP binding / damaged DNA binding / nucleoside-triphosphatase/ nucleotide binding; ATP binding [...] (587 aa)
•     • 0.467
RDR6
RDR6 (RNA-DEPENDENT RNA POLYMERASE 6); RNA-directed RNA polymerase/ nucleic acid binding; Encod [...] (1196 aa)
      • 0.465

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 1e-112
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 2e-99
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 1e-96
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 3e-80
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 2e-78
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-24
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-20
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-19
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 5e-15
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 4e-11
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 4e-09
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 5e-09
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 9e-09
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 1e-07
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 9e-07
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-06
COG1205 851 COG1205, COG1205, Distinct helicase family with a 2e-05
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 3e-05
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-04
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 3e-04
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.002
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  340 bits (875), Expect = e-112
 Identities = 137/328 (41%), Positives = 199/328 (60%), Gaps = 21/328 (6%)

Query: 1   MQVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSW 60
            + + ++   L SG+  L+LLY++PE   +P F+  LK++     ++LVAIDEAHCIS W
Sbjct: 93  REERQQVLNQLKSGQ--LKLLYISPERLMSPRFLELLKRLP----ISLVAIDEAHCISQW 146

Query: 61  GHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLF 120
           GHDFRP YR+L  LR  LP+ P+LALTATA P+V+ D+ E L LQ+  + + SF+RPNL 
Sbjct: 147 GHDFRPDYRRLGRLRAGLPNPPVLALTATATPRVRDDIREQLGLQDANIFRGSFDRPNLA 206

Query: 121 YEVRYKDLLDDAYADLC--SVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAG 178
            +V  K    +    L   + +        I+YCL R   +EL+ +L   GIS  AYHAG
Sbjct: 207 LKVVEKG---EPSDQLAFLATVLPQLSKSGIIYCLTRKKVEELAEWLRKNGISAGAYHAG 263

Query: 179 LNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGR 238
           L+++ R  V   +++   +V+VAT AFGMGID+ DVR V H+++P S+E++YQE+GRAGR
Sbjct: 264 LSNEERERVQQAFLNDEIKVMVATNAFGMGIDKPDVRFVIHYDLPGSIESYYQETGRAGR 323

Query: 239 DQLPSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCEGSGC 298
           D LP++++L Y  +D R   +++   QSK        E   +  ++   QM+ YCE   C
Sbjct: 324 DGLPAEAILLYSPEDIRWQRYLI--EQSKPD------EEQKQIELAKLRQMIAYCETQTC 375

Query: 299 RRKKILESFGEQIPVSLCKNSCDACKHP 326
           RR  +L+ FGE  P   C N CD C   
Sbjct: 376 RRLVLLKYFGEDEP-EPCGN-CDNCLDT 401

Length = 590
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 394
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0353695 consensus ATP-dependent DNA helicase [General func 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PTZ00110545 helicase; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 99.98
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0346569 consensus RNA helicase [RNA processing and modific 99.97
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.97
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG4284 980 consensus DEAD box protein [Transcription] 99.96
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.96
PRK106891147 transcription-repair coupling factor; Provisional 99.96
KOG0327397 consensus Translation initiation factor 4F, helica 99.96
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.96
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.96
PRK13767 876 ATP-dependent helicase; Provisional 99.96
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.96
PRK02362 737 ski2-like helicase; Provisional 99.95
PRK14701 1638 reverse gyrase; Provisional 99.95
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.95
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.95
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.95
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.94
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.94
PHA02653675 RNA helicase NPH-II; Provisional 99.94
PRK00254 720 ski2-like helicase; Provisional 99.94
PRK01172 674 ski2-like helicase; Provisional 99.93
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.93
COG1202 830 Superfamily II helicase, archaea-specific [General 99.93
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.93
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.92
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.92
PRK04914 956 ATP-dependent helicase HepA; Validated 99.92
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.92
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.92
PRK09401 1176 reverse gyrase; Reviewed 99.91
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.91
PHA02558501 uvsW UvsW helicase; Provisional 99.9
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.9
PRK13766 773 Hef nuclease; Provisional 99.89
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.89
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.89
PRK05580679 primosome assembly protein PriA; Validated 99.87
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.87
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.87
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.86
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.85
COG1204 766 Superfamily II helicase [General function predicti 99.84
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.84
COG1205 851 Distinct helicase family with a unique C-terminal 99.84
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.83
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.83
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.83
PRK05298652 excinuclease ABC subunit B; Provisional 99.82
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.82
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.82
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.81
PRK09694878 helicase Cas3; Provisional 99.81
KOG0354746 consensus DEAD-box like helicase [General function 99.81
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.8
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.79
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.79
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.78
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.77
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.75
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.75
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.74
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.73
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.72
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.72
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.7
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.7
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.67
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.67
smart0049082 HELICc helicase superfamily c-terminal domain. 99.66
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.64
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.62
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.61
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.6
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.6
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.59
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.59
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.56
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.56
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.5
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.45
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.4
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.38
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.34
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.27
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.26
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.22
COG4096 875 HsdR Type I site-specific restriction-modification 99.21
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.2
PRK14873665 primosome assembly protein PriA; Provisional 99.19
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.14
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.13
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.11
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.08
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.05
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.04
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.02
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.95
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.87
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.87
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.84
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.83
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.75
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 98.72
KOG1123776 consensus RNA polymerase II transcription initiati 98.71
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.57
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.53
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.53
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 98.46
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.35
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.3
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.29
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.28
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.18
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.14
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.1
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.09
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.08
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.06
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 98.0
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.95
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.9
smart00487201 DEXDc DEAD-like helicases superfamily. 97.45
COG4889 1518 Predicted helicase [General function prediction on 97.4
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.32
KOG2340698 consensus Uncharacterized conserved protein [Funct 97.32
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.32
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.23
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 97.13
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 97.07
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 96.89
KOG4439901 consensus RNA polymerase II transcription terminat 96.76
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 96.3
COG0610 962 Type I site-specific restriction-modification syst 96.29
PF13871278 Helicase_C_4: Helicase_C-like 96.28
PRK05580 679 primosome assembly protein PriA; Validated 96.17
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 96.13
PF04851184 ResIII: Type III restriction enzyme, res subunit; 96.12
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 96.07
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.06
PRK14873 665 primosome assembly protein PriA; Provisional 95.85
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 95.79
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 95.54
TIGR00643630 recG ATP-dependent DNA helicase RecG. 95.32
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 94.95
COG1198 730 PriA Primosomal protein N' (replication factor Y) 94.61
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 94.52
PRK10689 1147 transcription-repair coupling factor; Provisional 94.11
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 93.9
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 93.38
PRK14701 1638 reverse gyrase; Provisional 93.37
KOG0383696 consensus Predicted helicase [General function pre 93.27
KOG0347 731 consensus RNA helicase [RNA processing and modific 93.16
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 93.14
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 92.98
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 92.24
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 92.03
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 91.51
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 91.4
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 90.75
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 90.69
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 90.46
KOG1001674 consensus Helicase-like transcription factor HLTF/ 90.37
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 89.38
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 88.98
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 88.85
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 87.77
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 86.62
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 85.95
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 85.32
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 85.03
PRK09401 1176 reverse gyrase; Reviewed 84.44
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 84.14
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 84.01
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 83.04
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 83.04
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 82.06
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 81.75
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 81.72
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 81.43
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 81.28
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 81.14
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 80.68
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 80.09
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=3.5e-72  Score=524.99  Aligned_cols=378  Identities=36%  Similarity=0.641  Sum_probs=321.3

Q ss_pred             chHHHHHHHHhcCCCcccEEEeCCceecChHHHHHHHhhccCCCccEEEEecCCccccCCCCCHHHHHHHHHHHHhCCCC
Q 016133            2 QVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDV   81 (394)
Q Consensus         2 ~~r~~i~~~l~~g~~~~~il~~tPe~v~tp~~~~~l~~~~~~~~l~~iVvDEaH~l~~~g~~fr~~~~~l~~l~~~~~~~   81 (394)
                      +||.+++.+|...+|++++||+|||+.+|.+|...|+.+.+.+.|.+||||||||+++|||||||+|..|+.|+..++++
T Consensus        98 ~ER~ri~~DL~~ekp~~K~LYITPE~AAt~~FQ~lLn~L~~r~~L~Y~vVDEAHCVSQWGHDFRPDYL~LG~LRS~~~~v  177 (641)
T KOG0352|consen   98 VERSRIMGDLAKEKPTIKMLYITPEGAATDGFQKLLNGLANRDVLRYIVVDEAHCVSQWGHDFRPDYLTLGSLRSVCPGV  177 (641)
T ss_pred             HHHHHHHHHHHhcCCceeEEEEchhhhhhhhHHHHHHHHhhhceeeeEEechhhhHhhhccccCcchhhhhhHHhhCCCC
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEeecCChhHHHHHHHHhCCCCCE-EEecCCCCCCeEEEEEEcCchhhHHHHHHHHHHhC-------------CCcc
Q 016133           82 PILALTATAAPKVQKDVMESLCLQNPL-VLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKAN-------------GDTC  147 (394)
Q Consensus        82 ~~l~lSAT~~~~~~~~i~~~l~~~~~~-~~~~~~~~~nl~~~v~~~~~~~~~~~~l~~~l~~~-------------~~~~  147 (394)
                      |+++||||+++++.+||...|.+.+|+ ++.++..|.|++|.+.++....+-+..|.++....             ..++
T Consensus       178 pwvALTATA~~~VqEDi~~qL~L~~PVAiFkTP~FR~NLFYD~~~K~~I~D~~~~LaDF~~~~LG~~~~~~~~~K~~~GC  257 (641)
T KOG0352|consen  178 PWVALTATANAKVQEDIAFQLKLRNPVAIFKTPTFRDNLFYDNHMKSFITDCLTVLADFSSSNLGKHEKASQNKKTFTGC  257 (641)
T ss_pred             ceEEeecccChhHHHHHHHHHhhcCcHHhccCcchhhhhhHHHHHHHHhhhHhHhHHHHHHHhcCChhhhhcCCCCcCcc
Confidence            999999999999999999999999997 67888999999999999888888887777765431             2358


Q ss_pred             EEEEeCcHHHHHHHHHHHHhCCCceEEecCCCCHHHHHHHHHHHhcCCCeEEEeccccccccCCCCccEEEEecCCCCHH
Q 016133          148 AIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSME  227 (394)
Q Consensus       148 ~IVF~~s~~~~~~l~~~L~~~g~~~~~~h~~l~~~~R~~~~~~f~~g~~~iLVaT~~~~~GiD~p~v~~VI~~~~p~s~~  227 (394)
                      +||||.|++.|++++-.|...|+++..||+||...+|.+++++|++++++||+||..||||||.|+|++||||++|.+++
T Consensus       258 GIVYCRTR~~cEq~AI~l~~~Gi~A~AYHAGLK~~ERTeVQe~WM~~~~PvI~AT~SFGMGVDKp~VRFViHW~~~qn~A  337 (641)
T KOG0352|consen  258 GIVYCRTRNECEQVAIMLEIAGIPAMAYHAGLKKKERTEVQEKWMNNEIPVIAATVSFGMGVDKPDVRFVIHWSPSQNLA  337 (641)
T ss_pred             eEEEeccHHHHHHHHHHhhhcCcchHHHhcccccchhHHHHHHHhcCCCCEEEEEeccccccCCcceeEEEecCchhhhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcccCCCCceEEEEEecccHHHHHHHHHhcccCCCCccchhHhhhhhhhhhHHHHHHHhhcccchHHHHHhhh
Q 016133          228 AFYQESGRAGRDQLPSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCEGSGCRRKKILESF  307 (394)
Q Consensus       228 ~y~Qr~GRagR~g~~g~~i~l~~~~d~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Crr~~l~~~f  307 (394)
                      .|||++|||||+|+++.|-++|+..|...+++++.....+... ....+...+..+..|..|++||+..+|||..|.+||
T Consensus       338 gYYQESGRAGRDGk~SyCRLYYsR~D~~~i~FLi~~e~aklre-k~~ke~~~k~~I~~F~k~~eFCE~~~CRH~~ia~fF  416 (641)
T KOG0352|consen  338 GYYQESGRAGRDGKRSYCRLYYSRQDKNALNFLVSGELAKLRE-KAKKEMQIKSIITGFAKMLEFCESARCRHVSIASFF  416 (641)
T ss_pred             HHHHhccccccCCCccceeeeecccchHHHHHHHhhHHHHHHH-hcchhhhHHHHHHHHHHHHHHHHHcccchHHHHHhc
Confidence            9999999999999999999999999999999998865443221 122344456677889999999999999999999999


Q ss_pred             CCCCCCCCcCCCCCCCCCchHhhHHHHHHHHHHhhcCCceeEEee-cCccCC---CCccchhhcccccCCCCccccccC
Q 016133          308 GEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFIS-SQDMTD---GGQYSEFWNRDDEASGSEEDISDC  382 (394)
Q Consensus       308 ~~~~~~~~c~~~Cd~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~  382 (394)
                      |+..+  .|..+||.|+.|....+.++...+.+....-...+-.. +.+++.   ++.+..+-.|+++.++++++-.++
T Consensus       417 gD~~p--~ckg~cd~c~~p~k~~r~~e~f~~s~~s~~~~~~~~~~~~~~~~~~g~~gg~~~~~ey~~g~~gs~d~s~d~  493 (641)
T KOG0352|consen  417 DDTEC--PCKTNCDYCRDPTKTIRNVEAFINSEASTGRSMFRKSASSGESGFDSVYGGGKRGGETEDELLSAASTSKDA  493 (641)
T ss_pred             CCCCC--CCCCCccccCCHHHHHHHHHHHHHhhhhccccccccccCccccccccccccccccccccccccCCCCcchhh
Confidence            99876  58888999997765555555555433221101111111 223322   234666777777777776554443

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
2v1x_A591 Crystal Structure Of Human Recq-Like Dna Helicase L 7e-58
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 3e-56
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 5e-54
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-08
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 3e-08
2jgn_A185 Ddx3 Helicase Domain Length = 185 3e-08
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 5e-08
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-07
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 2e-07
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-07
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-07
2hyi_C413 Structure Of The Human Exon Junction Complex With A 2e-07
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-07
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 3e-07
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 7e-07
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 3e-06
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-05
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 1e-05
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 1e-05
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 1e-05
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 2e-05
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 2e-05
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 2e-05
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-05
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-05
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 4e-05
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 4e-05
1fuu_A394 Yeast Initiation Factor 4a Length = 394 4e-05
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 5e-05
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 1e-04
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 1e-04
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 1e-04
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 1e-04
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 1e-04
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 2e-04
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 2e-04
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 2e-04
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 5e-04
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 6e-04
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure 
Iteration: 1

 Score =  221 bits (562), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 170/322 (52%), Gaps = 21/322 (6%)
Query: 7   IYEDLDSGKPSLRLLYVTPELTA-TPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFR 65
           ++ ++ +    L+L+YVTPE  A +  FMS+L+K +       +A+DE HC S WGHDFR
Sbjct: 126 VHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFR 185
Query: 66  PSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRY 125
           P Y+ L  L+   P+  ++ LTATA   V  D  + LC++      +SFNRPNL+YEVR 
Sbjct: 186 PDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQ 245
Query: 126 KXXXXXXXXXXCSVLKANG---DTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDK 182
           K             L  NG       I+YC  +   ++++  L   GI   AYHA L  +
Sbjct: 246 KPSNTEDFIEDIVKL-INGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPE 304
Query: 183 ARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLP 242
            +++V   W ++  QVVVATVAFGMGID+ DVR V H ++ KSME +YQESGRAGRD + 
Sbjct: 305 DKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMK 364
Query: 243 SKSLLYYGMDDRRRMEFILXXXXXXXXXXFSTRERSSKKSISDFSQMVDYCEG-SGCRRK 301
           +  +LYYG  D  R+  ++          +               +MV YC+  S CRR 
Sbjct: 365 ADCILYYGFGDIFRISSMVVMENVGQQKLY---------------EMVSYCQNISKCRRV 409
Query: 302 KILESFGEQIPVSLCKNSCDAC 323
            + + F E      C   CD C
Sbjct: 410 LMAQHFDEVWNSEACNKMCDNC 431
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 1e-147
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 1e-137
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 9e-16
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 9e-15
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 2e-13
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 5e-13
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-12
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-12
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-12
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-12
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 2e-12
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 6e-12
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 6e-12
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 6e-12
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-11
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 2e-11
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 2e-11
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-10
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 2e-10
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 3e-10
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-09
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-09
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-09
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 2e-09
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 8e-09
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 2e-08
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 2e-08
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-08
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 6e-07
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 3e-06
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-06
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 7e-06
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 1e-05
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-05
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-04
1yks_A440 Genome polyprotein [contains: flavivirin protease 1e-04
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 3e-04
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
 Score =  429 bits (1106), Expect = e-147
 Identities = 118/328 (35%), Positives = 174/328 (53%), Gaps = 19/328 (5%)

Query: 4   KTKIYEDLDSGKPSLRLLYVTPE-LTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGH 62
              ++ ++ +    L+L+YVTPE +  +  FMS+L+K +       +A+DE HC S WGH
Sbjct: 123 VKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGH 182

Query: 63  DFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYE 122
           DFRP Y+ L  L+   P+  ++ LTATA   V  D  + LC++      +SFNRPNL+YE
Sbjct: 183 DFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYE 242

Query: 123 VRYKD-LLDDAYADLCSVLKAN-GDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLN 180
           VR K    +D   D+  ++         I+YC  +   ++++  L   GI   AYHA L 
Sbjct: 243 VRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLE 302

Query: 181 DKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQ 240
            + +++V   W ++  QVVVATVAFGMGID+ DVR V H ++ KSME +YQESGRAGRD 
Sbjct: 303 PEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDD 362

Query: 241 LPSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCE-GSGCR 299
           + +  +LYYG  D  R+  ++        +                 +MV YC+  S CR
Sbjct: 363 MKADCILYYGFGDIFRISSMVVMENVGQQK---------------LYEMVSYCQNISKCR 407

Query: 300 RKKILESFGEQIPVSLCKNSCDACKHPN 327
           R  + + F E      C   CD C   +
Sbjct: 408 RVLMAQHFDEVWNSEACNKMCDNCCKDS 435
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query394
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.98
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.97
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.97
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.97
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.97
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.96
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.96
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.96
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.96
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.96
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.96
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.96
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.96
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.96
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.95
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.95
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.95
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.95
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.95
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.95
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.95
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.95
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.95
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.95
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.94
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.94
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.94
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.94
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.94
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.94
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.94
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.94
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.89
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.93
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.93
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.93
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.93
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.93
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.93
3h1t_A590 Type I site-specific restriction-modification syst 99.93
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.92
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.92
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.92
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.91
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.91
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.91
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.9
3jux_A822 Protein translocase subunit SECA; protein transloc 99.9
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.87
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.83
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.78
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.73
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.95
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.79
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.77
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.76
3bor_A237 Human initiation factor 4A-II; translation initiat 98.73
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.72
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.64
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.62
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.6
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.6
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.59
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.59
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.57
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.56
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.56
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.55
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.54
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.43
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.16
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.08
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.56
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.36
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.26
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.08
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 95.5
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 94.75
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 93.59
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 93.05
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 91.74
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 91.38
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 91.01
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 90.77
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 90.3
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 89.48
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 87.84
3bor_A237 Human initiation factor 4A-II; translation initiat 87.8
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 87.7
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 87.51
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 86.75
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 86.63
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 84.78
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 84.15
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 82.59
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-56  Score=459.86  Aligned_cols=310  Identities=38%  Similarity=0.708  Sum_probs=272.7

Q ss_pred             hHHHHHHHHhcCCCcccEEEeCCceecCh-HHHHHHHhhccCCCccEEEEecCCccccCCCCCHHHHHHHHHHHHhCCCC
Q 016133            3 VKTKIYEDLDSGKPSLRLLYVTPELTATP-GFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDV   81 (394)
Q Consensus         3 ~r~~i~~~l~~g~~~~~il~~tPe~v~tp-~~~~~l~~~~~~~~l~~iVvDEaH~l~~~g~~fr~~~~~l~~l~~~~~~~   81 (394)
                      ++..++..+.......+|+|+|||.+.++ .++..+.+......+++|||||||++++|||+||+.|..|..++..+|+.
T Consensus       122 ~~~~~~~~l~~~~~~~~Ilv~Tpe~L~~~~~~~~~l~~~~~~~~i~~iViDEAH~is~~g~dfr~~~~~l~~l~~~~~~~  201 (591)
T 2v1x_A          122 HVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNA  201 (591)
T ss_dssp             HHHHHHHHHHCTTCCCCEEEECHHHHHSCHHHHHHHHHHHHTTCEEEEEEETGGGGSTTCTTCCGGGGGGGHHHHHCTTS
T ss_pred             HHHHHHHHhhcccCCCCEEEEChhHhhccHHHHHHHHhhhhccCCcEEEEECcccccccccccHHHHHHHHHHHHhCCCC
Confidence            34556677754444589999999988764 56666777667788999999999999999999999999988899999999


Q ss_pred             CEEEEeecCChhHHHHHHHHhCCCCCEEEecCCCCCCeEEEEEEcCc-hhhHHHHHHHHHHh-CCCccEEEEeCcHHHHH
Q 016133           82 PILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDL-LDDAYADLCSVLKA-NGDTCAIVYCLERTTCD  159 (394)
Q Consensus        82 ~~l~lSAT~~~~~~~~i~~~l~~~~~~~~~~~~~~~nl~~~v~~~~~-~~~~~~~l~~~l~~-~~~~~~IVF~~s~~~~~  159 (394)
                      |+++||||+++.+..++...+++..+..+..++.++|++|.+..... ...++..|..++.. ..++++||||+|++.++
T Consensus       202 ~ii~lSAT~~~~v~~~i~~~l~~~~~~~~~~~~~r~nl~~~v~~~~~~~~~~~~~l~~~l~~~~~~~~~IVf~~sr~~~e  281 (591)
T 2v1x_A          202 SLIGLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSE  281 (591)
T ss_dssp             EEEEEESSCCHHHHHHHHHHTTCCSCEEEECCCCCTTEEEEEEECCSSHHHHHHHHHHHHTTTTTTCEEEEECSSHHHHH
T ss_pred             cEEEEecCCCHHHHHHHHHHhCCCCcEEEecCCCCcccEEEEEeCCCcHHHHHHHHHHHHHHhccCCCeEEEeCcHHHHH
Confidence            99999999999999999999999999999999999999999887653 34566777787764 36779999999999999


Q ss_pred             HHHHHHHhCCCceEEecCCCCHHHHHHHHHHHhcCCCeEEEeccccccccCCCCccEEEEecCCCCHHHHHHHHhhcccC
Q 016133          160 ELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRD  239 (394)
Q Consensus       160 ~l~~~L~~~g~~~~~~h~~l~~~~R~~~~~~f~~g~~~iLVaT~~~~~GiD~p~v~~VI~~~~p~s~~~y~Qr~GRagR~  239 (394)
                      .+++.|.+.|+.+..|||+|++.+|..++++|++|+++|||||++++||||+|+|++||||++|.|+++|+||+|||||+
T Consensus       282 ~la~~L~~~g~~~~~~h~~l~~~~R~~~~~~F~~g~~~VlVAT~a~~~GID~p~V~~VI~~~~p~s~~~y~Qr~GRaGR~  361 (591)
T 2v1x_A          282 QVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRD  361 (591)
T ss_dssp             HHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSSSEEEECTTSCTTCCCSCEEEEEESSCCSSHHHHHHHHTTSCTT
T ss_pred             HHHHHHHHCCCCEEEecCCCCHHHHHHHHHHHHcCCCeEEEEechhhcCCCcccccEEEEeCCCCCHHHHHHHhccCCcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCceEEEEEecccHHHHHHHHHhcccCCCCccchhHhhhhhhhhhHHHHHHHhh-cccchHHHHHhhhCCCCCCCCcCC
Q 016133          240 QLPSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCE-GSGCRRKKILESFGEQIPVSLCKN  318 (394)
Q Consensus       240 g~~g~~i~l~~~~d~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~Crr~~l~~~f~~~~~~~~c~~  318 (394)
                      |++|.|+++|++.|...++.++...               ......+..|+.||+ ...|||+.|++|||+...+..|++
T Consensus       362 G~~g~~i~l~~~~D~~~~~~~~~~~---------------~~~~~~l~~~~~~~~~~~~Crr~~ll~~f~e~~~~~~c~~  426 (591)
T 2v1x_A          362 DMKADCILYYGFGDIFRISSMVVME---------------NVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNK  426 (591)
T ss_dssp             SSCEEEEEEECHHHHHHHHHHTTTS---------------TTHHHHHHHHHHHHTCSSSCHHHHHHHHHTCCC---CCCS
T ss_pred             CCCceEEEEEChHHHHHHHHHHhhh---------------hhhHHHHHHHHHHHhcccccHHHHHHHHcCCCCCccccCC
Confidence            9999999999999999888876431               123456788999999 589999999999999876668988


Q ss_pred             CCCCCCCch
Q 016133          319 SCDACKHPN  327 (394)
Q Consensus       319 ~Cd~C~~~~  327 (394)
                      .||+|..+.
T Consensus       427 ~Cd~C~~~~  435 (591)
T 2v1x_A          427 MCDNCCKDS  435 (591)
T ss_dssp             CBHHHHCCC
T ss_pred             CCCCCCCCC
Confidence            899998763
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 394
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-32
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 2e-20
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 2e-19
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 9e-18
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 3e-15
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-14
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 1e-14
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-14
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 3e-12
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 3e-12
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 7e-11
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 2e-10
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 4e-10
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 5e-09
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 8e-08
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 3e-07
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 1e-04
d1tf5a4175 c.37.1.19 (A:396-570) Translocation ATPase SecA, n 0.004
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecQ helicase domain
species: Escherichia coli [TaxId: 562]

 Score =  119 bits (298), Expect = 1e-32
 Identities = 77/214 (35%), Positives = 113/214 (52%), Gaps = 14/214 (6%)

Query: 113 SFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISC 172
           SF+RPN+ Y +  K         L   ++       I+YC  R   ++ +A L + GIS 
Sbjct: 1   SFDRPNIRYMLMEKF---KPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSKGISA 57

Query: 173 AAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQE 232
           AAYHAGL +  R+ V + +     Q+VVATVAFGMGI++ +VR V HF+IP+++E++YQE
Sbjct: 58  AAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQE 117

Query: 233 SGRAGRDQLPSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDY 292
           +GRAGRD LP++++L+Y   D   +   L +      Q     +          + M  +
Sbjct: 118 TGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQLQDIERHK---------LNAMGAF 168

Query: 293 CEGSGCRRKKILESFGEQIPVSLCKNSCDACKHP 326
            E   CRR  +L  FGE      C N CD C  P
Sbjct: 169 AEAQTCRRLVLLNYFGEGRQEP-CGN-CDICLDP 200
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query394
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 100.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.97
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.97
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.97
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.97
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.97
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.96
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.95
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.94
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.92
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.89
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.86
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.86
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.81
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.8
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.8
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.8
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.76
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.55
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.52
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.43
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.38
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.34
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.89
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.82
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.79
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.75
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.75
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.72
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.7
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.7
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.65
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.48
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 98.07
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.04
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.0
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.96
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.65
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.46
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.46
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.06
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.89
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.41
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 96.34
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 95.84
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 95.09
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 90.31
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 88.29
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 86.73
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecQ helicase domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=4.5e-45  Score=324.41  Aligned_cols=200  Identities=38%  Similarity=0.696  Sum_probs=179.8

Q ss_pred             CCCCCCeEEEEEEcCchhhHHHHHHHHHHhCCCccEEEEeCcHHHHHHHHHHHHhCCCceEEecCCCCHHHHHHHHHHHh
Q 016133          113 SFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWI  192 (394)
Q Consensus       113 ~~~~~nl~~~v~~~~~~~~~~~~l~~~l~~~~~~~~IVF~~s~~~~~~l~~~L~~~g~~~~~~h~~l~~~~R~~~~~~f~  192 (394)
                      +++|||++|.+....   ++++.|..+++...+.++||||+|++.++.++..|...|+.+..+||+++..+|.++++.|+
T Consensus         1 s~~RpNi~y~v~~~~---~k~~~L~~~l~~~~~~~~IIF~~t~~~~~~l~~~l~~~~~~~~~~h~~~~~~~r~~~~~~f~   77 (200)
T d1oywa3           1 SFDRPNIRYMLMEKF---KPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQ   77 (200)
T ss_dssp             CCCCTTEEEEEEECS---SHHHHHHHHHHHTTTCCEEEECSSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHH
T ss_pred             CCCCCCcEEEEEcCC---cHHHHHHHHHHhcCCCCEEEEEeeehhhHHhhhhhccCCceeEEecCCCcHHHHHHHHHHHh
Confidence            579999999998764   47888999998888889999999999999999999999999999999999999999999999


Q ss_pred             cCCCeEEEeccccccccCCCCccEEEEecCCCCHHHHHHHHhhcccCCCCceEEEEEecccHHHHHHHHHhcccCCCCcc
Q 016133          193 SSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEFILSKNQSKNSQSF  272 (394)
Q Consensus       193 ~g~~~iLVaT~~~~~GiD~p~v~~VI~~~~p~s~~~y~Qr~GRagR~g~~g~~i~l~~~~d~~~~~~i~~~~~~~~~~~~  272 (394)
                      +|+++|||||++++||||+|+|++||||++|.++++|+||+|||||+|++|.+++|+.+.|...+++++++....     
T Consensus        78 ~g~~~ilvaTd~~~~GiD~p~v~~VI~~~~P~~~~~y~qr~GR~gR~g~~g~ai~~~~~~d~~~l~~~i~~~~~~-----  152 (200)
T d1oywa3          78 RDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQG-----  152 (200)
T ss_dssp             TTSCSEEEECTTSCTTTCCTTCCEEEESSCCSSHHHHHHHHTTSCTTSSCEEEEEEECHHHHHHHHHHHHTSCCS-----
T ss_pred             cccceEEEecchhhhccCCCCCCEEEECCCccchHHHHHHhhhhhcCCCCceEEEecCHHHHHHHHhhhhccccc-----
Confidence            999999999999999999999999999999999999999999999999999999999999999999888754332     


Q ss_pred             chhHhhhhhhhhhHHHHHHHhhcccchHHHHHhhhCCCCCCCCcCCCCCCCCCc
Q 016133          273 STRERSSKKSISDFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHP  326 (394)
Q Consensus       273 ~~~~~~~~~~~~~~~~~~~~~~~~~Crr~~l~~~f~~~~~~~~c~~~Cd~C~~~  326 (394)
                          +......+.+..|.+|+++..|||..|++|||+... ..|+ .||+|.+|
T Consensus       153 ----~~~~~~~~~~~~m~~~~~~~~Crr~~ll~~fge~~~-~~C~-~CD~C~~p  200 (200)
T d1oywa3         153 ----QLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQ-EPCG-NCDICLDP  200 (200)
T ss_dssp             ----HHHHHHHHHHHHHHHHHTCSSCHHHHHHHHTTCCCC-SCCS-CBHHHHSC
T ss_pred             ----cchhhhHHHHHHHHHHHhchhhHHHHHHHHcCCCCC-CCCC-CCCCCCCC
Confidence                112233456788999999999999999999999764 4676 79999876
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure