Citrus Sinensis ID: 016477

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MTRRCSHCSNNGHNSRTCPTRGGGSSPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHYHSSSSAAASPNPDSPLSDHVRDPNHLTDGYLSDDPAHGSGSSNRRCERKKVPCLLARRACAGASLPLAFTFCLHMDVNKRQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPSPLARESDNTSSQPSLNLSLSTEFEPMEAVCKETEKDSEEPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHPILKPIPILPKEPVNVDQLVCMSQLSIGETERGLREPSPLSLKLLGEPSRQSAFHANAPVSRSDLSKGKTTPIQAV
cccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccEEEEEEEEEcccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHHHHHHHHHHccccccccccccEEcccHHHHHHHHHHHHHHHcccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEc
mtrrcshcsnnghnsrtcptrgggsspgvgglKLFGvrltdgsiikksasmgnlsalhyhssssaaaspnpdsplsdhvrdpnhltdgylsddpahgsgssnrrcerkkvpcllarracagaslpLAFTFCLHMdvnkrqigvpwteEEHRLFLIGLqklgkgdwrgiarnyvmsrtptqvASHAQKYFIRQSNATRRKRRSSLFDMvaddmatdtppvpeeqvmlpsplaresdntssqpslnlslstefepmEAVCKEtekdseepvidlneftpmvssffpaympvpytywphnaatgeedkdagtsgnhpilkpipilpkepvnvdQLVCMSqlsigeterglrepsplslkllgepsrqsafhanapvsrsdlskgkttpiqav
mtrrcshcsnnghnsrtcptrgggssPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHYHSSSSAAASPNPDSPLSDHVRDPNHLTDgylsddpahgsgssnrrceRKKVPCLLARRACAGASLPLAFTFCLHMDVNKRQIGVPWTEEEHRLFLIglqklgkgdWRGIARNYVMSRTPTQVASHAQkyfirqsnatrrkrRSSLFDMVADDMATDTPPVPEEQVMLPSPLaresdntssqpslnlslsteFEPMEAVCKEtekdseepviDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHPILKPIPILPKEPVNVDQLVCMSQLSigeterglrepSPLSLKLLGEPSRQSafhanapvsrsdlskgkttpiqav
MTRRCSHCSNNGHNSRTCPTRgggsspgvggLKLFGVRLTDGSIIKKSASMGnlsalhyhssssaaaspnpdsplsdHVRDPNHLTDGYLSDDPAHGSGSSNRRCERKKVPCLLARRACAGASLPLAFTFCLHMDVNKRQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPSPLARESDNTSSQPSLNLSLSTEFEPMEAVCKETEKDSEEPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHpilkpipilpkEPVNVDQLVCMSQLSIGETERGLREPSPLSLKLLGEPSRQSAFHANAPVSRSDLSKGKTTPIQAV
*****************************GGLKLFGVRLTDGSII***************************************************************KVPCLLARRACAGASLPLAFTFCLHMDVNKRQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFI******************************************************************************VIDLNEFTPMVSSFFPAYMPVPYTYWPHNA****************ILKPIPILPKEPVNVDQLVCMSQL***************************************************
*TRRCSHCSNNGHNSRTC**********VGGLKLFGVRLTDG********************************************************************************************************EEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKY*********************************************************************************************************************************************************************************************************
**************SRTCPTRGGGSSPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHY*****************DHVRDPNHLTDGYLSDD*************RKKVPCLLARRACAGASLPLAFTFCLHMDVNKRQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPS***************NLSLSTEFEPM************EPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATG********SGNHPILKPIPILPKEPVNVDQLVCMSQLSIG*********SPLSLKLLGEPSRQSA***********************
*****************************GGLKLFGVRLTDGSIIKKS********************************************************************************************IGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSN**********************************************************************SEEPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAA***********GNHPILKPIPILPKEPVNVDQLVCM******************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRRCSHCSNNGHNSRTCPTRGGGSSPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHYHSSSSAAASPNPDSPLSDHVRDPNHLTDGYLSDDPAHGSGSSNRRCERKKVPCLLARRACAGASLPLAFTFCLHMDVNKRQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPSPLARESDNTSSQPSLNLSLSTEFEPMEAVCKETEKDSEEPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHPILKPIPILPKEPVNVDQLVCMSQLSIGETERGLREPSPLSLKLLGEPSRQSAFHANAPVSRSDLSKGKTTPIQAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query389 2.2.26 [Sep-21-2011]
Q8S9H7307 Transcription factor DIVA N/A no 0.221 0.280 0.581 8e-26
Q2V9B0297 Transcription factor MYB1 N/A no 0.213 0.279 0.666 3e-22
Q869R9 734 Myb-like protein J OS=Dic yes no 0.174 0.092 0.507 1e-13
Q54HX6 977 Myb-like protein I OS=Dic no no 0.146 0.058 0.482 5e-07
Q6R0H0287 Transcription factor ASG4 no no 0.131 0.177 0.481 3e-05
Q54IF9 423 Myb-like protein G OS=Dic no no 0.143 0.132 0.454 3e-05
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.143 0.046 0.406 0.0001
P92973 608 Protein CCA1 OS=Arabidops no no 0.115 0.074 0.425 0.0007
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function desciption
 Score =  118 bits (296), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 70/86 (81%)

Query: 138 KRQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATR 197
           +R+ GVPWTEEEH+LFL+GL+K GKGDWR I+RN+V++RTPTQVASHAQKYFIRQ +  +
Sbjct: 127 ERKKGVPWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKYFIRQLSGGK 186

Query: 198 RKRRSSLFDMVADDMATDTPPVPEEQ 223
            KRR+S+ D+   +++ +  P P+ +
Sbjct: 187 DKRRASIHDITTVNLSDNQTPSPDNK 212
Involved in the dorsovental asymmetry of flowers. Promotes ventral identity.
Antirrhinum majus (taxid: 4151)
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function description
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query389
255549830381 DNA binding protein, putative [Ricinus c 0.897 0.916 0.622 1e-125
224070973377 predicted protein [Populus trichocarpa] 0.910 0.938 0.621 1e-124
171452360382 myb transcription factor [Bruguiera gymn 0.897 0.913 0.597 1e-122
351720685360 MYB transcription factor MYB52 [Glycine 0.899 0.972 0.586 1e-117
149727987353 MYB transcription factor MYB52 [Medicago 0.892 0.983 0.597 1e-116
357454797353 hypothetical protein MTR_2g100930 [Medic 0.892 0.983 0.594 1e-115
118488820369 unknown [Populus trichocarpa x Populus d 0.884 0.932 0.615 1e-114
449447817346 PREDICTED: uncharacterized protein LOC10 0.889 1.0 0.619 1e-114
225442479358 PREDICTED: uncharacterized protein LOC10 0.910 0.988 0.641 1e-113
351722226359 MYB transcription factor MYB62 [Glycine 0.876 0.949 0.585 1e-111
>gi|255549830|ref|XP_002515966.1| DNA binding protein, putative [Ricinus communis] gi|223544871|gb|EEF46386.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 262/421 (62%), Positives = 286/421 (67%), Gaps = 72/421 (17%)

Query: 1   MTRRCSHCSNNGHNSRTCPTRGG------------GSSPGVGGLKLFGVRLTDGSIIKKS 48
           MTRRCSHCSNNGHNSRTCPTR               S+  + G++LFGVRLTDGSIIKKS
Sbjct: 1   MTRRCSHCSNNGHNSRTCPTRSSTCSSAAGSGSASSSASSIAGVRLFGVRLTDGSIIKKS 60

Query: 49  ASMGNLSALHYHSSSSAAASPNPDSPLSDHVRDPNHLTDGYLSDDPAHGSGSSNRRCERK 108
           ASMGNLSA HYHSS  AAASPNPDSPLSDHVRD   + DGYLSDDPAH S S+NRR ERK
Sbjct: 61  ASMGNLSA-HYHSS--AAASPNPDSPLSDHVRD--SVQDGYLSDDPAHASCSTNRRGERK 115

Query: 109 KVPCLLARRACAGASLPLAFTFCLHMDVNKRQIGVPWTEEEHRLFLIGLQKLGKGDWRGI 168
           K                                GVPWTEEEHRLFLIGLQKLGKGDWRGI
Sbjct: 116 K--------------------------------GVPWTEEEHRLFLIGLQKLGKGDWRGI 143

Query: 169 ARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPS 228
           ARNYV+SRTPTQVASHAQKYFIRQ+NATRRKRRSSLFDMV  DMAT+   VPEE   LPS
Sbjct: 144 ARNYVVSRTPTQVASHAQKYFIRQTNATRRKRRSSLFDMVP-DMATEPQSVPEEH-ELPS 201

Query: 229 PLARESDNTSSQPSLNLSLSTEFEPMEAV-----------------CKETEKDSEE---P 268
               ++DN  + PSLNLS   E EPME                    K+TE    E    
Sbjct: 202 GQLGDTDNADALPSLNLSFKPECEPMETASEEPAEEPEEMLTGSSELKQTEHRLSEFAPA 261

Query: 269 VIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHPILKPIPILPKEPVN 328
           V  L+EFTP +S F+PAYMP+PY +W  N A  EE     TS NH +LKP+PI PKEPVN
Sbjct: 262 VPQLSEFTPFISGFYPAYMPIPYPFWSTNTAIPEEANTVETS-NHQVLKPVPIFPKEPVN 320

Query: 329 VDQLVCMSQLSIGETERGLREPSPLSLKLLGEPSRQSAFHANAPVSRSDLSKGKTTPIQA 388
           VD+LV MS LSIGE ER  RE S LSLKL+GEPSRQSAFHANA VS SDLS+GK +PIQA
Sbjct: 321 VDELVGMSHLSIGEMERDHRELSRLSLKLIGEPSRQSAFHANASVSGSDLSQGKGSPIQA 380

Query: 389 V 389
           V
Sbjct: 381 V 381

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224070973|ref|XP_002303311.1| predicted protein [Populus trichocarpa] gi|222840743|gb|EEE78290.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|171452360|dbj|BAG15871.1| myb transcription factor [Bruguiera gymnorhiza] Back     alignment and taxonomy information
>gi|351720685|ref|NP_001235649.1| MYB transcription factor MYB52 [Glycine max] gi|110931652|gb|ABH02825.1| MYB transcription factor MYB52 [Glycine max] Back     alignment and taxonomy information
>gi|149727987|gb|ABR28340.1| MYB transcription factor MYB52 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357454797|ref|XP_003597679.1| hypothetical protein MTR_2g100930 [Medicago truncatula] gi|355486727|gb|AES67930.1| hypothetical protein MTR_2g100930 [Medicago truncatula] Back     alignment and taxonomy information
>gi|118488820|gb|ABK96220.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|449447817|ref|XP_004141664.1| PREDICTED: uncharacterized protein LOC101214316 [Cucumis sativus] gi|449480623|ref|XP_004155948.1| PREDICTED: uncharacterized protein LOC101229963 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225442479|ref|XP_002283785.1| PREDICTED: uncharacterized protein LOC100241227 [Vitis vinifera] gi|297743200|emb|CBI36067.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351722226|ref|NP_001235701.1| MYB transcription factor MYB62 [Glycine max] gi|110931662|gb|ABH02830.1| MYB transcription factor MYB62 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query389
TAIR|locus:2094942387 AT3G16350 [Arabidopsis thalian 0.637 0.640 0.546 1.5e-77
TAIR|locus:2171519365 AT5G47390 [Arabidopsis thalian 0.334 0.356 0.544 1.6e-49
TAIR|locus:2020653261 AT1G70000 [Arabidopsis thalian 0.239 0.356 0.610 4e-39
TAIR|locus:2151621317 AT5G61620 [Arabidopsis thalian 0.298 0.365 0.476 1.9e-35
TAIR|locus:2165106233 AT5G56840 [Arabidopsis thalian 0.182 0.304 0.708 1.6e-32
TAIR|locus:2027181265 AT1G74840 [Arabidopsis thalian 0.383 0.562 0.438 1.9e-28
TAIR|locus:2011216285 AT1G19000 [Arabidopsis thalian 0.259 0.354 0.563 2.2e-27
TAIR|locus:2028461314 AT1G49010 [Arabidopsis thalian 0.264 0.328 0.537 7.4e-27
UNIPROTKB|Q8S9H7307 DIVARICATA "Transcription fact 0.262 0.332 0.514 2.2e-25
TAIR|locus:2042872298 AT2G38090 [Arabidopsis thalian 0.205 0.268 0.654 2e-24
TAIR|locus:2094942 AT3G16350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 617 (222.3 bits), Expect = 1.5e-77, Sum P(2) = 1.5e-77
 Identities = 142/260 (54%), Positives = 172/260 (66%)

Query:   138 KRQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATR 197
             +R+ GVPWTEEEHRLFL+GLQKLGKGDWRGI+RNYV SRTPTQVASHAQKYFIR ++++R
Sbjct:   132 ERKRGVPWTEEEHRLFLVGLQKLGKGDWRGISRNYVTSRTPTQVASHAQKYFIRHTSSSR 191

Query:   198 RKRRSSLFDMVADDMATDTPPVPEEQVMLPSPLARESDNTSSQPSLNLSLS--TEFEPME 255
             RKRRSSLFDMV D+M TD+ P  EEQ +  S  ++E +  S  PSL LSL+  TE E + 
Sbjct:   192 RKRRSSLFDMVTDEMVTDSSPTQEEQTLNGSSPSKEPEKKSYLPSLELSLNNTTEAEEVV 251

Query:   256 AVCKETEKDSEEPVIDLNEFTPMV--SSFFPAYMPVPYTYW-PHNAATGEEDKDAGTSGN 312
             A     EK S+E +   N  +PM+    FFP   PV YT W P +    E   +A TS  
Sbjct:   252 ATAPRQEK-SQEAIEPSNGVSPMLVPGGFFPPCFPVTYTIWLPASLHGTEHALNAETSSQ 310

Query:   313 -HXXXXXXXXXXXEPVNVDQLVCMSQLSIGETERGLRE--PSPLSLKLLGEPSRQSAFHA 369
              H           E VN+D+LV MSQLSIG   R   E  PSPLSL+L  EPSR SAFH+
Sbjct:   311 QHQVLKPKPGFAKERVNMDELVGMSQLSIGMATRHETETSPSPLSLRL--EPSRPSAFHS 368

Query:   370 NAPVSRSDLSKGKTTPIQAV 389
             N  V+ +DLSKG +  IQA+
Sbjct:   369 NGSVNGADLSKGNSA-IQAI 387
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2171519 AT5G47390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020653 AT1G70000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151621 AT5G61620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165106 AT5G56840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027181 AT1G74840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011216 AT1G19000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query389
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 6e-17
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 9e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 6e-09
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 5e-05
COG5114 432 COG5114, COG5114, Histone acetyltransferase comple 3e-04
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 74.0 bits (182), Expect = 6e-17
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 142 GVPWTEEEHRLFLIGLQKLGKGDW---RGIARNYVMSR-TPTQVASHAQKYFIRQ 192
            V WTE+ H  FL  +QKLG  DW   + I    V+   T  QVASH QKY ++Q
Sbjct: 3   RVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|227445 COG5114, COG5114, Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 389
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.73
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.38
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.03
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.02
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.55
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.52
KOG0724335 consensus Zuotin and related molecular chaperones 98.27
KOG4329445 consensus DNA-binding protein [General function pr 98.19
PLN03212249 Transcription repressor MYB5; Provisional 98.09
PLN03091 459 hypothetical protein; Provisional 97.91
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 97.85
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.85
KOG1279506 consensus Chromatin remodeling factor subunit and 97.8
PLN03212249 Transcription repressor MYB5; Provisional 97.54
PLN03091 459 hypothetical protein; Provisional 97.38
KOG0048238 consensus Transcription factor, Myb superfamily [T 96.83
PLN03162526 golden-2 like transcription factor; Provisional 96.68
KOG0049 939 consensus Transcription factor, Myb superfamily [T 96.12
KOG4167907 consensus Predicted DNA-binding protein, contains 95.94
KOG0048238 consensus Transcription factor, Myb superfamily [T 95.66
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 95.36
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 94.99
KOG0049 939 consensus Transcription factor, Myb superfamily [T 94.9
KOG0724335 consensus Zuotin and related molecular chaperones 94.64
KOG4468 782 consensus Polycomb-group transcriptional regulator 94.55
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 93.92
PLN031421033 Probable chromatin-remodeling complex ATPase chain 93.92
KOG3841 455 consensus TEF-1 and related transcription factor, 93.78
smart0042668 TEA TEA domain. 93.5
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 92.41
PF1528840 zf-CCHC_6: Zinc knuckle 91.49
PF1439249 zf-CCHC_4: Zinc knuckle 91.29
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 89.49
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 88.98
KOG1194 534 consensus Predicted DNA-binding protein, contains 88.9
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 87.57
KOG0051607 consensus RNA polymerase I termination factor, Myb 81.09
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.73  E-value=4.1e-18  Score=130.12  Aligned_cols=51  Identities=49%  Similarity=0.722  Sum_probs=47.5

Q ss_pred             CCCCCHHHHHHHHHHHHHcCCCCH---HHHHhhhcCCC-CHHHHHHHHHHHHHHH
Q 016477          142 GVPWTEEEHRLFLIGLQKLGKGDW---RGIARNYVMSR-TPTQVASHAQKYFIRQ  192 (389)
Q Consensus       142 ~~~WTeEEH~lFLeGLekyGkGdW---k~IAr~fV~TR-Tp~QVrSHAQKYF~rl  192 (389)
                      +..||+|||++||+||+.||.|+|   +.|++.++.|| |+.||+||+||||+++
T Consensus         3 r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k~   57 (57)
T TIGR01557         3 RVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ   57 (57)
T ss_pred             CCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHccC
Confidence            678999999999999999999999   99997777789 9999999999999864

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query389
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 4e-23
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 1e-18
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-15
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 4e-15
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 6e-13
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 2e-09
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 2e-09
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 4e-08
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 4e-08
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 1e-07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 7e-07
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 2e-05
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 2e-05
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 2e-05
2crg_A70 Metastasis associated protein MTA3; transcription 5e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 6e-05
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 8e-05
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 2e-04
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 3e-04
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 7e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 91.0 bits (226), Expect = 4e-23
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 139 RQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRR 198
               V WT EE  LF  GL K G+  W  I++  + SRT  QV S+A++YF  +      
Sbjct: 6   SGYSVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKVKCGLD 63

Query: 199 KRRSS 203
           K   +
Sbjct: 64  KETPN 68
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query389
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.56
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.46
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.41
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.36
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.35
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.33
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.26
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.22
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.19
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.18
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.15
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.11
2crg_A70 Metastasis associated protein MTA3; transcription 99.11
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.09
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 98.98
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.97
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.95
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.92
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.43
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.9
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.89
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.87
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.8
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.78
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.78
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.78
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.75
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.74
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.73
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.72
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.66
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.66
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.65
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.64
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.64
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.62
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.57
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.52
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.48
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.46
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.45
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.42
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.3
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.02
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.54
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.45
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.24
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.15
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.18
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 95.89
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.49
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.45
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 95.42
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 94.92
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 93.99
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 92.48
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 92.31
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 92.14
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 91.99
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 86.82
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 86.64
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 84.9
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 84.38
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 83.69
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.56  E-value=8.6e-15  Score=112.94  Aligned_cols=63  Identities=37%  Similarity=0.546  Sum_probs=58.4

Q ss_pred             CCCCCHHHHHHHHHHHHHcCCCCHHHHHhhhcCCCCHHHHHHHHHHHHHHHhhhccccCCCCccc
Q 016477          142 GVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFD  206 (389)
Q Consensus       142 ~~~WTeEEH~lFLeGLekyGkGdWk~IAr~fV~TRTp~QVrSHAQKYF~rl~~~~krKrRsSL~D  206 (389)
                      ..+||+||+++|++++++||. +|..|| .+|++||..||+.|+++||.+..+.+..+++.+||+
T Consensus         9 ~~~WT~eEd~~l~~~~~~~G~-~W~~Ia-~~~~~Rt~~q~k~r~~~~l~~~~~~g~~~~~~si~s   71 (72)
T 2cu7_A            9 SVKWTIEEKELFEQGLAKFGR-RWTKIS-KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKT   71 (72)
T ss_dssp             CCCCCHHHHHHHHHHHHHTCS-CHHHHH-HHHSSSCHHHHHHHHHHHHHHHSCSCTTCCCSCCCC
T ss_pred             CCCCCHHHHHHHHHHHHHHCc-CHHHHH-HHcCCCCHHHHHHHHHHHHHHHHhcCCCCCcccccc
Confidence            569999999999999999999 999999 699999999999999999999887777788888875
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 389
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 5e-17
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 4e-15
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 6e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 2e-08
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-08
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 3e-07
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-06
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-06
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 6e-05
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-04
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 0.001
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Metastasis associated protein MTA3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 72.5 bits (178), Expect = 5e-17
 Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 145 WTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRR 201
           W+  E  LF   L+K GK D+  I ++++  ++ T +  +   Y  + ++   +++R
Sbjct: 4   WSASEACLFEEALEKYGK-DFNDIRQDFLPWKSLTSIIEYY--YMWKTTDRYVQQKR 57
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query389
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.58
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.5
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.45
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.31
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.21
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.16
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.13
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.12
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.07
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.04
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.9
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.9
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.85
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.53
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.34
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.33
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.88
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 97.84
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.11
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 90.45
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 85.62
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 84.38
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 82.97
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.58  E-value=1.1e-15  Score=116.88  Aligned_cols=55  Identities=33%  Similarity=0.384  Sum_probs=46.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHcCCCCH--HHHHhhh-cCCCCHHHHHHHHHHHHHHHhh
Q 016477          140 QIGVPWTEEEHRLFLIGLQKLGKGDW--RGIARNY-VMSRTPTQVASHAQKYFIRQSN  194 (389)
Q Consensus       140 ~~~~~WTeEEH~lFLeGLekyGkGdW--k~IAr~f-V~TRTp~QVrSHAQKYF~rl~~  194 (389)
                      +.+..||+|||++|++||+.||.++|  +.|.+.+ |.++|..||+||+||||+++.+
T Consensus         5 k~R~~WT~elH~~Fv~Av~~lG~~~atpk~I~~~m~v~~lT~~qV~SHlQKYrl~l~k   62 (64)
T d1irza_           5 KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKK   62 (64)
T ss_dssp             CSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHHHHHHHHHS
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCccccchHHHHHHcCCCCCCHHHHHHHHHHHHHHHHh
Confidence            34779999999999999999998444  6786433 8889999999999999999865
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure