Citrus Sinensis ID: 016477
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 389 | ||||||
| 255549830 | 381 | DNA binding protein, putative [Ricinus c | 0.897 | 0.916 | 0.622 | 1e-125 | |
| 224070973 | 377 | predicted protein [Populus trichocarpa] | 0.910 | 0.938 | 0.621 | 1e-124 | |
| 171452360 | 382 | myb transcription factor [Bruguiera gymn | 0.897 | 0.913 | 0.597 | 1e-122 | |
| 351720685 | 360 | MYB transcription factor MYB52 [Glycine | 0.899 | 0.972 | 0.586 | 1e-117 | |
| 149727987 | 353 | MYB transcription factor MYB52 [Medicago | 0.892 | 0.983 | 0.597 | 1e-116 | |
| 357454797 | 353 | hypothetical protein MTR_2g100930 [Medic | 0.892 | 0.983 | 0.594 | 1e-115 | |
| 118488820 | 369 | unknown [Populus trichocarpa x Populus d | 0.884 | 0.932 | 0.615 | 1e-114 | |
| 449447817 | 346 | PREDICTED: uncharacterized protein LOC10 | 0.889 | 1.0 | 0.619 | 1e-114 | |
| 225442479 | 358 | PREDICTED: uncharacterized protein LOC10 | 0.910 | 0.988 | 0.641 | 1e-113 | |
| 351722226 | 359 | MYB transcription factor MYB62 [Glycine | 0.876 | 0.949 | 0.585 | 1e-111 |
| >gi|255549830|ref|XP_002515966.1| DNA binding protein, putative [Ricinus communis] gi|223544871|gb|EEF46386.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 454 bits (1168), Expect = e-125, Method: Compositional matrix adjust.
Identities = 262/421 (62%), Positives = 286/421 (67%), Gaps = 72/421 (17%)
Query: 1 MTRRCSHCSNNGHNSRTCPTRGG------------GSSPGVGGLKLFGVRLTDGSIIKKS 48
MTRRCSHCSNNGHNSRTCPTR S+ + G++LFGVRLTDGSIIKKS
Sbjct: 1 MTRRCSHCSNNGHNSRTCPTRSSTCSSAAGSGSASSSASSIAGVRLFGVRLTDGSIIKKS 60
Query: 49 ASMGNLSALHYHSSSSAAASPNPDSPLSDHVRDPNHLTDGYLSDDPAHGSGSSNRRCERK 108
ASMGNLSA HYHSS AAASPNPDSPLSDHVRD + DGYLSDDPAH S S+NRR ERK
Sbjct: 61 ASMGNLSA-HYHSS--AAASPNPDSPLSDHVRD--SVQDGYLSDDPAHASCSTNRRGERK 115
Query: 109 KVPCLLARRACAGASLPLAFTFCLHMDVNKRQIGVPWTEEEHRLFLIGLQKLGKGDWRGI 168
K GVPWTEEEHRLFLIGLQKLGKGDWRGI
Sbjct: 116 K--------------------------------GVPWTEEEHRLFLIGLQKLGKGDWRGI 143
Query: 169 ARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPS 228
ARNYV+SRTPTQVASHAQKYFIRQ+NATRRKRRSSLFDMV DMAT+ VPEE LPS
Sbjct: 144 ARNYVVSRTPTQVASHAQKYFIRQTNATRRKRRSSLFDMVP-DMATEPQSVPEEH-ELPS 201
Query: 229 PLARESDNTSSQPSLNLSLSTEFEPMEAV-----------------CKETEKDSEE---P 268
++DN + PSLNLS E EPME K+TE E
Sbjct: 202 GQLGDTDNADALPSLNLSFKPECEPMETASEEPAEEPEEMLTGSSELKQTEHRLSEFAPA 261
Query: 269 VIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHPILKPIPILPKEPVN 328
V L+EFTP +S F+PAYMP+PY +W N A EE TS NH +LKP+PI PKEPVN
Sbjct: 262 VPQLSEFTPFISGFYPAYMPIPYPFWSTNTAIPEEANTVETS-NHQVLKPVPIFPKEPVN 320
Query: 329 VDQLVCMSQLSIGETERGLREPSPLSLKLLGEPSRQSAFHANAPVSRSDLSKGKTTPIQA 388
VD+LV MS LSIGE ER RE S LSLKL+GEPSRQSAFHANA VS SDLS+GK +PIQA
Sbjct: 321 VDELVGMSHLSIGEMERDHRELSRLSLKLIGEPSRQSAFHANASVSGSDLSQGKGSPIQA 380
Query: 389 V 389
V
Sbjct: 381 V 381
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224070973|ref|XP_002303311.1| predicted protein [Populus trichocarpa] gi|222840743|gb|EEE78290.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|171452360|dbj|BAG15871.1| myb transcription factor [Bruguiera gymnorhiza] | Back alignment and taxonomy information |
|---|
| >gi|351720685|ref|NP_001235649.1| MYB transcription factor MYB52 [Glycine max] gi|110931652|gb|ABH02825.1| MYB transcription factor MYB52 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|149727987|gb|ABR28340.1| MYB transcription factor MYB52 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357454797|ref|XP_003597679.1| hypothetical protein MTR_2g100930 [Medicago truncatula] gi|355486727|gb|AES67930.1| hypothetical protein MTR_2g100930 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|118488820|gb|ABK96220.1| unknown [Populus trichocarpa x Populus deltoides] | Back alignment and taxonomy information |
|---|
| >gi|449447817|ref|XP_004141664.1| PREDICTED: uncharacterized protein LOC101214316 [Cucumis sativus] gi|449480623|ref|XP_004155948.1| PREDICTED: uncharacterized protein LOC101229963 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225442479|ref|XP_002283785.1| PREDICTED: uncharacterized protein LOC100241227 [Vitis vinifera] gi|297743200|emb|CBI36067.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351722226|ref|NP_001235701.1| MYB transcription factor MYB62 [Glycine max] gi|110931662|gb|ABH02830.1| MYB transcription factor MYB62 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 389 | ||||||
| TAIR|locus:2094942 | 387 | AT3G16350 [Arabidopsis thalian | 0.637 | 0.640 | 0.546 | 1.5e-77 | |
| TAIR|locus:2171519 | 365 | AT5G47390 [Arabidopsis thalian | 0.334 | 0.356 | 0.544 | 1.6e-49 | |
| TAIR|locus:2020653 | 261 | AT1G70000 [Arabidopsis thalian | 0.239 | 0.356 | 0.610 | 4e-39 | |
| TAIR|locus:2151621 | 317 | AT5G61620 [Arabidopsis thalian | 0.298 | 0.365 | 0.476 | 1.9e-35 | |
| TAIR|locus:2165106 | 233 | AT5G56840 [Arabidopsis thalian | 0.182 | 0.304 | 0.708 | 1.6e-32 | |
| TAIR|locus:2027181 | 265 | AT1G74840 [Arabidopsis thalian | 0.383 | 0.562 | 0.438 | 1.9e-28 | |
| TAIR|locus:2011216 | 285 | AT1G19000 [Arabidopsis thalian | 0.259 | 0.354 | 0.563 | 2.2e-27 | |
| TAIR|locus:2028461 | 314 | AT1G49010 [Arabidopsis thalian | 0.264 | 0.328 | 0.537 | 7.4e-27 | |
| UNIPROTKB|Q8S9H7 | 307 | DIVARICATA "Transcription fact | 0.262 | 0.332 | 0.514 | 2.2e-25 | |
| TAIR|locus:2042872 | 298 | AT2G38090 [Arabidopsis thalian | 0.205 | 0.268 | 0.654 | 2e-24 |
| TAIR|locus:2094942 AT3G16350 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 617 (222.3 bits), Expect = 1.5e-77, Sum P(2) = 1.5e-77
Identities = 142/260 (54%), Positives = 172/260 (66%)
Query: 138 KRQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATR 197
+R+ GVPWTEEEHRLFL+GLQKLGKGDWRGI+RNYV SRTPTQVASHAQKYFIR ++++R
Sbjct: 132 ERKRGVPWTEEEHRLFLVGLQKLGKGDWRGISRNYVTSRTPTQVASHAQKYFIRHTSSSR 191
Query: 198 RKRRSSLFDMVADDMATDTPPVPEEQVMLPSPLARESDNTSSQPSLNLSLS--TEFEPME 255
RKRRSSLFDMV D+M TD+ P EEQ + S ++E + S PSL LSL+ TE E +
Sbjct: 192 RKRRSSLFDMVTDEMVTDSSPTQEEQTLNGSSPSKEPEKKSYLPSLELSLNNTTEAEEVV 251
Query: 256 AVCKETEKDSEEPVIDLNEFTPMV--SSFFPAYMPVPYTYW-PHNAATGEEDKDAGTSGN 312
A EK S+E + N +PM+ FFP PV YT W P + E +A TS
Sbjct: 252 ATAPRQEK-SQEAIEPSNGVSPMLVPGGFFPPCFPVTYTIWLPASLHGTEHALNAETSSQ 310
Query: 313 -HXXXXXXXXXXXEPVNVDQLVCMSQLSIGETERGLRE--PSPLSLKLLGEPSRQSAFHA 369
H E VN+D+LV MSQLSIG R E PSPLSL+L EPSR SAFH+
Sbjct: 311 QHQVLKPKPGFAKERVNMDELVGMSQLSIGMATRHETETSPSPLSLRL--EPSRPSAFHS 368
Query: 370 NAPVSRSDLSKGKTTPIQAV 389
N V+ +DLSKG + IQA+
Sbjct: 369 NGSVNGADLSKGNSA-IQAI 387
|
|
| TAIR|locus:2171519 AT5G47390 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020653 AT1G70000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151621 AT5G61620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2165106 AT5G56840 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2027181 AT1G74840 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2011216 AT1G19000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 389 | |||
| TIGR01557 | 57 | TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai | 6e-17 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 9e-10 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 4e-09 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 6e-09 | |
| cd11660 | 50 | cd11660, SANT_TRF, Telomere repeat binding factor- | 5e-05 | |
| COG5114 | 432 | COG5114, COG5114, Histone acetyltransferase comple | 3e-04 |
| >gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Score = 74.0 bits (182), Expect = 6e-17
Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
Query: 142 GVPWTEEEHRLFLIGLQKLGKGDW---RGIARNYVMSR-TPTQVASHAQKYFIRQ 192
V WTE+ H FL +QKLG DW + I V+ T QVASH QKY ++Q
Sbjct: 3 RVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57 |
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family | Back alignment and domain information |
|---|
| >gnl|CDD|227445 COG5114, COG5114, Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 389 | |||
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 99.73 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.38 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.03 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.02 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 98.55 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 98.52 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 98.27 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 98.19 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.09 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 97.91 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 97.85 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.85 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 97.8 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 97.54 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 97.38 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 96.83 | |
| PLN03162 | 526 | golden-2 like transcription factor; Provisional | 96.68 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 96.12 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 95.94 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 95.66 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 95.36 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 94.99 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 94.9 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 94.64 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 94.55 | |
| PF00098 | 18 | zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi | 93.92 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 93.92 | |
| KOG3841 | 455 | consensus TEF-1 and related transcription factor, | 93.78 | |
| smart00426 | 68 | TEA TEA domain. | 93.5 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 92.41 | |
| PF15288 | 40 | zf-CCHC_6: Zinc knuckle | 91.49 | |
| PF14392 | 49 | zf-CCHC_4: Zinc knuckle | 91.29 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 89.49 | |
| PF01285 | 431 | TEA: TEA/ATTS domain family; InterPro: IPR000818 T | 88.98 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 88.9 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 87.57 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 81.09 |
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Probab=99.73 E-value=4.1e-18 Score=130.12 Aligned_cols=51 Identities=49% Similarity=0.722 Sum_probs=47.5
Q ss_pred CCCCCHHHHHHHHHHHHHcCCCCH---HHHHhhhcCCC-CHHHHHHHHHHHHHHH
Q 016477 142 GVPWTEEEHRLFLIGLQKLGKGDW---RGIARNYVMSR-TPTQVASHAQKYFIRQ 192 (389)
Q Consensus 142 ~~~WTeEEH~lFLeGLekyGkGdW---k~IAr~fV~TR-Tp~QVrSHAQKYF~rl 192 (389)
+..||+|||++||+||+.||.|+| +.|++.++.|| |+.||+||+||||+++
T Consensus 3 r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k~ 57 (57)
T TIGR01557 3 RVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57 (57)
T ss_pred CCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHccC
Confidence 678999999999999999999999 99997777789 9999999999999864
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. |
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03162 golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] | Back alignment and domain information |
|---|
| >smart00426 TEA TEA domain | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >PF15288 zf-CCHC_6: Zinc knuckle | Back alignment and domain information |
|---|
| >PF14392 zf-CCHC_4: Zinc knuckle | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 389 | |||
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 4e-23 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 1e-18 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 2e-15 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 4e-15 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 6e-13 | |
| 1vf9_A | 64 | Telomeric repeat binding factor 2; MYB, helix-turn | 2e-09 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 2e-09 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 6e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 4e-08 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 4e-08 | |
| 1w0u_A | 55 | Telomeric repeat binding factor 2; telomere, DNA-b | 1e-07 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 7e-07 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 2e-05 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 2e-05 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 2e-05 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 5e-05 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 6e-05 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 8e-05 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 2e-04 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 3e-04 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 7e-04 |
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
Score = 91.0 bits (226), Expect = 4e-23
Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
Query: 139 RQIGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRR 198
V WT EE LF GL K G+ W I++ + SRT QV S+A++YF +
Sbjct: 6 SGYSVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKVKCGLD 63
Query: 199 KRRSS 203
K +
Sbjct: 64 KETPN 68
|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 389 | |||
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.56 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.46 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.41 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.36 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.35 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.33 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 99.26 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 99.22 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 99.19 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.18 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 99.15 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.11 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 99.11 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.09 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 98.98 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 98.97 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.95 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 98.92 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.43 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.9 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 98.89 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.87 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 98.8 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 98.78 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.78 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.78 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.75 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 98.74 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 98.73 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.72 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.66 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.66 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 98.65 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 98.64 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 98.64 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 98.62 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.57 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.52 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.48 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 98.46 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 98.45 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.42 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.3 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.02 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 97.54 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.45 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 97.24 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 97.15 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 96.18 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 95.89 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 95.49 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 95.45 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 95.42 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 94.92 | |
| 1dsq_A | 26 | Nucleic acid binding protein P14; CCHC type zinc f | 93.99 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 92.48 | |
| 2hzd_A | 82 | Transcriptional enhancer factor TEF-1; DNA-binding | 92.31 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 92.14 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 91.99 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 86.82 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 86.64 | |
| 1a6b_B | 40 | Momulv, zinc finger protein NCP10; nucleocapsid pr | 84.9 | |
| 1nc8_A | 29 | Nucleocapsid protein; HIV-2, RNA recognition, zinc | 84.38 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 83.69 |
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
Probab=99.56 E-value=8.6e-15 Score=112.94 Aligned_cols=63 Identities=37% Similarity=0.546 Sum_probs=58.4
Q ss_pred CCCCCHHHHHHHHHHHHHcCCCCHHHHHhhhcCCCCHHHHHHHHHHHHHHHhhhccccCCCCccc
Q 016477 142 GVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFD 206 (389)
Q Consensus 142 ~~~WTeEEH~lFLeGLekyGkGdWk~IAr~fV~TRTp~QVrSHAQKYF~rl~~~~krKrRsSL~D 206 (389)
..+||+||+++|++++++||. +|..|| .+|++||..||+.|+++||.+..+.+..+++.+||+
T Consensus 9 ~~~WT~eEd~~l~~~~~~~G~-~W~~Ia-~~~~~Rt~~q~k~r~~~~l~~~~~~g~~~~~~si~s 71 (72)
T 2cu7_A 9 SVKWTIEEKELFEQGLAKFGR-RWTKIS-KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKT 71 (72)
T ss_dssp CCCCCHHHHHHHHHHHHHTCS-CHHHHH-HHHSSSCHHHHHHHHHHHHHHHSCSCTTCCCSCCCC
T ss_pred CCCCCHHHHHHHHHHHHHHCc-CHHHHH-HHcCCCCHHHHHHHHHHHHHHHHhcCCCCCcccccc
Confidence 569999999999999999999 999999 699999999999999999999887777788888875
|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 389 | ||||
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 5e-17 | |
| d1irza_ | 64 | a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th | 4e-15 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 6e-10 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 3e-09 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 2e-08 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 3e-08 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 3e-07 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 1e-06 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 1e-06 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 6e-05 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 2e-04 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 0.001 |
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: Metastasis associated protein MTA3 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 72.5 bits (178), Expect = 5e-17
Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
Query: 145 WTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRR 201
W+ E LF L+K GK D+ I ++++ ++ T + + Y + ++ +++R
Sbjct: 4 WSASEACLFEEALEKYGK-DFNDIRQDFLPWKSLTSIIEYY--YMWKTTDRYVQQKR 57
|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 389 | |||
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 99.58 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.5 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.45 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 99.31 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.21 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.16 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.13 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.12 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.07 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.04 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 98.9 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 98.9 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.85 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.53 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 98.34 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.33 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 97.88 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 97.84 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 96.11 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 90.45 | |
| d1nc8a_ | 29 | HIV nucleocapsid {Human immunodeficiency virus typ | 85.62 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 84.38 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 82.97 |
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: GARP response regulators domain: Arr10-B species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.58 E-value=1.1e-15 Score=116.88 Aligned_cols=55 Identities=33% Similarity=0.384 Sum_probs=46.8
Q ss_pred CCCCCCCHHHHHHHHHHHHHcCCCCH--HHHHhhh-cCCCCHHHHHHHHHHHHHHHhh
Q 016477 140 QIGVPWTEEEHRLFLIGLQKLGKGDW--RGIARNY-VMSRTPTQVASHAQKYFIRQSN 194 (389)
Q Consensus 140 ~~~~~WTeEEH~lFLeGLekyGkGdW--k~IAr~f-V~TRTp~QVrSHAQKYF~rl~~ 194 (389)
+.+..||+|||++|++||+.||.++| +.|.+.+ |.++|..||+||+||||+++.+
T Consensus 5 k~R~~WT~elH~~Fv~Av~~lG~~~atpk~I~~~m~v~~lT~~qV~SHlQKYrl~l~k 62 (64)
T d1irza_ 5 KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKK 62 (64)
T ss_dssp CSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHHHHHHHHHS
T ss_pred CCCCCCCHHHHHHHHHHHHHhCccccchHHHHHHcCCCCCCHHHHHHHHHHHHHHHHh
Confidence 34779999999999999999998444 6786433 8889999999999999999865
|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|