Citrus Sinensis ID: 017922

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----

MTSNIMYAVDCEMVLCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVGVTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPRVIDTSLIFKYVDEYRRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVPLLQEDVAETERARLFLHRIPTKVPSEELHGVIPGDFTIEAKAVKRIRGDNYAAFAIFSSPQEANQAFENVKGNQSKDSYGRPQKLVEFQSNAGIIASLYVRKMVCDEPSNQIVVKKRTFEGEENAGVSKKHNIKWINEEEKIADTNQCKCEDHLKVIERLKRELREKDFQISMQDKNISDLKKKVAEMKDQKSRRR

cccccEEEEEccEEEEccccEEEEEEEEEEccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHccccccEEEcccccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHcHHHHHHHHHHHcccccccccHHHccccccccEEEEcccccccccccEEEEEcccHHHHHHHHHHHcccccccccccccEEEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

cccccEEEEEEEEEEcccccEEEEEEEEEEccccEEEEEEEcccccEEEEEEEEccccHHHHccccccHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHcccEEccEEEccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccHHHccHHHHHHHHHccccccccHHHHHHHccccccEEEccccccccccEEEEEEEccHHHHHHHHHHccccccccccccccEEEEEEcccccEEEEEEEEEEcccccccccccccccccHHccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc

MTSNIMYAVDCEMVLcedgseglVRLCVVDRNLKVTIDELVKPEKAVADYRSEitgltaddlvGVTCSLAEIQKRMKKLLSNGTILVGHSLnndlevlkldhprvidtSLIFKYvdeyrrpslYNLCKSVlgyeirkkgtphncldDASAAMKLVLAIIERRVDnavpllqeDVAETERARLFLhriptkvpseelhgvipgdfTIEAKAVKrirgdnyaafaifsspqEANQAFEnvkgnqskdsygrpqklveFQSNAGIIASLYVRKmvcdepsnqivvKKRTfegeenagvskkhnikWINEEEkiadtnqckceDHLKVIERLKRELREKDFQISMQDKNISDLKKKVAEMKDQKSRRR

MTSNIMYAVDCEMVLCEDGSEGLVRLCVVDRNLKvtidelvkpekavaDYRSeitgltaddlvGVTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPRVIDTSLIfkyvdeyrrpSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVPLLQEDVAETERARLFLhriptkvpseelhgvipgDFTIEAKAVKRIRGDNYAAFAIFSSPQEANQAFENVKGNQSKDSYGRPQKLVEFQSNAGIIASLYVRKMVCDEPSNQIVVkkrtfegeenagvskkhnikwINEEekiadtnqckceDHLKVIERLKRElrekdfqismqdknisdlkkkvaemkdqksrrr

****IMYAVDCEMVLCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVGVTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPRVIDTSLIFKYVDEYRRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVPLLQEDVAETERARLFLHRIPTKVPSEELHGVIPGDFTIEAKAVKRIRGDNYAAFAIFS**************************LVEFQSNAGIIASLYVRKMVCDEPSNQIVVKKRTFE******VSKKHNIKWINEEEKIADTNQCKCEDHLKVIERLK***********************************

**SNIMYAVDCEMVLCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVGVTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPRVIDTSLIFKYVDEYRRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVP*****************************GVIPGDFTIEAKAVKRIRGDNYAAFAIFSSPQEANQAFENVKGNQSKDSYGRPQKLVEFQSNAGIIASLYVRK*****************************************************VI***************M*DKNISD****************

***NIMYAVDCEMVLCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVGVTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPRVIDTSLIFKYVDEYRRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVPLLQEDVAETERARLFLHRIPTKVPSEELHGVIPGDFTIEAKAVKRIRGDNYAAFAIFSSPQEANQAFENVKGNQSKDSYGRPQKLVEFQSNAGIIASLYVRKMVCDE**************************************NQCKCEDHLKVIERLKRELREKDFQISMQDKNISDLKKKVAEM********

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		364	2.2.26 [Sep-21-2011]
A3KPE8		409	Small RNA degrading nucle	yes	no	0.75	0.667	0.584	5e-90
Q8RXK2		782	Small RNA degrading nucle	no	no	0.813	0.378	0.514	1e-81
Q9FFG1		466	Small RNA degrading nucle	no	no	0.826	0.645	0.504	3e-77
Q9SN09		322	Putative small RNA degrad	no	no	0.675	0.763	0.510	1e-63
O94443		631	Uncharacterized exonuclea	yes	no	0.409	0.236	0.414	4e-25
Q8L7M4		567	Small RNA degrading nucle	no	no	0.445	0.285	0.396	8e-23
Q8IX06		675	Exonuclease GOR OS=Homo s	yes	no	0.431	0.232	0.372	8e-23
P48778		690	Exonuclease GOR OS=Pan tr	no	no	0.428	0.226	0.375	1e-22
A0PJM3		583	Putative exonuclease GOR-	no	no	0.428	0.267	0.368	4e-22
P53331		553	RNA exonuclease 1 OS=Sacc	yes	no	0.403	0.265	0.388	1e-21

>sp\|A3KPE8\|SDN1_ARATH Small RNA degrading nuclease 1 OS=Arabidopsis thaliana GN=SDN1 PE=2 SV=1	Back alignment and function desciption

 Score =  331 bits (848), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 162/277 (58%), Positives = 212/277 (76%), Gaps = 4/277 (1%)

Query: 1   MTSNIMYAVDCEMVLCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTAD 60
           M S  M AVDCEMVLCEDG+EGLVR+ VVDR+LKV +DE VKP K V DYR++ITG+TA+
Sbjct: 135 MESTNMVAVDCEMVLCEDGTEGLVRVGVVDRDLKVILDEFVKPNKPVVDYRTDITGITAE 194

Query: 61  DLVGVTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPRVIDTSLIFKYVD--EY 118
           D+   + S+ +IQ+ ++  LS GTILVGHSLN DLEVLK+DHP+VIDT+L+FKY +  + 
Sbjct: 195 DIENASLSVVDIQETLQPFLSTGTILVGHSLNRDLEVLKIDHPKVIDTALVFKYPNTRKL 254

Query: 119 RRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVPLLQEDVAETE 178
           RRPSL NLCKS+LGYE+RK G PH+C+ DASAAMKL LA++E+RVD  +   +E + E E
Sbjct: 255 RRPSLNNLCKSILGYEVRKTGVPHDCVHDASAAMKLALAVVEKRVDTTIKPSKE-MLEVE 313

Query: 179 RARLFLHRIPTKVPSEELHGVIPGDFTIEAKAVKRIRGDNYAAFAIFSSPQEANQAFENV 238
           +A+LFLH+IP  VPSEEL  V+ G FT++ K  K  +G  Y AFA+F S ++A+QAFE++
Sbjct: 314 KAKLFLHKIPNNVPSEELEQVLSGKFTLDVKQAK-TQGRYYCAFALFHSSEDADQAFEHI 372

Query: 239 KGNQSKDSYGRPQKLVEFQSNAGIIASLYVRKMVCDE 275
            G +  DS G PQK+V  + ++G  AS+YVRKMV DE
Sbjct: 373 DGIEMTDSLGLPQKVVIIKLSSGSRASIYVRKMVQDE 409

3'-5' exonuclease degrading single-stranded small RNAs.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -

>sp\|Q8RXK2\|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1	Back alignment and function description

>sp\|Q9FFG1\|SDN2_ARATH Small RNA degrading nuclease 2 OS=Arabidopsis thaliana GN=SDN2 PE=2 SV=1	Back alignment and function description

>sp\|Q9SN09\|SDN4_ARATH Putative small RNA degrading nuclease 4 OS=Arabidopsis thaliana GN=SDN4 PE=3 SV=1	Back alignment and function description

>sp\|O94443\|YFE9_SCHPO Uncharacterized exonuclease C637.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC637.09 PE=3 SV=2	Back alignment and function description

>sp\|Q8L7M4\|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2	Back alignment and function description

>sp\|Q8IX06\|GOR_HUMAN Exonuclease GOR OS=Homo sapiens GN=REXO1L1 PE=2 SV=2	Back alignment and function description

>sp\|P48778\|GOR_PANTR Exonuclease GOR OS=Pan troglodytes GN=REXO1L1 PE=2 SV=3	Back alignment and function description

>sp\|A0PJM3\|GORL_HUMAN Putative exonuclease GOR-like protein OS=Homo sapiens GN=REXO1L2P PE=5 SV=2	Back alignment and function description

>sp\|P53331\|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		364
255567879		504	exonuclease, putative [Ricinus communis]	0.980	0.708	0.565	1e-104
449448294		524	PREDICTED: small RNA degrading nuclease	0.945	0.656	0.540	1e-102
356563578		509	PREDICTED: small RNA degrading nuclease	0.947	0.677	0.541	1e-101
388506214		525	unknown [Lotus japonicus]	0.928	0.643	0.543	1e-98
186510862		409	small RNA degrading nuclease 1 [Arabidop	0.75	0.667	0.584	3e-88
6522931		406	hypothetical protein [Arabidopsis thalia	0.741	0.665	0.581	2e-87
297816266		409	At3g50100 [Arabidopsis lyrata subsp. lyr	0.75	0.667	0.581	1e-86
297794263		776	exonuclease [Arabidopsis lyrata subsp. l	0.859	0.403	0.495	2e-82
79547863		782	small RNA degrading nuclease 3 [Arabidop	0.813	0.378	0.514	9e-80
10177611		782	unnamed protein product [Arabidopsis tha	0.813	0.378	0.501	2e-77

>gi\|255567879\|ref\|XP_002524917.1\| exonuclease, putative [Ricinus communis] gi\|223535752\|gb\|EEF37414.1\| exonuclease, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 208/368 (56%), Positives = 262/368 (71%), Gaps = 11/368 (2%)

Query: 1   MTSNIMYAVDCEMVLCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTAD 60
           M+++ + A+DCEMVLCEDG+E LVR+CVVDRNL+V +DE V P K VADYR+EITG+TA 
Sbjct: 139 MSTDSIIAIDCEMVLCEDGTEALVRVCVVDRNLQVKLDEKVNPYKPVADYRTEITGVTAR 198

Query: 61  DLVGVTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPRVIDTSLIFKYVDEYRR 120
           DL GV+CSLA+IQK MKKLL  GTILVGH L NDL+ LKLDH RV+DTS IF+ +D  R 
Sbjct: 199 DLDGVSCSLADIQKFMKKLLQKGTILVGHGLYNDLQALKLDHARVVDTSFIFRRLDG-RP 257

Query: 121 PSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVPLLQEDVAETERA 180
           PSL  LCKSVLG+E+RK G PHNC+DDASAAMKL LA IER VDN +P+  E V E E A
Sbjct: 258 PSLDTLCKSVLGFELRKGGAPHNCMDDASAAMKLFLAKIERGVDNDIPVNHEHVLENELA 317

Query: 181 RLFLHRIPTKVPSEELHGVIPGDFTIEAKAVKRIRGDNYAAFAIFSSPQEANQAFENVKG 240
           +L LH IPT V SEELH V P  FTIE K  K+ R   Y+A AIF  PQEA+ AF+N+ G
Sbjct: 318 KLLLHGIPTDVHSEELHRVFPEQFTIELKPPKKGRV-QYSALAIFKDPQEAHCAFDNLNG 376

Query: 241 NQSKDSYGRPQKLVEFQSNAGIIASLYVRKMVCDEPSNQIVVKKRTFEGEENAGVSKK-- 298
              KD  G  QK++  +   G  A+LYVRKM  D   +Q + KKR F+G E+ G +KK  
Sbjct: 377 RLEKDKNGLLQKMITLKLKTGATANLYVRKMGHDHFIHQDLQKKRAFQG-EDIGNTKKLK 435

Query: 299 -----HNIKWINE-EEKIADTNQCKCEDHLKVIERLKRELREKDFQISMQDKNISDLKKK 352
                 ++K I   ++++ + +  KC+DH+K IE+LK+ L  K+FQIS QDK I+ LKK+
Sbjct: 436 RDDCDDHVKEIERLKQELKEKDLSKCDDHMKEIEKLKQNLSSKEFQISTQDKIITKLKKE 495

Query: 353 VAEMKDQK 360
           + EMK +K
Sbjct: 496 LEEMKLKK 503

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449448294\|ref\|XP_004141901.1\| PREDICTED: small RNA degrading nuclease 3-like [Cucumis sativus] gi\|449517369\|ref\|XP_004165718.1\| PREDICTED: small RNA degrading nuclease 3-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356563578\|ref\|XP_003550038.1\| PREDICTED: small RNA degrading nuclease 3-like [Glycine max]	Back alignment and taxonomy information

>gi\|388506214\|gb\|AFK41173.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|186510862\|ref\|NP_190579.2\| small RNA degrading nuclease 1 [Arabidopsis thaliana] gi\|215274638\|sp\|A3KPE8.1\|SDN1_ARATH RecName: Full=Small RNA degrading nuclease 1 gi\|126352268\|gb\|ABO09879.1\| At3g50100 [Arabidopsis thaliana] gi\|195971097\|gb\|ACG60893.1\| small RNA-degrading nuclease 1 [Arabidopsis thaliana] gi\|332645105\|gb\|AEE78626.1\| small RNA degrading nuclease 1 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|6522931\|emb\|CAB62118.1\| hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297816266\|ref\|XP_002876016.1\| At3g50100 [Arabidopsis lyrata subsp. lyrata] gi\|297321854\|gb\|EFH52275.1\| At3g50100 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|297794263\|ref\|XP_002865016.1\| exonuclease [Arabidopsis lyrata subsp. lyrata] gi\|297310851\|gb\|EFH41275.1\| exonuclease [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|79547863\|ref\|NP_201525.2\| small RNA degrading nuclease 3 [Arabidopsis thaliana] gi\|75330762\|sp\|Q8RXK2.1\|SDN3_ARATH RecName: Full=Small RNA degrading nuclease 3 gi\|19423880\|gb\|AAL87318.1\| unknown protein [Arabidopsis thaliana] gi\|25055029\|gb\|AAN71976.1\| unknown protein [Arabidopsis thaliana] gi\|332010934\|gb\|AED98317.1\| small RNA degrading nuclease 3 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|10177611\|dbj\|BAB10958.1\| unnamed protein product [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		364
TAIR\|locus:2083163		409	SDN1 "small RNA degrading nucl	0.75	0.667	0.584	2.2e-82
TAIR\|locus:2155563		782	SDN3 "small RNA degrading nucl	0.909	0.423	0.479	1.1e-76
TAIR\|locus:2169717		466	SDN2 "small RNA degrading nucl	0.862	0.673	0.494	9.6e-73
TAIR\|locus:2083153		322	AT3G50090 [Arabidopsis thalian	0.675	0.763	0.510	7.1e-61
TAIR\|locus:2145244		567	AT5G25800 [Arabidopsis thalian	0.901	0.578	0.289	1.6e-25
UNIPROTKB\|E1BR93		755	LOC427001 "Uncharacterized pro	0.480	0.231	0.398	9.1e-25
UNIPROTKB\|F1P5D1		773	LOC427001 "Uncharacterized pro	0.480	0.226	0.398	9.5e-25
POMBASE\|SPAC637.09		631	SPAC637.09 "ribonuclease H70 (	0.403	0.232	0.42	1.6e-24
ASPGD\|ASPL0000067196		723	AN7566 [Emericella nidulans (t	0.640	0.322	0.345	4.7e-24
DICTYBASE\|DDB_G0291590		694	rexo1 "RNA exonuclease 1" [Dic	0.425	0.223	0.396	3.1e-23

TAIR\|locus:2083163 SDN1 "small RNA degrading nuclease 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 826 (295.8 bits), Expect = 2.2e-82, P = 2.2e-82
 Identities = 162/277 (58%), Positives = 212/277 (76%)

Query:     1 MTSNIMYAVDCEMVLCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTAD 60
             M S  M AVDCEMVLCEDG+EGLVR+ VVDR+LKV +DE VKP K V DYR++ITG+TA+
Sbjct:   135 MESTNMVAVDCEMVLCEDGTEGLVRVGVVDRDLKVILDEFVKPNKPVVDYRTDITGITAE 194

Query:    61 DLVGVTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPRVIDTSLIFKYVD--EY 118
             D+   + S+ +IQ+ ++  LS GTILVGHSLN DLEVLK+DHP+VIDT+L+FKY +  + 
Sbjct:   195 DIENASLSVVDIQETLQPFLSTGTILVGHSLNRDLEVLKIDHPKVIDTALVFKYPNTRKL 254

Query:   119 RRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVPLLQEDVAETE 178
             RRPSL NLCKS+LGYE+RK G PH+C+ DASAAMKL LA++E+RVD  +   +E + E E
Sbjct:   255 RRPSLNNLCKSILGYEVRKTGVPHDCVHDASAAMKLALAVVEKRVDTTIKPSKE-MLEVE 313

Query:   179 RARLFLHRIPTKVPSEELHGVIPGDFTIEAKAVKRIRGDNYAAFAIFSSPQEANQAFENV 238
             +A+LFLH+IP  VPSEEL  V+ G FT++ K  K  +G  Y AFA+F S ++A+QAFE++
Sbjct:   314 KAKLFLHKIPNNVPSEELEQVLSGKFTLDVKQAKT-QGRYYCAFALFHSSEDADQAFEHI 372

Query:   239 KGNQSKDSYGRPQKLVEFQSNAGIIASLYVRKMVCDE 275
              G +  DS G PQK+V  + ++G  AS+YVRKMV DE
Sbjct:   373 DGIEMTDSLGLPQKVVIIKLSSGSRASIYVRKMVQDE 409

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0004527 "exonuclease activity" evidence=IEA;ISS

GO:0005622 "intracellular" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

GO:0008408 "3'-5' exonuclease activity" evidence=IDA

GO:0010587 "miRNA catabolic process" evidence=IDA

TAIR\|locus:2155563 SDN3 "small RNA degrading nuclease 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2169717 SDN2 "small RNA degrading nuclease 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2083153 AT3G50090 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2145244 AT5G25800 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BR93 LOC427001 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P5D1 LOC427001 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

POMBASE\|SPAC637.09 SPAC637.09 "ribonuclease H70 (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000067196 AN7566 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0291590 rexo1 "RNA exonuclease 1" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
A3KPE8	SDN1_ARATH	3, ., 1, ., -, ., -	0.5848	0.75	0.6674	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	SDN1	SDN1 (SMALL RNA DEGRADING NUCLEASE 1); 3'-5' exonuclease/ exonuclease; Encodes an exonuclease that degrades single-stranded small RNAs in vitro and limits the accumulation of small RNAs in vivo. ; 3'-5' exonuclease degrading single-stranded small RNAs (409 aa)
		(Arabidopsis thaliana)
Predicted Functional Partners:
	AT5G61390	exonuclease family protein; exonuclease family protein; FUNCTIONS IN- exonuclease activity, nuc [...] (487 aa)	•	0.921
	AT1G74390	exonuclease family protein; exonuclease family protein; FUNCTIONS IN- exonuclease activity, nuc [...] (506 aa)	•	0.921
	AT5G53360	seven in absentia (SINA) family protein; seven in absentia (SINA) family protein; FUNCTIONS IN- [...] (233 aa)	•	0.439
	HYL1	HYL1 (HYPONASTIC LEAVES 1); double-stranded RNA binding / miRNA binding / protein binding; Enco [...] (419 aa)	•	0.436
	HST	HST (HASTY); nucleocytoplasmic transporter; Encodes member of importin/exportin family. Involve [...] (1202 aa)	•	0.435

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		364
cd06145		150	cd06145, REX1_like, DEDDh 3'-5' exonuclease domain	1e-68
cd06144		152	cd06144, REX4_like, DEDDh 3'-5' exonuclease domain	2e-39
cd06137		161	cd06137, DEDDh_RNase, DEDDh 3'-5' exonuclease doma	2e-34
smart00479		169	smart00479, EXOIII, exonuclease domain in DNA-poly	2e-29
cd06149		157	cd06149, ISG20, DEDDh 3'-5' exonuclease domain of	5e-20
pfam00929		161	pfam00929, RNase_T, Exonuclease	4e-18
cd06143		174	cd06143, PAN2_exo, DEDDh 3'-5' exonuclease domain	2e-11
cd06127		159	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain fam	3e-10
COG0847		243	COG0847, DnaQ, DNA polymerase III, epsilon subunit	3e-07
cd06130		156	cd06130, DNA_pol_III_epsilon_like, an uncharacteri	1e-05
PRK07740		244	PRK07740, PRK07740, hypothetical protein; Provisio	3e-05
pfam01612		172	pfam01612, DNA_pol_A_exo1, 3'-5' exonuclease	4e-05
cd06141		170	cd06141, WRN_exo, DEDDy 3'-5' exonuclease domain o	1e-04
TIGR01405		1213	TIGR01405, polC_Gram_pos, DNA polymerase III, alph	2e-04
COG2176		1444	COG2176, PolC, DNA polymerase III, alpha subunit (	2e-04
PRK06310		250	PRK06310, PRK06310, DNA polymerase III subunit eps	3e-04

>gnl\|CDD\|99848 cd06145, REX1_like, DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins	Back alignment and domain information

 Score =  212 bits (542), Expect = 1e-68
 Identities = 72/151 (47%), Positives = 102/151 (67%), Gaps = 2/151 (1%)

Query: 7   YAVDCEMVLCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVGVT 66
           +A+DCEM    DG E L R+ VVD N KV +DELVKP+  + DY +  +G+T + L  VT
Sbjct: 1   FALDCEMCYTTDGLE-LTRVTVVDENGKVVLDELVKPDGEIVDYNTRFSGITEEMLENVT 59

Query: 67  CSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPRVIDTSLIFKYVDEYR-RPSLYN 125
            +L ++QK++  L+S  TILVGHSL NDL+ LKL HPRVIDT+++F +      +PSL N
Sbjct: 60  TTLEDVQKKLLSLISPDTILVGHSLENDLKALKLIHPRVIDTAILFPHPRGPPYKPSLKN 119

Query: 126 LCKSVLGYEIRKKGTPHNCLDDASAAMKLVL 156
           L K  LG +I++    H+ ++DA AA++LV 
Sbjct: 120 LAKKYLGRDIQQGEGGHDSVEDARAALELVK 150

This subfamily is composed of RNA exonuclease 1 (REX1 or Rex1p), REX3 (or Rex3p), and similar eukaryotic proteins. In yeast, REX1 and REX3 are required for 5S rRNA and MRP (mitochondrial RNA processing) RNA maturation, respectively. They are DEDDh-type DnaQ-like 3'-5' exonucleases containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. REX1 is the major exonuclease responsible for pre-tRNA trail trimming and may also be involved in nuclear CCA turnover. REX proteins function in the processing and maturation of many RNA species, similar to the function of Escherichia coli RNase T. Length = 150

>gnl\|CDD\|99847 cd06144, REX4_like, DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>gnl\|CDD\|99840 cd06137, DEDDh_RNase, DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins	Back alignment and domain information

>gnl\|CDD\|214685 smart00479, EXOIII, exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases	Back alignment and domain information

>gnl\|CDD\|99852 cd06149, ISG20, DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>gnl\|CDD\|216200 pfam00929, RNase_T, Exonuclease	Back alignment and domain information

>gnl\|CDD\|99846 cd06143, PAN2_exo, DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2	Back alignment and domain information

>gnl\|CDD\|176648 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family	Back alignment and domain information

>gnl\|CDD\|223916 COG0847, DnaQ, DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|99834 cd06130, DNA_pol_III_epsilon_like, an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III	Back alignment and domain information

>gnl\|CDD\|236085 PRK07740, PRK07740, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|216604 pfam01612, DNA_pol_A_exo1, 3'-5' exonuclease	Back alignment and domain information

>gnl\|CDD\|176653 cd06141, WRN_exo, DEDDy 3'-5' exonuclease domain of WRN and similar proteins	Back alignment and domain information

>gnl\|CDD\|233397 TIGR01405, polC_Gram_pos, DNA polymerase III, alpha chain, Gram-positive type	Back alignment and domain information

>gnl\|CDD\|225087 COG2176, PolC, DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|180525 PRK06310, PRK06310, DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		364
cd06145		150	REX1_like DEDDh 3'-5' exonuclease domain of RNA ex	100.0
cd06137		161	DEDDh_RNase DEDDh 3'-5' exonuclease domain of the	100.0
cd06149		157	ISG20 DEDDh 3'-5' exonuclease domain of Interferon	100.0
cd06143		174	PAN2_exo DEDDh 3'-5' exonuclease domain of the euk	100.0
KOG2249		280	consensus 3'-5' exonuclease [Replication, recombin	100.0
cd06144		152	REX4_like DEDDh 3'-5' exonuclease domain of RNA ex	100.0
PRK05711		240	DNA polymerase III subunit epsilon; Provisional	99.97
TIGR01406		225	dnaQ_proteo DNA polymerase III, epsilon subunit, P	99.97
KOG2248		380	consensus 3'-5' exonuclease [Replication, recombin	99.97
PRK09146		239	DNA polymerase III subunit epsilon; Validated	99.97
PRK07740		244	hypothetical protein; Provisional	99.96
PRK07247		195	DNA polymerase III subunit epsilon; Validated	99.96
PRK06310		250	DNA polymerase III subunit epsilon; Validated	99.96
PRK06309		232	DNA polymerase III subunit epsilon; Validated	99.96
cd06131		167	DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl	99.96
PRK06063		313	DNA polymerase III subunit epsilon; Provisional	99.96
PRK06807		313	DNA polymerase III subunit epsilon; Validated	99.96
PRK08517		257	DNA polymerase III subunit epsilon; Provisional	99.96
TIGR00573		217	dnaq exonuclease, DNA polymerase III, epsilon subu	99.96
PRK07983		219	exodeoxyribonuclease X; Provisional	99.96
PRK07942		232	DNA polymerase III subunit epsilon; Provisional	99.96
PRK09145		202	DNA polymerase III subunit epsilon; Validated	99.96
smart00479		169	EXOIII exonuclease domain in DNA-polymerase alpha	99.96
cd06130		156	DNA_pol_III_epsilon_like an uncharacterized bacter	99.96
PRK07748		207	sporulation inhibitor KapD; Provisional	99.95
cd06136		177	TREX1_2 DEDDh 3'-5' exonuclease domain of three pr	99.95
PRK06195		309	DNA polymerase III subunit epsilon; Validated	99.95
COG2176		1444	PolC DNA polymerase III, alpha subunit (gram-posit	99.95
TIGR01298		200	RNaseT ribonuclease T. in gamma-subdivision Proteo	99.95
PRK07883		557	hypothetical protein; Validated	99.95
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.95
cd06134		189	RNaseT DEDDh 3'-5' exonuclease domain of RNase T.	99.95
PRK05168		211	ribonuclease T; Provisional	99.94
PRK06722		281	exonuclease; Provisional	99.94
PRK05601		377	DNA polymerase III subunit epsilon; Validated	99.94
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.94
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.93
TIGR01405		1213	polC_Gram_pos DNA polymerase III, alpha chain, Gra	99.93
cd06133		176	ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain o	99.93
COG0847		243	DnaQ DNA polymerase III, epsilon subunit and relat	99.93
cd06127		159	DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh	99.92
cd06138		183	ExoI_N N-terminal DEDDh 3'-5' exonuclease domain o	99.92
PRK09182		294	DNA polymerase III subunit epsilon; Validated	99.92
PF00929		164	RNase_T: Exonuclease; InterPro: IPR013520 This ent	99.9
PRK11779		476	sbcB exonuclease I; Provisional	99.88
PRK05359		181	oligoribonuclease; Provisional	99.88
cd06135		173	Orn DEDDh 3'-5' exonuclease domain of oligoribonuc	99.88
PRK00448		1437	polC DNA polymerase III PolC; Validated	99.87
PTZ00315		582	2'-phosphotransferase; Provisional	99.87
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	99.64
COG1949		184	Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA	99.26
cd05160		199	DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain	99.19
COG5018		210	KapD Inhibitor of the KinA pathway to sporulation,	99.11
KOG3242		208	consensus Oligoribonuclease (3'->5' exoribonucleas	99.09
KOG0542		280	consensus Predicted exonuclease [Replication, reco	99.08
cd06139		193	DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease	99.02
COG2925		475	SbcB Exonuclease I [DNA replication, recombination	98.96
PF01612		176	DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR00	98.7
PRK05755		880	DNA polymerase I; Provisional	98.64
cd06125		96	DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonucleas	98.63
cd05780		195	DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease dom	98.52
cd06146		193	mut-7_like_exo DEDDy 3'-5' exonuclease domain of C	98.52
cd00007		155	35EXOc 3'-5' exonuclease. The 35EXOc domain is res	98.25
cd05781		188	DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of	98.21
PF04857		262	CAF1: CAF1 family ribonuclease; InterPro: IPR00694	98.19
PF13482		164	RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A	98.18
cd06141		170	WRN_exo DEDDy 3'-5' exonuclease domain of WRN and	98.09
cd06129		161	RNaseD_like DEDDy 3'-5' exonuclease domain of RNas	98.06
PRK10829		373	ribonuclease D; Provisional	97.85
cd05779		204	DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domai	97.84
cd05785		207	DNA_polB_like2_exo Uncharacterized bacterial subgr	97.72
COG0349		361	Rnd Ribonuclease D [Translation, ribosomal structu	97.72
cd05784		193	DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of	97.58
smart00474		172	35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proo	97.56
TIGR01388		367	rnd ribonuclease D. This model describes ribonucle	97.53
cd06142		178	RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribon	97.51
cd05777		230	DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain	97.5
cd06148		197	Egl_like_exo DEDDy 3'-5' exonuclease domain of Dro	97.47
cd05783		204	DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of	97.15
KOG0304		239	consensus mRNA deadenylase subunit [RNA processing	96.91
cd05782		208	DNA_polB_like1_exo Uncharacterized bacterial subgr	96.89
PF10108		209	DNA_pol_B_exo2: Predicted 3'-5' exonuclease relate	96.85
cd05778		231	DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease	96.7
cd06140		178	DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5'	96.69
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	96.6
COG0749		593	PolA DNA polymerase I - 3'-5' exonuclease and poly	96.55
COG3359		278	Predicted exonuclease [DNA replication, recombinat	96.5
KOG4793		318	consensus Three prime repair exonuclease [Replicat	96.21
PHA02528		881	43 DNA polymerase; Provisional	96.19
PRK05762		786	DNA polymerase II; Reviewed	96.15
smart00486		471	POLBc DNA polymerase type-B family. DNA polymerase	96.14
PTZ00166		1054	DNA polymerase delta catalytic subunit; Provisiona	96.12
cd05776		234	DNA_polB_alpha_exo inactive DEDDy 3'-5' exonucleas	96.07
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	96.0
cd09018		150	DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease	95.43
cd06147		192	Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of y	95.31
PF03104		325	DNA_pol_B_exo1: DNA polymerase family B, exonuclea	94.96
PHA02570		220	dexA exonuclease; Provisional	94.8
TIGR00593		887	pola DNA polymerase I. This family is based on the	94.75
smart00362		72	RRM_2 RNA recognition motif.	94.74
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	94.64
TIGR00592		1172	pol2 DNA polymerase (pol2). This family is based o	93.77
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	93.71
smart00360		71	RRM RNA recognition motif.	93.21
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	93.18
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	93.03
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	92.17
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	92.03
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	91.95
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	91.94
KOG1798		2173	consensus DNA polymerase epsilon, catalytic subuni	90.54
PLN03120		260	nucleic acid binding protein; Provisional	89.98
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	89.64
COG0417		792	PolB DNA polymerase elongation subunit (family B)	89.51
KOG3657		1075	consensus Mitochondrial DNA polymerase gamma, cata	88.65
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	88.55
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	88.43
TIGR03491		457	RecB family nuclease, putative, TM0106 family. Mem	88.09
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	87.97
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	87.96
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	87.53
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	87.18
PLN03213		759	repressor of silencing 3; Provisional	86.92
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	86.15
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	85.95
KOG0969		1066	consensus DNA polymerase delta, catalytic subunit	85.83
PRK05761		787	DNA polymerase I; Reviewed	83.49
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	83.14
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	82.54
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	82.17
PHA02524		498	43A DNA polymerase subunit A; Provisional	81.97
KOG0533		243	consensus RRM motif-containing protein [RNA proces	80.68
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	80.49

>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins	Back alignment and domain information

Probab=100.00  E-value=5.8e-37  Score=270.09  Aligned_cols=148  Identities=48%  Similarity=0.751  Sum_probs=136.2

Q ss_pred             EEEEEeccCCCCCcccEEEEEEEEcCCcEEEEEEEcCCCcccccccccCCCChhhhcCCCCCHHHHHHHHHHhhcCCCEE
Q 017922            7 YAVDCEMVLCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVGVTCSLAEIQKRMKKLLSNGTIL   86 (364)
Q Consensus         7 ValD~ETTGl~~g~~~Ii~V~vVd~~G~vi~d~lVkP~~~I~d~~t~itGIT~e~L~~ap~~~~eV~~el~~fl~~~~iL   86 (364)
                      |+|||||||+..+ ++|++|++|+.+|.++|++||+|..+|+++++++||||++||+++|.++.+|+++|++|++++++|
T Consensus         1 ~~iD~E~~g~~~g-~ei~~i~~v~~~~~~~f~~lv~P~~~i~~~~t~itGIt~~~l~~a~~~~~~v~~~~~~fl~~~~vl   79 (150)
T cd06145           1 FALDCEMCYTTDG-LELTRVTVVDENGKVVLDELVKPDGEIVDYNTRFSGITEEMLENVTTTLEDVQKKLLSLISPDTIL   79 (150)
T ss_pred             CEEeeeeeeecCC-CEEEEEEEEeCCCCEEEEEeECCCCccchhccCcCCCCHHHhccCCCCHHHHHHHHHHHhCCCCEE
Confidence            6899999999988 789999999999999999999999999999999999999999999548999999999999448999


Q ss_pred             EEechhhHHHHHcccCCCccchHHHhhhhcC-CCCccHHHHHHHHhCCccCCCCCCCChHHHHHHHHHHH
Q 017922           87 VGHSLNNDLEVLKLDHPRVIDTSLIFKYVDE-YRRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLV  155 (364)
Q Consensus        87 VGHn~~fDl~fL~~~~~~vIDT~~L~r~~~~-~~~~sL~~L~k~~Lgi~i~~~~~~H~Al~DA~Ata~L~  155 (364)
                      ||||+.||++||+..+++++||+.|++..++ ..+|+|+.||+.|+|+.++.++.+|+|++||++|++||
T Consensus        80 VgHn~~fD~~fL~~~~~~~iDT~~l~r~~~~~~~~~~L~~L~~~~~~~~i~~~~~~H~Al~DA~~t~~l~  149 (150)
T cd06145          80 VGHSLENDLKALKLIHPRVIDTAILFPHPRGPPYKPSLKNLAKKYLGRDIQQGEGGHDSVEDARAALELV  149 (150)
T ss_pred             EEcChHHHHHHhhccCCCEEEcHHhccccCCCCCChhHHHHHHHHCCcceeCCCCCCCcHHHHHHHHHHh
Confidence            9999999999999999999999999998776 56799999998888987764235899999999999998

>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins	Back alignment and domain information

>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2	Back alignment and domain information

>KOG2249 consensus 3'-5' exonuclease [Replication, recombination and repair]	Back alignment and domain information

>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>PRK05711 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial	Back alignment and domain information

>KOG2248 consensus 3'-5' exonuclease [Replication, recombination and repair]	Back alignment and domain information

>PRK09146 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK07740 hypothetical protein; Provisional	Back alignment and domain information

>PRK07247 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06310 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06309 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins	Back alignment and domain information

>PRK06063 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>PRK06807 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK08517 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family	Back alignment and domain information

>PRK07983 exodeoxyribonuclease X; Provisional	Back alignment and domain information

>PRK07942 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>PRK09145 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases	Back alignment and domain information

>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III	Back alignment and domain information

>PRK07748 sporulation inhibitor KapD; Provisional	Back alignment and domain information

>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins	Back alignment and domain information

>PRK06195 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01298 RNaseT ribonuclease T	Back alignment and domain information

>PRK07883 hypothetical protein; Validated	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T	Back alignment and domain information

>PRK05168 ribonuclease T; Provisional	Back alignment and domain information

>PRK06722 exonuclease; Provisional	Back alignment and domain information

>PRK05601 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type	Back alignment and domain information

>cd06133 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins	Back alignment and domain information

>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]	Back alignment and domain information

>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family	Back alignment and domain information

>cd06138 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins	Back alignment and domain information

>PRK09182 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PF00929 RNase_T: Exonuclease; InterPro: IPR013520 This entry includes a variety of exonuclease proteins, such as ribonuclease T [] and the epsilon subunit of DNA polymerase III	Back alignment and domain information

>PRK11779 sbcB exonuclease I; Provisional	Back alignment and domain information

>PRK05359 oligoribonuclease; Provisional	Back alignment and domain information

>cd06135 Orn DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins	Back alignment and domain information

>PRK00448 polC DNA polymerase III PolC; Validated	Back alignment and domain information

>PTZ00315 2'-phosphotransferase; Provisional	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>COG1949 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA processing and modification]	Back alignment and domain information

>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases	Back alignment and domain information

>COG5018 KapD Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only]	Back alignment and domain information

>KOG3242 consensus Oligoribonuclease (3'->5' exoribonuclease) [RNA processing and modification]	Back alignment and domain information

>KOG0542 consensus Predicted exonuclease [Replication, recombination and repair]	Back alignment and domain information

>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases	Back alignment and domain information

>COG2925 SbcB Exonuclease I [DNA replication, recombination, and repair]	Back alignment and domain information

>PF01612 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides	Back alignment and domain information

>PRK05755 DNA polymerase I; Provisional	Back alignment and domain information

>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily	Back alignment and domain information

>cd05780 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease domain of Pyrococcus kodakaraensis Kod1 and similar archaeal family-B DNA polymerases	Back alignment and domain information

>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins	Back alignment and domain information

>cd00007 35EXOc 3'-5' exonuclease	Back alignment and domain information

>cd05781 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of Sulfurisphaera ohwakuensis DNA polymerase B3 and similar archaeal family-B DNA polymerases	Back alignment and domain information

>PF04857 CAF1: CAF1 family ribonuclease; InterPro: IPR006941 CAF1 is an RNase of the DEDD superfamily, and a subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA deadenylation	Back alignment and domain information

>PF13482 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 2AJQ_F 1T8E_A 1T7P_A 1SKR_A 1X9W_A 1TK8_A 1TK0_A 1SL2_A	Back alignment and domain information

>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins	Back alignment and domain information

>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins	Back alignment and domain information

>PRK10829 ribonuclease D; Provisional	Back alignment and domain information

>cd05779 DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon, a family-B DNA polymerase	Back alignment and domain information

>cd05785 DNA_polB_like2_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases	Back alignment and domain information

>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd05784 DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase II and similar bacterial family-B DNA polymerases	Back alignment and domain information

>smart00474 35EXOc 3'-5' exonuclease	Back alignment and domain information

>TIGR01388 rnd ribonuclease D	Back alignment and domain information

>cd06142 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins	Back alignment and domain information

>cd05777 DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase delta, a family-B DNA polymerase	Back alignment and domain information

>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins	Back alignment and domain information

>cd05783 DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of Sulfolobus solfataricus DNA polymerase B1 and similar archaeal family-B DNA polymerases	Back alignment and domain information

>KOG0304 consensus mRNA deadenylase subunit [RNA processing and modification]	Back alignment and domain information

>cd05782 DNA_polB_like1_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases	Back alignment and domain information

>PF10108 DNA_pol_B_exo2: Predicted 3'-5' exonuclease related to the exonuclease domain of PolB; InterPro: IPR019288 This entry represents various prokaryotic 3'-5' exonucleases and hypothetical proteins	Back alignment and domain information

>cd05778 DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase zeta, a family-B DNA polymerase	Back alignment and domain information

>cd06140 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>COG0749 PolA DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair]	Back alignment and domain information

>COG3359 Predicted exonuclease [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG4793 consensus Three prime repair exonuclease [Replication, recombination and repair]	Back alignment and domain information

>PHA02528 43 DNA polymerase; Provisional	Back alignment and domain information

>PRK05762 DNA polymerase II; Reviewed	Back alignment and domain information

>smart00486 POLBc DNA polymerase type-B family	Back alignment and domain information

>PTZ00166 DNA polymerase delta catalytic subunit; Provisional	Back alignment and domain information

>cd05776 DNA_polB_alpha_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha, a family-B DNA polymerase	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>cd09018 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins	Back alignment and domain information

>cd06147 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins	Back alignment and domain information

>PF03104 DNA_pol_B_exo1: DNA polymerase family B, exonuclease domain Several related DNA polymerases were too dissimilar to be included	Back alignment and domain information

>PHA02570 dexA exonuclease; Provisional	Back alignment and domain information

>TIGR00593 pola DNA polymerase I	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>TIGR00592 pol2 DNA polymerase (pol2)	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG1798 consensus DNA polymerase epsilon, catalytic subunit A [Replication, recombination and repair]	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>COG0417 PolB DNA polymerase elongation subunit (family B) [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG3657 consensus Mitochondrial DNA polymerase gamma, catalytic subunit [Replication, recombination and repair]	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>TIGR03491 RecB family nuclease, putative, TM0106 family	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0969 consensus DNA polymerase delta, catalytic subunit [Replication, recombination and repair]	Back alignment and domain information

>PRK05761 DNA polymerase I; Reviewed	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>PHA02524 43A DNA polymerase subunit A; Provisional	Back alignment and domain information

>KOG0533 consensus RRM motif-containing protein [RNA processing and modification]	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		364
1wlj_A		189	Human Isg20 Length = 189		3e-13

>pdb|1WLJ|A Chain A, Human Isg20 Length = 189

Back alignment and structure

Iteration: 1

Score = 72.4 bits (176), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 53/155 (34%), Positives = 85/155 (54%), Gaps = 10/155 (6%) Query: 8 AVDCEMV-LCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVGVT 66 A+DCEMV L GL R +V+ + V D+ ++PE + DYR+ ++G+T +VG T Sbjct: 9 AMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGAT 68 Query: 67 CSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHP--RVIDTS---LIFK--YVDEYR 119 A + + +LL G ++VGH L +D + LK D + DTS L+++ +D R Sbjct: 69 -PFAVARLEILQLL-KGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCR 126 Query: 120 RPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKL 154 R SL L + +L I+ H+ ++DA A M+L Sbjct: 127 RVSLRVLSERLLHKSIQNSLLGHSSVEDARATMEL 161

PyMOL of 1wlj

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		364
1wlj_A		189	Interferon stimulated gene 20KDA; exoribonuclease,	2e-54
2xri_A		224	ERI1 exoribonuclease 3; hydrolase, metal binding;	2e-08
1w0h_A		204	3'-5' exonuclease ERI1; nuclease domain, hydrolase	1e-07
3mxm_B		242	Three prime repair exonuclease 1; RNAse H-like fol	2e-07
2p1j_A		186	POLIII, DNA polymerase III POLC-type; structural g	3e-07
1zbh_A		299	3'-5' exonuclease ERI1; histone mRNA 3'-END-specif	6e-07
1y97_A		238	Three prime repair exonuclease 2; TREX2, hydrolase	9e-07
3u3y_B		314	Three prime repair exonuclease 1; RNAse H fold, 3'	1e-06
1zbu_A		349	ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase;	2e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-05
3cg7_A		308	CRN-4, cell death-related nuclease 4; hydrolase, a	2e-05
2e6m_A		208	Werner syndrome ATP-dependent helicase homolog; AP	4e-05

>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Length = 189	Back alignment and structure

 Score =  176 bits (449), Expect = 2e-54
 Identities = 56/183 (30%), Positives = 87/183 (47%), Gaps = 10/183 (5%)

Query: 6   MYAVDCEMVLCEDGSE-GLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVG 64
           + A+DCEMV      E GL R  +V+ +  V  D+ ++PE  + DYR+ ++G+T   +VG
Sbjct: 7   VVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVG 66

Query: 65  VTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPR--VIDTSLIFKY-----VDE 117
            T   A  +  + +LL  G ++VGH L +D + LK D     + DTS          +D 
Sbjct: 67  AT-PFAVARLEILQLLK-GKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDH 124

Query: 118 YRRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVPLLQEDVAET 177
            RR SL  L + +L   I+     H+ ++DA A M+L       R    +P L     E 
Sbjct: 125 CRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSDLEH 184

Query: 178 ERA 180
              
Sbjct: 185 HHH 187

PyMOL of 1wlj

>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Length = 224	Back alignment and structure

>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Length = 204	Back alignment and structure

>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Length = 242	Back alignment and structure

>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Length = 186	Back alignment and structure

>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Length = 299	Back alignment and structure

>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Length = 238	Back alignment and structure

>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B* Length = 314	Back alignment and structure

>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Length = 349	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A Length = 308	Back alignment and structure

>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Length = 208	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		364
1wlj_A		189	Interferon stimulated gene 20KDA; exoribonuclease,	100.0
2p1j_A		186	POLIII, DNA polymerase III POLC-type; structural g	99.97
2gui_A		194	DNA polymerase III epsilon subunit; DNA polymerase	99.97
1w0h_A		204	3'-5' exonuclease ERI1; nuclease domain, hydrolase	99.96
3mxm_B		242	Three prime repair exonuclease 1; RNAse H-like fol	99.96
1y97_A		238	Three prime repair exonuclease 2; TREX2, hydrolase	99.95
3u3y_B		314	Three prime repair exonuclease 1; RNAse H fold, 3'	99.95
2f96_A		224	Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas	99.95
1zbh_A		299	3'-5' exonuclease ERI1; histone mRNA 3'-END-specif	99.95
2xri_A		224	ERI1 exoribonuclease 3; hydrolase, metal binding;	99.95
2igi_A		180	Oligoribonuclease; RNAse, exoribonuclease, exonucl	99.94
3v9w_A		235	Ribonuclease T; DEDD nucleases family, EXO-nucleas	99.94
3cg7_A		308	CRN-4, cell death-related nuclease 4; hydrolase, a	99.94
2gbz_A		194	Oligoribonuclease; ORN, deddh, structural genomics	99.94
1zbu_A		349	ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase;	99.94
3tr8_A		186	Oligoribonuclease; transcription, hydrolase; 2.50A	99.93
2qxf_A		482	Exodeoxyribonuclease I; alpha-beta domain, DNAQ su	99.92
2kfn_A		605	Klenow fragment of DNA polymerase I; complex (poly	99.12
4hec_A		190	Putative uncharacterized protein; ssgcid, structur	99.01
1x9m_A		698	DNA polymerase; DNA ploymerase, N-2-acetylaminoflu	98.97
4dfk_A		540	DNA polymerase I, thermostable; DNA polymerase, tr	98.41
4gmj_B		285	CCR4-NOT transcription complex subunit 7; mRNA dec	98.3
3saf_A		428	Exosome component 10; exoribonuclease, RNA exosome	98.15
1qht_A		775	Protein (DNA polymerase); archaea, hyperthermostab	98.13
3d45_A		507	Poly(A)-specific ribonuclease PARN; CAP analogue,	98.01
2d5r_A		252	CCR4-NOT transcription complex subunit 7; poly(A)	97.94
1noy_A		388	Protein (DNA polymerase (E.C.2.7.7.7)); exonucleas	97.91
2e6m_A		208	Werner syndrome ATP-dependent helicase homolog; AP	97.83
1yt3_A		375	Ribonuclease D, RNAse D; exoribonuclease, exonucle	97.69
2p51_A		333	SPCC18.06C protein; DEDD nuclease fold, hydrolase,	97.68
3pv8_A		592	DNA polymerase I; DNA polymerase I, protein-DNA co	97.66
1uoc_A		289	POP2; hydrolase, DEDD nuclease, mRNA degradation,	97.65
1vk0_A		206	Hypothetical protein; homohexamer, AT5G06450, stru	97.64
1s5j_A		847	DNA polymerase I; replication, disulfide bonds, tr	97.44
2hbj_A		410	Exosome complex exonuclease RRP6; RNA metabolism,	97.37
3iay_A		919	DNA polymerase delta catalytic subunit; protein-DN	97.32
2a1r_A		430	Poly(A)-specific ribonuclease PARN; DEDD, nuclease	97.03
3qex_A		903	DNA polymerase, GP43; difluorotoluene nucleoside;	96.93
3cym_A		440	Uncharacterized protein BAD_0989; structural genom	96.93
1x5o_A		114	RNA binding motif, single-stranded interacting pro	96.9
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	96.79
2gv9_A		1193	DNA polymerase; polymerase alpha fold, transferase	96.78
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	96.58
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	96.53
3k59_A		786	POL II, DNA polymerase II; protein-DNA complex, DN	96.5
1x4e_A		85	RNA binding motif, single-stranded interacting pro	96.48
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	96.44
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	96.36
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	96.35
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	96.25
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	96.25
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	96.24
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	96.23
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	96.22
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	96.19
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	96.17
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	96.17
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	96.1
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	96.1
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	96.1
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	96.08
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	96.03
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	96.01
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	96.0
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	95.99
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	95.99
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	95.97
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	95.96
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	95.93
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	95.92
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	95.91
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	95.9
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	95.9
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	95.87
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	95.85
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	95.84
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	95.82
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	95.8
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	95.79
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	95.79
2div_A		99	TRNA selenocysteine associated protein; structural	95.78
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	95.77
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	95.76
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	95.76
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	95.76
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	95.74
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	95.74
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	95.73
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	95.71
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	95.7
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	95.7
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	95.7
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	95.68
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	95.68
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	95.68
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	95.67
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	95.63
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	95.59
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	95.56
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	95.56
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	95.55
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	95.5
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	95.48
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	95.48
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	95.43
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	95.43
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	95.41
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	95.4
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	95.37
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	95.35
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	95.33
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	95.33
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	95.3
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	95.3
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	95.29
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	95.28
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	95.27
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	95.22
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	95.21
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	95.2
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	95.2
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	95.19
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	95.18
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	95.18
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	95.18
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	95.16
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	95.15
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	95.11
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	95.11
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	95.1
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	95.1
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	95.07
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	95.06
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	95.04
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	95.03
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	95.0
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	95.0
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	94.96
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	94.96
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	94.96
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	94.95
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	94.95
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	94.91
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	94.9
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	94.9
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	94.89
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	94.89
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	94.86
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	94.81
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	94.78
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	94.76
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	94.75
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	94.75
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	94.74
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	94.72
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	94.72
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	94.69
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	94.69
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	94.63
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	94.63
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	94.6
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	94.59
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	94.52
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	94.49
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	94.49
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	94.44
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	94.34
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	94.32
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	94.32
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	94.25
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	94.23
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	94.2
2dis_A		109	Unnamed protein product; structural genomics, RRM	94.16
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	94.15
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	94.14
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	94.13
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	94.11
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	94.1
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	94.08
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	94.08
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	94.06
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	94.0
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	93.99
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	93.98
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	93.98
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	93.91
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	93.91
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	93.9
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	93.89
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	93.84
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	93.81
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	93.79
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	93.78
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	93.71
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	93.71
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	93.67
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	93.64
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	92.71
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	93.58
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	93.54
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	93.39
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	93.34
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	93.27
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	93.27
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	93.26
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	93.21
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	93.05
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	92.97
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	92.84
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	92.81
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	92.77
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	92.72
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	92.61
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	92.36
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	92.28
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	92.1
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	91.87
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	91.83
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	91.77
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	91.72
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	91.68
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	91.18
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	90.91
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	90.84
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	90.83
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	90.8
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	90.55
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	90.46
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	90.44
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	90.37
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	89.86
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	89.56
2py5_A		575	DNA polymerase; protein-DNA complex, replication,	89.4
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	89.17
1x5p_A		97	Negative elongation factor E; structure genomics,	89.04
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	88.66
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	84.95
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	84.68
1bgx_T		832	TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi	84.11
2l08_A		97	Regulator of nonsense transcripts 3A; NESG, nonsen	83.84
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	83.64
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	82.67
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	82.12
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	81.6
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	80.07

>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

Probab=100.00  E-value=1.8e-33  Score=253.76  Aligned_cols=157  Identities=32%  Similarity=0.459  Sum_probs=136.0

Q ss_pred             CCcEEEEEEeccCCCCCc-ccEEEEEEEEcCCcEEEEEEEcCCCcccccccccCCCChhhhcCCCCCHHHHHHHHHHhhc
Q 017922            3 SNIMYAVDCEMVLCEDGS-EGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVGVTCSLAEIQKRMKKLLS   81 (364)
Q Consensus         3 ~~~~ValD~ETTGl~~g~-~~Ii~V~vVd~~G~vi~d~lVkP~~~I~d~~t~itGIT~e~L~~ap~~~~eV~~el~~fl~   81 (364)
                      ..+||+|||||||+++.. .+|++|++|+.+|+++|++||+|..+|+++++.+||||++||.++| +|.+|+++|.+|+ 
T Consensus         4 ~~~~vviD~ETTGl~~~~~~~iiei~~v~~~g~~i~~~lV~P~~~i~~~~~~i~GIt~~~l~~a~-~~~~v~~~~~~~l-   81 (189)
T 1wlj_A            4 SREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGAT-PFAVARLEILQLL-   81 (189)
T ss_dssp             --CEEEEEEEEEEETTTTEEEEEEEEEECTTCCEEEEEEEECSSCEEECCHHHHCCCHHHHTTCE-EHHHHHHHHHHHH-
T ss_pred             CCeEEEEEeECcCcCCCCCceEEEEEEEeCCCCEEEeeEecCCCCCCccccCCCCCCHHHHcCCC-CHHHHHHHHHHHH-
Confidence            358999999999998764 4789999999999999999999999999999999999999999999 9999999999999 


Q ss_pred             CCCEEEEechhhHHHHHcccCCC--ccchHHHhh--h--hcC-CCCccHHHHHHHHhCCccCCCCCCCChHHHHHHHHHH
Q 017922           82 NGTILVGHSLNNDLEVLKLDHPR--VIDTSLIFK--Y--VDE-YRRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKL  154 (364)
Q Consensus        82 ~~~iLVGHn~~fDl~fL~~~~~~--vIDT~~L~r--~--~~~-~~~~sL~~L~k~~Lgi~i~~~~~~H~Al~DA~Ata~L  154 (364)
                      ++++|||||+.||++||+..+|+  ++||+.+++  .  ..| ..+++|+.||+.+||++++.++.+|+|++||++|++|
T Consensus        82 ~~~~lV~hn~~fD~~~L~~~~~~~~~idt~~~~~~~~~~~~p~~~~~~L~~l~~~~lgi~~~~~~~~H~Al~Da~ata~l  161 (189)
T 1wlj_A           82 KGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMEL  161 (189)
T ss_dssp             TTSEEEESSHHHHHHHTTCCCTTCEEEEGGGCHHHHHHHTC-----CCHHHHHHHHTCCCCSCCTTCCCHHHHHHHHHHH
T ss_pred             CCCEEEECCcHHHHHHHHHhCCCCceechHhhhhhhhcccCCCCCCccHHHHHHHHcCCCCCCCCCCcCcHHHHHHHHHH
Confidence            89999999999999999998886  799998754  2  233 4789999999666899987422289999999999999


Q ss_pred             HHHHHHh
Q 017922          155 VLAIIER  161 (364)
Q Consensus       155 ~~~~le~  161 (364)
                      |.++++.
T Consensus       162 ~~~l~~~  168 (189)
T 1wlj_A          162 YQISQRI  168 (189)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            9988754

PyMOL of 1wlj

>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8}	Back alignment and structure

>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A*	Back alignment and structure

>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A	Back alignment and structure

>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B*	Back alignment and structure

>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5	Back alignment and structure

>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens}	Back alignment and structure

>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens}	Back alignment and structure

>2igi_A Oligoribonuclease; RNAse, exoribonuclease, exonuclease, hydrolase, mRNA decay; 1.70A {Escherichia coli} SCOP: c.55.3.5 PDB: 1yta_A 1j9a_A	Back alignment and structure

>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A	Back alignment and structure

>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A	Back alignment and structure

>2gbz_A Oligoribonuclease; ORN, deddh, structural genomics, hydrolase; 2.30A {Xanthomonas campestris PV}	Back alignment and structure

>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens}	Back alignment and structure

>3tr8_A Oligoribonuclease; transcription, hydrolase; 2.50A {Coxiella burnetii}	Back alignment and structure

>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A*	Back alignment and structure

>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} SCOP: c.55.3.5 e.8.1.1 PDB: 1d9f_A* 1d9d_A* 1krp_A* 1ksp_A* 1qsl_A* 1kfs_A* 2kfz_A* 2kzm_A* 2kzz_A* 1dpi_A* 1kfd_A* 1kln_A* 1d8y_A*	Back alignment and structure

>4hec_A Putative uncharacterized protein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, unknown; 1.80A {Mycobacterium tuberculosis}	Back alignment and structure

>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A*	Back alignment and structure

>4dfk_A DNA polymerase I, thermostable; DNA polymerase, transferase-DNA complex; HET: DNA DOC 0L5; 1.65A {Thermus aquaticus} PDB: 1jxe_A* 3ktq_A* 3lwl_A* 3lwm_A* 3m8s_A* 3m8r_A* 3oju_A* 3rr7_A* 3rr8_A* 3rrg_A* 3ojs_A* 3rtv_A* 3sv3_A* 3sv4_A* 3syz_A* 3sz2_A* 3t3f_A* 4df4_A* 4df8_A* 4dfj_A* ...	Back alignment and structure

>4gmj_B CCR4-NOT transcription complex subunit 7; mRNA decay, deadenylase, RNA bindin; HET: GOL; 2.70A {Homo sapiens}	Back alignment and structure

>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A	Back alignment and structure

>1qht_A Protein (DNA polymerase); archaea, hyperthermostable, family B polymer alpha family polymerase, transferase; 2.10A {Thermococcus SP} SCOP: c.55.3.5 e.8.1.1 PDB: 1tgo_A 2xhb_A* 2vwj_A* 2vwk_A* 1wns_A* 1wn7_A 1qqc_A* 4ahc_A* 4ail_C* 3a2f_A* 2jgu_A* 1d5a_A	Back alignment and structure

>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus}	Back alignment and structure

>2d5r_A CCR4-NOT transcription complex subunit 7; poly(A) deadenylase, antiproliferative protein, transcription; 2.50A {Homo sapiens} SCOP: c.55.3.9	Back alignment and structure

>1noy_A Protein (DNA polymerase (E.C.2.7.7.7)); exonuclease, DNA-binding, complex (nucleotidyltransferase/DNA); HET: DNA; 2.20A {Enterobacteria phage T4} SCOP: c.55.3.5 PDB: 1noz_A*	Back alignment and structure

>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A*	Back alignment and structure

>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5	Back alignment and structure

>2p51_A SPCC18.06C protein; DEDD nuclease fold, hydrolase, gene regulation; 1.40A {Schizosaccharomyces pombe} PDB: 3g0z_A 3g10_A	Back alignment and structure

>3pv8_A DNA polymerase I; DNA polymerase I, protein-DNA complex, thymine-adenine, CLOS conformation; HET: DNA 2DT D3T; 1.52A {Geobacillus kaustophilus} PDB: 3px0_A* 3px4_A* 3px6_A* 3thv_A* 3ti0_A* 4dse_A* 4dsf_A* 4ds4_A* 4dqp_A* 4dqi_A* 4ds5_A* 4e0d_A* 4dqr_A* 4dqq_A* 3tan_A* 3tap_A* 3taq_A* 3tar_A* 4dqs_A* 3hp6_A* ...	Back alignment and structure

>1uoc_A POP2; hydrolase, DEDD nuclease, mRNA degradation, poly(A) tail, transcription regulation, repressor, phosphorylation.; 2.3A {Saccharomyces cerevisiae} SCOP: c.55.3.9	Back alignment and structure

>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A	Back alignment and structure

>1s5j_A DNA polymerase I; replication, disulfide bonds, transferase; HET: DNA; 2.40A {Sulfolobus solfataricus} SCOP: c.55.3.5 e.8.1.1	Back alignment and structure

>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A*	Back alignment and structure

>3iay_A DNA polymerase delta catalytic subunit; protein-DNA complex, DNA replication, DNA-BI DNA-directed DNA polymerase, exonuclease, hydrolase; HET: DNA DOC DCP; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2a1r_A Poly(A)-specific ribonuclease PARN; DEDD, nuclease domain, hydrolase-RNA complex; 2.60A {Homo sapiens} PDB: 2a1s_A	Back alignment and structure

>3qex_A DNA polymerase, GP43; difluorotoluene nucleoside; HET: DNA DOC DGT; 1.73A {Enterobacteria phage RB69} PDB: 3qei_A* 3qer_A* 3qes_A* 3qet_A* 3qep_A* 3qew_A* 3qev_A* 3s9h_A* 3sq0_A* 4dtn_A* 4dto_A* 4dtp_A* 4dtr_A* 4dts_A* 4dtu_A* 4dtx_A* 4e3s_A* 4fjm_A* 4fjl_A* 3spz_A* ...	Back alignment and structure

>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID}	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2gv9_A DNA polymerase; polymerase alpha fold, transferase; HET: DNA; 2.68A {Human herpesvirus 1} PDB: 1dml_B*	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3k59_A POL II, DNA polymerase II; protein-DNA complex, DNA damage, DNA repair, DNA-binding; HET: DNA DOC DCP; 1.92A {Escherichia coli} PDB: 3k57_A* 3k58_A* 3k5l_A* 3k5m_A* 3k5n_A* 3k5o_A* 3maq_A* 1q8i_A*	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2py5_A DNA polymerase; protein-DNA complex, replication, transferase/DNA complex; HET: DNA; 1.60A {Bacillus phage PHI29} SCOP: c.55.3.5 e.8.1.1 PDB: 1xhz_A* 1xhx_A* 2ex3_A* 1xi1_A* 2pyj_A* 2pyl_A* 2pzs_A*	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A*	Back alignment and structure

>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens}	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		364
d1wlja_		173	c.55.3.5 (A:) Interferon-stimulated gene 20 kDa pr	1e-14
d3b6oa1		226	c.55.3.5 (A:9-234) Three prime repair exonuclease	2e-06
d1w0ha_		200	c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapien	6e-06
d1y97a1		228	c.55.3.5 (A:1-228) Three prime repair exonuclease	1e-04

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Length = 173	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Interferon-stimulated gene 20 kDa protein, ISG20
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 68.9 bits (167), Expect = 1e-14
 Identities = 50/173 (28%), Positives = 79/173 (45%), Gaps = 10/173 (5%)

Query: 6   MYAVDCEMV-LCEDGSEGLVRLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVG 64
           + A+DCEMV L      GL R  +V+ +  V  D+ ++PE  + DYR+ ++G+T      
Sbjct: 2   VVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVT--PQHM 59

Query: 65  VTCSLAEIQKRMKKLLSNGTILVGHSLNNDLEVLKLDHPR------VIDTSLIF-KYVDE 117
           V  +   + +     L  G ++VGH L +D + LK D           D  L     +D 
Sbjct: 60  VGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDH 119

Query: 118 YRRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVLAIIERRVDNAVPLL 170
            RR SL  L + +L   I+     H+ ++DA A M+L       R    +P L
Sbjct: 120 CRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRL 172

PyMOL of d1wlja_

>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 226	Back information, alignment and structure

>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 200	Back information, alignment and structure

>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Length = 228	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		364
d1wlja_		173	Interferon-stimulated gene 20 kDa protein, ISG20 {	100.0
d2guia1		174	N-terminal exonuclease domain of the epsilon subun	99.95
d3b6oa1		226	Three prime repair exonuclease 1, TREX1 {Mouse (Mu	99.93
d1y97a1		228	Three prime repair exonuclease 2, TREX2 {Human (Ho	99.9
d1w0ha_		200	Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 960	99.87
d2f96a1		202	Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287	99.79
d2qxfa1		467	Exonuclease I {Escherichia coli K12 (Escherichia c	99.76
d2igia1		180	Oligoribonuclease {Escherichia coli [TaxId: 562]}	99.56
d1kfsa1		195	Exonuclease domain of prokaryotic DNA polymerase {	98.92
d1yt3a3		193	Ribonuclease D, catalytic domain {Escherichia coli	98.8
d2d5ra1		252	CCR4-NOT transcription complex subunit 7, CAF1 {Hu	98.68
d1x9ma1		204	Exonuclease domain of T7 DNA polymerase {Bacteriop	98.48
d2hhva1		171	Exonuclease domain of prokaryotic DNA polymerase {	98.38
d2hbka2		292	Exosome complex exonuclease RRP6 {Baker's yeast (S	98.3
d1vk0a_		206	Hypothetical protein AT5G06450 {Thale-cress (Arabi	98.0
d1uoca_		286	Pop2 RNase D domain {Baker's yeast (Saccharomyces	97.75
d1tgoa1		347	Exonuclease domain of family B DNA polymerases {Ar	97.6
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	97.25
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	96.9
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	96.88
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	96.83
d1s5ja1		410	Exonuclease domain of family B DNA polymerases {Su	96.83
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	96.82
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	96.76
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	96.75
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	96.73
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	96.69
d1q8ia1		388	Exonuclease domain of family B DNA polymerases {Es	96.68
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	96.58
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	96.58
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	96.56
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	96.56
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	96.51
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	96.51
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	96.5
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	96.46
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	96.46
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	96.46
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	96.45
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	96.42
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	96.39
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	96.39
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	96.39
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	96.38
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	96.37
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	96.36
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	96.36
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	96.32
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	96.31
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	96.29
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	96.28
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	96.27
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	96.26
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	96.25
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	96.23
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	96.23
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	96.18
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	96.17
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	96.17
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	96.16
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	96.16
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	96.15
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	96.11
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	96.05
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	96.04
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	96.03
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	96.02
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	95.94
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	95.84
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	95.82
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	95.75
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	95.73
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	95.72
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	95.63
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	95.47
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	95.41
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	95.4
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	95.35
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	95.34
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	95.21
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	95.15
d1noya_		372	Exonuclease domain of family B DNA polymerases {Ba	95.13
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	94.86
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	94.66
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	94.64
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	94.57
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	94.5
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	94.4
d1ih7a1		375	Exonuclease domain of family B DNA polymerases {Ba	94.35
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	94.22
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	94.02
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	93.88
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	93.85
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	93.76
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	93.67
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	93.57
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	93.55
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	92.72
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	89.11
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	89.06
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	88.82
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	88.82
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	86.58
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	86.39
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	85.9
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	82.08
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	80.5
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	80.43

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Interferon-stimulated gene 20 kDa protein, ISG20
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.1e-34  Score=248.46  Aligned_cols=153  Identities=31%  Similarity=0.447  Sum_probs=135.2

Q ss_pred             cEEEEEEeccCCCCCcccEE-EEEEEEcCCcEEEEEEEcCCCcccccccccCCCChhhhcCCCCCHHHHHHHHHHhhcCC
Q 017922            5 IMYAVDCEMVLCEDGSEGLV-RLCVVDRNLKVTIDELVKPEKAVADYRSEITGLTADDLVGVTCSLAEIQKRMKKLLSNG   83 (364)
Q Consensus         5 ~~ValD~ETTGl~~g~~~Ii-~V~vVd~~G~vi~d~lVkP~~~I~d~~t~itGIT~e~L~~ap~~~~eV~~el~~fl~~~   83 (364)
                      ++|||||||||++++.++++ .+++|+.+|+++|++||+|..+|+++++.+||||++++.++| +|.+++++|.+|+ ++
T Consensus         1 ~~v~iD~EttGl~~~~~~ii~~~~iv~~~g~~i~~~~v~p~~~i~~~~~~i~GIt~e~~~~~~-~~~~~~~~~~~~~-~~   78 (173)
T d1wlja_           1 EVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGAT-PFAVARLEILQLL-KG   78 (173)
T ss_dssp             CEEEEEEEEEEETTTTEEEEEEEEEECTTCCEEEEEEEECSSCEEECCHHHHCCCHHHHTTCE-EHHHHHHHHHHHH-TT
T ss_pred             CEEEEEEEcCCCCCCCCcEEEEEEEEEecCeEEEEEeeecccccCcceeEEecCcchhhhcCC-cHHHHHHHHHhhc-cc
Confidence            58999999999998877655 588899999999999999999999999999999999999999 9999999999999 89


Q ss_pred             CEEEEechhhHHHHHcccCCC------ccchHHHhhhhcC-CCCccHHHHHHHHhCCccCCCCCCCChHHHHHHHHHHHH
Q 017922           84 TILVGHSLNNDLEVLKLDHPR------VIDTSLIFKYVDE-YRRPSLYNLCKSVLGYEIRKKGTPHNCLDDASAAMKLVL  156 (364)
Q Consensus        84 ~iLVGHn~~fDl~fL~~~~~~------vIDT~~L~r~~~~-~~~~sL~~L~k~~Lgi~i~~~~~~H~Al~DA~Ata~L~~  156 (364)
                      .++||||+.||++||+...++      ++||..+++..++ ..+++|+.||+.++++.++.++.+|+|++||++|++||.
T Consensus        79 ~~lv~hn~~fD~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~~~~~~~~i~~~~~~H~Al~Da~at~~l~~  158 (173)
T d1wlja_          79 KLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQ  158 (173)
T ss_dssp             SEEEESSHHHHHHHTTCCCTTCEEEEGGGCHHHHHHHTC-----CCHHHHHHHHTCCCCSCCTTCCCHHHHHHHHHHHHH
T ss_pred             ceEEeechHhHHHHHHHhhccCcccchhHHHHHHHHHhhcccCCcCHHHHHHHHhCCcccCCCCCCChHHHHHHHHHHHH
Confidence            999999999999999987654      5789989888877 778999999988999988764568999999999999996


Q ss_pred             HHH
Q 017922          157 AII  159 (364)
Q Consensus       157 ~~l  159 (364)
                      .+.
T Consensus       159 ~~~  161 (173)
T d1wlja_         159 ISQ  161 (173)
T ss_dssp             HHH
T ss_pred             HHH
Confidence            544

PyMOL of d1wlja_

>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]}	Back information, alignment and structure

>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2d5ra1 c.55.3.9 (A:11-262) CCR4-NOT transcription complex subunit 7, CAF1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x9ma1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}	Back information, alignment and structure

>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1uoca_ c.55.3.9 (A:) Pop2 RNase D domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus gorgonarius [TaxId: 71997]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure