Citrus Sinensis ID: 018229
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 359 | 2.2.26 [Sep-21-2011] | |||||||
| Q9SW96 | 572 | Asparagine--tRNA ligase, | yes | no | 0.997 | 0.625 | 0.685 | 1e-148 | |
| Q9SSK1 | 571 | Asparagine--tRNA ligase, | no | no | 0.969 | 0.609 | 0.698 | 1e-146 | |
| Q9SW95 | 638 | Asparagine--tRNA ligase, | no | no | 0.793 | 0.446 | 0.447 | 9e-64 | |
| O48593 | 567 | Asparagine--tRNA ligase, | no | no | 0.749 | 0.474 | 0.415 | 2e-62 | |
| B3H198 | 467 | Asparagine--tRNA ligase O | yes | no | 0.662 | 0.509 | 0.398 | 6e-50 | |
| A3N039 | 467 | Asparagine--tRNA ligase O | yes | no | 0.662 | 0.509 | 0.398 | 6e-50 | |
| Q7N622 | 466 | Asparagine--tRNA ligase O | yes | no | 0.662 | 0.510 | 0.385 | 8e-50 | |
| Q7VLL7 | 467 | Asparagine--tRNA ligase O | yes | no | 0.679 | 0.522 | 0.390 | 4e-49 | |
| Q662R1 | 462 | Asparagine--tRNA ligase O | yes | no | 0.682 | 0.530 | 0.361 | 8e-48 | |
| P43829 | 467 | Asparagine--tRNA ligase O | yes | no | 0.662 | 0.509 | 0.379 | 1e-46 |
| >sp|Q9SW96|SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana GN=SYNC1 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 524 bits (1349), Expect = e-148, Method: Compositional matrix adjust.
Identities = 249/363 (68%), Positives = 308/363 (84%), Gaps = 5/363 (1%)
Query: 1 MADNELP-VDQVATMDLNDDA--VQRHQFSDRVLIKSILTRPDGGAGLAGRQVRVGGWVK 57
MAD +P Q+A + L +D VQR QFS+RVLI++IL RPDGGAGLAG+ VR+GGWVK
Sbjct: 1 MADEIVPPATQLAAVSLENDGSTVQRAQFSNRVLIRTILDRPDGGAGLAGQTVRIGGWVK 60
Query: 58 TGREQGKGSFAFLEVNDGSCPANLQVIVDKDVADLGQLVPTGTCVYVEGMLKNPPEG--T 115
+GR+QGK +F+FL VNDGSCPANLQV+VD + D+ LV TGTCV V+G+LK PP+G T
Sbjct: 61 SGRDQGKRTFSFLAVNDGSCPANLQVMVDPSLYDVSNLVATGTCVTVDGVLKVPPKGKGT 120
Query: 116 KQKIELRVQKVVDVGMVDPAKYPIPKTKLTLEFLRDRIPFRPRTNTIAAVARIRNALAYA 175
+Q+IEL V KV+DVG VD +KYP+PKTKLTLE LRD + R RTN+I+AVARIRNALA+A
Sbjct: 121 QQQIELNVVKVIDVGTVDASKYPLPKTKLTLETLRDVLHLRSRTNSISAVARIRNALAFA 180
Query: 176 THTFLQKQGFLYIHTPIITTSDCEGAGEMFQVTTLISDADKLEKELIKNPPPSEADIEAA 235
TH+F Q+ FLYIHTPIITTSDCEGAGEMFQ TTLI+ ++LE++LI NPPP+EAD+EAA
Sbjct: 181 THSFFQEHSFLYIHTPIITTSDCEGAGEMFQATTLINYTERLEQDLIDNPPPTEADVEAA 240
Query: 236 KLVIKEKGEAVAKLKSDKAGREAISASVTELTKAKENLAKLEERSKLKPGIPQKDGKIDY 295
+L++ E+G VA+LK+ KA +EAI+A+V EL AKE A ++ERS+L+PG+P+KDG IDY
Sbjct: 241 RLIVIERGNVVAELKAAKASKEAITAAVAELKIAKETFAHIDERSRLRPGLPKKDGNIDY 300
Query: 296 TQDFFARQAFLTVSGQLQVETYACAVSNVYTFGPTFRAEHSHTSRHLAEFWMVEPEMAFS 355
++DFF RQAFLTVSGQLQVETYACA+SNVYTFGPTFRAE+SHTSRHLAEFWMVEPE+AF+
Sbjct: 301 SKDFFGRQAFLTVSGQLQVETYACALSNVYTFGPTFRAENSHTSRHLAEFWMVEPEIAFA 360
Query: 356 DLK 358
DL+
Sbjct: 361 DLE 363
|
Potentially protective antigen in lymphatic filariasis. Arabidopsis thaliana (taxid: 3702) EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 2 |
| >sp|Q9SSK1|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3 OS=Arabidopsis thaliana GN=SYNC3 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SW95|SYNC2_ARATH Asparagine--tRNA ligase, cytoplasmic 2 OS=Arabidopsis thaliana GN=SYNC2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O48593|SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SYNO PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|B3H198|SYN_ACTP7 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=asnS PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A3N039|SYN_ACTP2 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=asnS PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q7N622|SYN_PHOLL Asparagine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=asnS PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q7VLL7|SYN_HAEDU Asparagine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=asnS PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q662R1|SYN_BORGA Asparagine--tRNA ligase OS=Borrelia garinii (strain PBi) GN=asnS PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P43829|SYN_HAEIN Asparagine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=asnS PE=3 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 359 | ||||||
| 359484512 | 571 | PREDICTED: asparaginyl-tRNA synthetase, | 0.997 | 0.626 | 0.814 | 1e-171 | |
| 224122518 | 568 | predicted protein [Populus trichocarpa] | 0.980 | 0.619 | 0.772 | 1e-160 | |
| 449435754 | 572 | PREDICTED: asparagine--tRNA ligase, cyto | 0.980 | 0.615 | 0.738 | 1e-157 | |
| 357520761 | 551 | Asparaginyl-tRNA synthetase [Medicago tr | 0.947 | 0.617 | 0.75 | 1e-152 | |
| 388490616 | 551 | unknown [Medicago truncatula] | 0.947 | 0.617 | 0.747 | 1e-151 | |
| 356513201 | 567 | PREDICTED: asparaginyl-tRNA synthetase, | 0.991 | 0.627 | 0.713 | 1e-149 | |
| 356523733 | 567 | PREDICTED: asparaginyl-tRNA synthetase, | 0.991 | 0.627 | 0.702 | 1e-148 | |
| 297793179 | 572 | EMB2755 [Arabidopsis lyrata subsp. lyrat | 0.980 | 0.615 | 0.713 | 1e-147 | |
| 15241897 | 572 | asparaginyl-tRNA synthetase, cytoplasmic | 0.997 | 0.625 | 0.685 | 1e-146 | |
| 15223302 | 571 | asparaginyl-tRNA synthetase, cytoplasmic | 0.969 | 0.609 | 0.698 | 1e-144 |
| >gi|359484512|ref|XP_003633115.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 606 bits (1563), Expect = e-171, Method: Compositional matrix adjust.
Identities = 295/362 (81%), Positives = 328/362 (90%), Gaps = 4/362 (1%)
Query: 1 MADNELP-VDQVATMDLNDDAVQ---RHQFSDRVLIKSILTRPDGGAGLAGRQVRVGGWV 56
MA++ +P VDQ+A LNDD + QFSDR LI++IL+RPDGGAGLAG+ V+VGGWV
Sbjct: 1 MAEDSVPPVDQMALATLNDDVSTPFVKAQFSDRHLIRTILSRPDGGAGLAGQTVKVGGWV 60
Query: 57 KTGREQGKGSFAFLEVNDGSCPANLQVIVDKDVADLGQLVPTGTCVYVEGMLKNPPEGTK 116
KTGREQGKGSFAFLE+NDGSCPANLQVIVD VA LGQLV TGTCV+VEG+LK PPEGTK
Sbjct: 61 KTGREQGKGSFAFLELNDGSCPANLQVIVDAAVAPLGQLVQTGTCVHVEGLLKVPPEGTK 120
Query: 117 QKIELRVQKVVDVGMVDPAKYPIPKTKLTLEFLRDRIPFRPRTNTIAAVARIRNALAYAT 176
Q++ELRV+KV VG VDPAKYP+PKT+LTLEFLRD + FRPRTNTI+AVARIRNALAYAT
Sbjct: 121 QRVELRVEKVHHVGPVDPAKYPLPKTRLTLEFLRDFVHFRPRTNTISAVARIRNALAYAT 180
Query: 177 HTFLQKQGFLYIHTPIITTSDCEGAGEMFQVTTLISDADKLEKELIKNPPPSEADIEAAK 236
HTF Q GFLYIHTPIITTSDCEGAGEMFQVTTLISDA+K+EKELIKNPPPSEADIEAAK
Sbjct: 181 HTFFQNHGFLYIHTPIITTSDCEGAGEMFQVTTLISDAEKVEKELIKNPPPSEADIEAAK 240
Query: 237 LVIKEKGEAVAKLKSDKAGREAISASVTELTKAKENLAKLEERSKLKPGIPQKDGKIDYT 296
++KEKGEAVA+LKS KA + I+ASV EL KAKENL++LEERSKLKPGIPQKDGKIDY+
Sbjct: 241 ALVKEKGEAVAQLKSAKASKGEITASVAELNKAKENLSRLEERSKLKPGIPQKDGKIDYS 300
Query: 297 QDFFARQAFLTVSGQLQVETYACAVSNVYTFGPTFRAEHSHTSRHLAEFWMVEPEMAFSD 356
QDFFARQAFLTVSGQLQVETYACAVS+VYTFGPTFRAEHSHTSRHLAEFWMVEPE+AF+D
Sbjct: 301 QDFFARQAFLTVSGQLQVETYACAVSSVYTFGPTFRAEHSHTSRHLAEFWMVEPEIAFAD 360
Query: 357 LK 358
LK
Sbjct: 361 LK 362
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224122518|ref|XP_002330501.1| predicted protein [Populus trichocarpa] gi|222872435|gb|EEF09566.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449435754|ref|XP_004135659.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic 1-like [Cucumis sativus] gi|449485808|ref|XP_004157279.1| PREDICTED: asparagine--tRNA ligase, cytoplasmic 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357520761|ref|XP_003630669.1| Asparaginyl-tRNA synthetase [Medicago truncatula] gi|355524691|gb|AET05145.1| Asparaginyl-tRNA synthetase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388490616|gb|AFK33374.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356513201|ref|XP_003525302.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356523733|ref|XP_003530489.1| PREDICTED: asparaginyl-tRNA synthetase, cytoplasmic 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297793179|ref|XP_002864474.1| EMB2755 [Arabidopsis lyrata subsp. lyrata] gi|297310309|gb|EFH40733.1| EMB2755 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15241897|ref|NP_200479.1| asparaginyl-tRNA synthetase, cytoplasmic 1 [Arabidopsis thaliana] gi|20140329|sp|Q9SW96.1|SYNC1_ARATH RecName: Full=Asparagine--tRNA ligase, cytoplasmic 1; AltName: Full=Asparaginyl-tRNA synthetase 1; Short=AsnRS 1; AltName: Full=Protein EMBRYO DEFECTIVE 2755 gi|5670315|gb|AAD46681.1|AF170909_1 SYNC1 protein [Arabidopsis thaliana] gi|10176772|dbj|BAB09886.1| SYNC1 protein [Arabidopsis thaliana] gi|133778862|gb|ABO38771.1| At5g56680 [Arabidopsis thaliana] gi|332009412|gb|AED96795.1| asparaginyl-tRNA synthetase, cytoplasmic 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15223302|ref|NP_177254.1| asparaginyl-tRNA synthetase, cytoplasmic 3 [Arabidopsis thaliana] gi|20140327|sp|Q9SSK1.1|SYNC3_ARATH RecName: Full=Asparagine--tRNA ligase, cytoplasmic 3; AltName: Full=Asparaginyl-tRNA synthetase 3; Short=AsnRS 3 gi|5902407|gb|AAD55509.1|AC008148_19 Similar to asparaginyl-tRNA synthetases [Arabidopsis thaliana] gi|332197025|gb|AEE35146.1| asparaginyl-tRNA synthetase, cytoplasmic 3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 359 | ||||||
| TAIR|locus:2165001 | 572 | SYNC1 [Arabidopsis thaliana (t | 0.997 | 0.625 | 0.685 | 2.7e-132 | |
| TAIR|locus:2014005 | 571 | SYNC3 [Arabidopsis thaliana (t | 0.969 | 0.609 | 0.698 | 1.7e-130 | |
| TAIR|locus:2079646 | 638 | NS2 "asparaginyl-tRNA syntheta | 0.793 | 0.446 | 0.447 | 4.2e-71 | |
| TAIR|locus:2130804 | 567 | NS1 [Arabidopsis thaliana (tax | 0.509 | 0.322 | 0.465 | 1.8e-68 | |
| TIGR_CMR|GSU_1156 | 461 | GSU_1156 "asparaginyl-tRNA syn | 0.484 | 0.377 | 0.497 | 1.4e-64 | |
| UNIPROTKB|Q9KSF9 | 466 | asnS "Asparagine--tRNA ligase" | 0.462 | 0.356 | 0.420 | 1.1e-58 | |
| TIGR_CMR|VC_1297 | 466 | VC_1297 "asparaginyl-tRNA synt | 0.462 | 0.356 | 0.420 | 1.1e-58 | |
| TIGR_CMR|CPS_2591 | 466 | CPS_2591 "asparaginyl-tRNA syn | 0.504 | 0.388 | 0.404 | 4.8e-58 | |
| TIGR_CMR|SO_2218 | 466 | SO_2218 "asparaginyl-tRNA synt | 0.484 | 0.373 | 0.423 | 6.1e-58 | |
| UNIPROTKB|P0A8M0 | 466 | asnS "asparaginyl-tRNA synthet | 0.465 | 0.358 | 0.422 | 1.6e-57 |
| TAIR|locus:2165001 SYNC1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1297 (461.6 bits), Expect = 2.7e-132, P = 2.7e-132
Identities = 249/363 (68%), Positives = 308/363 (84%)
Query: 1 MADNELP-VDQVATMDLNDDA--VQRHQFSDRVLIKSILTRPDGGAGLAGRQVRVGGWVK 57
MAD +P Q+A + L +D VQR QFS+RVLI++IL RPDGGAGLAG+ VR+GGWVK
Sbjct: 1 MADEIVPPATQLAAVSLENDGSTVQRAQFSNRVLIRTILDRPDGGAGLAGQTVRIGGWVK 60
Query: 58 TGREQGKGSFAFLEVNDGSCPANLQVIVDKDVADLGQLVPTGTCVYVEGMLKNPPEG--T 115
+GR+QGK +F+FL VNDGSCPANLQV+VD + D+ LV TGTCV V+G+LK PP+G T
Sbjct: 61 SGRDQGKRTFSFLAVNDGSCPANLQVMVDPSLYDVSNLVATGTCVTVDGVLKVPPKGKGT 120
Query: 116 KQKIELRVQKVVDVGMVDPAKYPIPKTKLTLEFLRDRIPFRPRTNTIAAVARIRNALAYA 175
+Q+IEL V KV+DVG VD +KYP+PKTKLTLE LRD + R RTN+I+AVARIRNALA+A
Sbjct: 121 QQQIELNVVKVIDVGTVDASKYPLPKTKLTLETLRDVLHLRSRTNSISAVARIRNALAFA 180
Query: 176 THTFLQKQGFLYIHTPIITTSDCEGAGEMFQVTTLISDADKLEKELIKNPPPSEADIEAA 235
TH+F Q+ FLYIHTPIITTSDCEGAGEMFQ TTLI+ ++LE++LI NPPP+EAD+EAA
Sbjct: 181 THSFFQEHSFLYIHTPIITTSDCEGAGEMFQATTLINYTERLEQDLIDNPPPTEADVEAA 240
Query: 236 KLVIKEKGEAVAKLKSDKAGREAISASVTELTKAKENLAKLEERSKLKPGIPQKDGKIDY 295
+L++ E+G VA+LK+ KA +EAI+A+V EL AKE A ++ERS+L+PG+P+KDG IDY
Sbjct: 241 RLIVIERGNVVAELKAAKASKEAITAAVAELKIAKETFAHIDERSRLRPGLPKKDGNIDY 300
Query: 296 TQDFFARQAFLTVSGQLQVETYACAVSNVYTFGPTFRAEHSHTSRHLAEFWMVEPEMAFS 355
++DFF RQAFLTVSGQLQVETYACA+SNVYTFGPTFRAE+SHTSRHLAEFWMVEPE+AF+
Sbjct: 301 SKDFFGRQAFLTVSGQLQVETYACALSNVYTFGPTFRAENSHTSRHLAEFWMVEPEIAFA 360
Query: 356 DLK 358
DL+
Sbjct: 361 DLE 363
|
|
| TAIR|locus:2014005 SYNC3 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2079646 NS2 "asparaginyl-tRNA synthetase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130804 NS1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1156 GSU_1156 "asparaginyl-tRNA synthetase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KSF9 asnS "Asparagine--tRNA ligase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1297 VC_1297 "asparaginyl-tRNA synthetase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2591 CPS_2591 "asparaginyl-tRNA synthetase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_2218 SO_2218 "asparaginyl-tRNA synthetase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A8M0 asnS "asparaginyl-tRNA synthetase" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9SW96 | SYNC1_ARATH | 6, ., 1, ., 1, ., 2, 2 | 0.6859 | 0.9972 | 0.6258 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 4th Layer | 6.1.1.22 | 0.914 |
| 3rd Layer | 6.1.1 | 0.921 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 359 | |||
| PLN02221 | 572 | PLN02221, PLN02221, asparaginyl-tRNA synthetase | 0.0 | |
| PLN02532 | 633 | PLN02532, PLN02532, asparagine-tRNA synthetase | 1e-105 | |
| PTZ00425 | 586 | PTZ00425, PTZ00425, asparagine-tRNA ligase; Provis | 5e-80 | |
| PRK03932 | 450 | PRK03932, asnC, asparaginyl-tRNA synthetase; Valid | 2e-67 | |
| PLN02603 | 565 | PLN02603, PLN02603, asparaginyl-tRNA synthetase | 1e-57 | |
| TIGR00457 | 453 | TIGR00457, asnS, asparaginyl-tRNA synthetase | 9e-53 | |
| COG0017 | 435 | COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetas | 3e-43 | |
| PRK03932 | 450 | PRK03932, asnC, asparaginyl-tRNA synthetase; Valid | 3e-42 | |
| TIGR00457 | 453 | TIGR00457, asnS, asparaginyl-tRNA synthetase | 1e-34 | |
| PLN02603 | 565 | PLN02603, PLN02603, asparaginyl-tRNA synthetase | 4e-33 | |
| cd00776 | 322 | cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/As | 2e-30 | |
| COG0017 | 435 | COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetas | 1e-27 | |
| cd04318 | 82 | cd04318, EcAsnRS_like_N, EcAsnRS_like_N: N-termina | 2e-26 | |
| cd00776 | 322 | cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/As | 8e-17 | |
| pfam00152 | 345 | pfam00152, tRNA-synt_2, tRNA synthetases class II | 2e-14 | |
| PRK05159 | 437 | PRK05159, aspC, aspartyl-tRNA synthetase; Provisio | 2e-11 | |
| cd04100 | 85 | cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-ter | 4e-11 | |
| PRK05159 | 437 | PRK05159, aspC, aspartyl-tRNA synthetase; Provisio | 3e-10 | |
| pfam01336 | 75 | pfam01336, tRNA_anti, OB-fold nucleic acid binding | 1e-08 | |
| PLN02532 | 633 | PLN02532, PLN02532, asparagine-tRNA synthetase | 3e-08 | |
| pfam00152 | 345 | pfam00152, tRNA-synt_2, tRNA synthetases class II | 4e-08 | |
| TIGR00458 | 428 | TIGR00458, aspS_nondisc, nondiscriminating asparty | 1e-07 | |
| TIGR00458 | 428 | TIGR00458, aspS_nondisc, nondiscriminating asparty | 2e-07 | |
| PLN02850 | 530 | PLN02850, PLN02850, aspartate-tRNA ligase | 3e-06 | |
| cd04323 | 84 | cd04323, AsnRS_cyto_like_N, AsnRS_cyto_like_N: N-t | 1e-05 | |
| COG0173 | 585 | COG0173, AspS, Aspartyl-tRNA synthetase [Translati | 1e-05 | |
| smart00991 | 56 | smart00991, WHEP-TRS, A conserved domain of 46 ami | 2e-05 | |
| PRK00476 | 588 | PRK00476, aspS, aspartyl-tRNA synthetase; Validate | 3e-05 | |
| PLN02850 | 530 | PLN02850, PLN02850, aspartate-tRNA ligase | 4e-05 | |
| PTZ00401 | 550 | PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Prov | 1e-04 | |
| PTZ00401 | 550 | PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Prov | 2e-04 | |
| cd00669 | 269 | cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA syn | 2e-04 | |
| PRK06462 | 335 | PRK06462, PRK06462, asparagine synthetase A; Revie | 2e-04 | |
| TIGR00459 | 583 | TIGR00459, aspS_bact, aspartyl-tRNA synthetase, ba | 4e-04 | |
| PLN02903 | 652 | PLN02903, PLN02903, aminoacyl-tRNA ligase | 5e-04 | |
| cd04319 | 103 | cd04319, PhAsnRS_like_N, PhAsnRS_like_N: N-termina | 0.001 | |
| cd00777 | 280 | cd00777, AspRS_core, Asp tRNA synthetase (aspRS) c | 0.001 | |
| PRK12820 | 706 | PRK12820, PRK12820, bifunctional aspartyl-tRNA syn | 0.002 | |
| cd01200 | 42 | cd01200, WHEPGMRS_RNA, EPRS-like_RNA binding domai | 0.003 | |
| pfam00458 | 56 | pfam00458, WHEP-TRS, WHEP-TRS domain | 0.004 |
| >gnl|CDD|177867 PLN02221, PLN02221, asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
Score = 600 bits (1549), Expect = 0.0
Identities = 266/363 (73%), Positives = 318/363 (87%), Gaps = 5/363 (1%)
Query: 1 MADNELP-VDQVATMDLNDDA--VQRHQFSDRVLIKSILTRPDGGAGLAGRQVRVGGWVK 57
M D +P +Q+A + L +D VQ+ QFSDRVLI+SIL RPDGGAGLAG++VR+GGWVK
Sbjct: 1 MGDEIVPPANQLAAVSLENDGSTVQKAQFSDRVLIRSILDRPDGGAGLAGQKVRIGGWVK 60
Query: 58 TGREQGKGSFAFLEVNDGSCPANLQVIVDKDVADLGQLVPTGTCVYVEGMLKNPPE--GT 115
TGREQGKG+FAFLEVNDGSCPANLQV+VD + DL LV TGTCV V+G+LK PPE GT
Sbjct: 61 TGREQGKGTFAFLEVNDGSCPANLQVMVDSSLYDLSTLVATGTCVTVDGVLKVPPEGKGT 120
Query: 116 KQKIELRVQKVVDVGMVDPAKYPIPKTKLTLEFLRDRIPFRPRTNTIAAVARIRNALAYA 175
KQKIEL V+KV+DVG VDP KYP+PKTKLTLEFLRD + R RTN+I+AVARIRNALA+A
Sbjct: 121 KQKIELSVEKVIDVGTVDPTKYPLPKTKLTLEFLRDVLHLRSRTNSISAVARIRNALAFA 180
Query: 176 THTFLQKQGFLYIHTPIITTSDCEGAGEMFQVTTLISDADKLEKELIKNPPPSEADIEAA 235
TH+F Q+ FLYIHTPIITTSDCEGAGEMFQVTTLI+ ++LE++LI NPPP+EAD+EAA
Sbjct: 181 THSFFQEHSFLYIHTPIITTSDCEGAGEMFQVTTLINYTERLEQDLIDNPPPTEADVEAA 240
Query: 236 KLVIKEKGEAVAKLKSDKAGREAISASVTELTKAKENLAKLEERSKLKPGIPQKDGKIDY 295
+L++KE+GE VA+LK+ KA +E I+A+V EL AKE+LA +EERSKLKPG+P+KDGKIDY
Sbjct: 241 RLIVKERGEVVAQLKAAKASKEEITAAVAELKIAKESLAHIEERSKLKPGLPKKDGKIDY 300
Query: 296 TQDFFARQAFLTVSGQLQVETYACAVSNVYTFGPTFRAEHSHTSRHLAEFWMVEPEMAFS 355
++DFF RQAFLTVSGQLQVETYACA+S+VYTFGPTFRAE+SHTSRHLAEFWMVEPE+AF+
Sbjct: 301 SKDFFGRQAFLTVSGQLQVETYACALSSVYTFGPTFRAENSHTSRHLAEFWMVEPEIAFA 360
Query: 356 DLK 358
DL+
Sbjct: 361 DLE 363
|
Length = 572 |
| >gnl|CDD|215291 PLN02532, PLN02532, asparagine-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|240414 PTZ00425, PTZ00425, asparagine-tRNA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235176 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178213 PLN02603, PLN02603, asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|232982 TIGR00457, asnS, asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|223096 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235176 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|232982 TIGR00457, asnS, asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|178213 PLN02603, PLN02603, asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|238399 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) class II core domain | Back alignment and domain information |
|---|
| >gnl|CDD|223096 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239813 cd04318, EcAsnRS_like_N, EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS | Back alignment and domain information |
|---|
| >gnl|CDD|238399 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) class II core domain | Back alignment and domain information |
|---|
| >gnl|CDD|215753 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K and N) | Back alignment and domain information |
|---|
| >gnl|CDD|235354 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239766 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) | Back alignment and domain information |
|---|
| >gnl|CDD|235354 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216440 pfam01336, tRNA_anti, OB-fold nucleic acid binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215291 PLN02532, PLN02532, asparagine-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|215753 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K and N) | Back alignment and domain information |
|---|
| >gnl|CDD|129550 TIGR00458, aspS_nondisc, nondiscriminating aspartyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|129550 TIGR00458, aspS_nondisc, nondiscriminating aspartyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|215456 PLN02850, PLN02850, aspartate-tRNA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|239818 cd04323, AsnRS_cyto_like_N, AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs | Back alignment and domain information |
|---|
| >gnl|CDD|223251 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|214960 smart00991, WHEP-TRS, A conserved domain of 46 amino acids, called WHEP-TRS has been shown | Back alignment and domain information |
|---|
| >gnl|CDD|234775 PRK00476, aspS, aspartyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215456 PLN02850, PLN02850, aspartate-tRNA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|173592 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173592 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238358 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >gnl|CDD|235808 PRK06462, PRK06462, asparagine synthetase A; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|211576 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|215490 PLN02903, PLN02903, aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|239814 cd04319, PhAsnRS_like_N, PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) | Back alignment and domain information |
|---|
| >gnl|CDD|238400 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class II core domain | Back alignment and domain information |
|---|
| >gnl|CDD|105955 PRK12820, PRK12820, bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238605 cd01200, WHEPGMRS_RNA, EPRS-like_RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215929 pfam00458, WHEP-TRS, WHEP-TRS domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 359 | |||
| PLN02221 | 572 | asparaginyl-tRNA synthetase | 100.0 | |
| PLN02532 | 633 | asparagine-tRNA synthetase | 100.0 | |
| PLN02603 | 565 | asparaginyl-tRNA synthetase | 100.0 | |
| COG0017 | 435 | AsnS Aspartyl/asparaginyl-tRNA synthetases [Transl | 100.0 | |
| PTZ00425 | 586 | asparagine-tRNA ligase; Provisional | 100.0 | |
| KOG0554 | 446 | consensus Asparaginyl-tRNA synthetase (mitochondri | 100.0 | |
| PRK03932 | 450 | asnC asparaginyl-tRNA synthetase; Validated | 100.0 | |
| TIGR00457 | 453 | asnS asparaginyl-tRNA synthetase. In a multiple se | 100.0 | |
| TIGR00458 | 428 | aspS_arch aspartyl-tRNA synthetase, archaeal type. | 100.0 | |
| PRK05159 | 437 | aspC aspartyl-tRNA synthetase; Provisional | 100.0 | |
| PLN02850 | 530 | aspartate-tRNA ligase | 100.0 | |
| PTZ00401 | 550 | aspartyl-tRNA synthetase; Provisional | 100.0 | |
| COG0173 | 585 | AspS Aspartyl-tRNA synthetase [Translation, riboso | 100.0 | |
| PRK12820 | 706 | bifunctional aspartyl-tRNA synthetase/aspartyl/glu | 100.0 | |
| TIGR00459 | 583 | aspS_bact aspartyl-tRNA synthetase, bacterial type | 100.0 | |
| PRK00476 | 588 | aspS aspartyl-tRNA synthetase; Validated | 100.0 | |
| PLN02903 | 652 | aminoacyl-tRNA ligase | 100.0 | |
| KOG0556 | 533 | consensus Aspartyl-tRNA synthetase [Translation, r | 100.0 | |
| PRK00484 | 491 | lysS lysyl-tRNA synthetase; Reviewed | 100.0 | |
| PLN02502 | 553 | lysyl-tRNA synthetase | 100.0 | |
| TIGR00499 | 496 | lysS_bact lysyl-tRNA synthetase, eukaryotic and no | 100.0 | |
| PRK12445 | 505 | lysyl-tRNA synthetase; Reviewed | 100.0 | |
| PTZ00385 | 659 | lysyl-tRNA synthetase; Provisional | 100.0 | |
| PTZ00417 | 585 | lysine-tRNA ligase; Provisional | 100.0 | |
| PRK02983 | 1094 | lysS lysyl-tRNA synthetase; Provisional | 100.0 | |
| KOG0555 | 545 | consensus Asparaginyl-tRNA synthetase [Translation | 100.0 | |
| KOG1885 | 560 | consensus Lysyl-tRNA synthetase (class II) [Transl | 100.0 | |
| COG1190 | 502 | LysU Lysyl-tRNA synthetase (class II) [Translation | 100.0 | |
| KOG2411 | 628 | consensus Aspartyl-tRNA synthetase, mitochondrial | 100.0 | |
| PF00152 | 335 | tRNA-synt_2: tRNA synthetases class II (D, K and N | 100.0 | |
| cd00776 | 322 | AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class | 100.0 | |
| PRK06462 | 335 | asparagine synthetase A; Reviewed | 100.0 | |
| cd00775 | 329 | LysRS_core Lys_tRNA synthetase (LysRS) class II co | 99.96 | |
| TIGR00462 | 304 | genX lysyl-tRNA synthetase-like protein GenX. Many | 99.95 | |
| cd00669 | 269 | Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl | 99.94 | |
| cd00777 | 280 | AspRS_core Asp tRNA synthetase (aspRS) class II co | 99.94 | |
| PRK09350 | 306 | poxB regulator PoxA; Provisional | 99.92 | |
| cd04317 | 135 | EcAspRS_like_N EcAspRS_like_N: N-terminal, anticod | 99.87 | |
| cd04322 | 108 | LysRS_N LysRS_N: N-terminal, anticodon recognition | 99.83 | |
| cd04319 | 103 | PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticod | 99.83 | |
| cd04316 | 108 | ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, a | 99.81 | |
| cd04320 | 102 | AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon r | 99.75 | |
| COG2269 | 322 | Truncated, possibly inactive, lysyl-tRNA synthetas | 99.7 | |
| cd04318 | 82 | EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticod | 99.69 | |
| cd04323 | 84 | AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, a | 99.66 | |
| cd04321 | 86 | ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, a | 99.66 | |
| cd04100 | 85 | Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, ant | 99.65 | |
| PF01336 | 75 | tRNA_anti-codon: OB-fold nucleic acid binding doma | 99.08 | |
| PRK09537 | 417 | pylS pyrolysyl-tRNA synthetase; Reviewed | 98.81 | |
| cd00768 | 211 | class_II_aaRS-like_core Class II tRNA amino-acyl s | 98.55 | |
| TIGR02367 | 453 | PylS pyrrolysyl-tRNA synthetase. PylS is the archa | 98.33 | |
| cd00773 | 261 | HisRS-like_core Class II Histidinyl-tRNA synthetas | 97.84 | |
| PF00587 | 173 | tRNA-synt_2b: tRNA synthetase class II core domain | 97.78 | |
| cd00779 | 255 | ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla | 97.61 | |
| cd00670 | 235 | Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t | 97.57 | |
| PRK00037 | 412 | hisS histidyl-tRNA synthetase; Reviewed | 97.47 | |
| TIGR00442 | 397 | hisS histidyl-tRNA synthetase. This model finds a | 97.45 | |
| cd00774 | 254 | GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik | 97.41 | |
| cd04489 | 78 | ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB fol | 97.33 | |
| PRK09194 | 565 | prolyl-tRNA synthetase; Provisional | 97.29 | |
| cd04478 | 95 | RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds cor | 97.16 | |
| cd00771 | 298 | ThrRS_core Threonyl-tRNA synthetase (ThrRS) class | 97.15 | |
| TIGR00409 | 568 | proS_fam_II prolyl-tRNA synthetase, family II. Pro | 97.12 | |
| PRK00413 | 638 | thrS threonyl-tRNA synthetase; Reviewed | 97.08 | |
| PRK12305 | 575 | thrS threonyl-tRNA synthetase; Reviewed | 97.08 | |
| cd00772 | 264 | ProRS_core Prolyl-tRNA synthetase (ProRS) class II | 97.08 | |
| TIGR00443 | 314 | hisZ_biosyn_reg ATP phosphoribosyltransferase, reg | 97.07 | |
| cd00496 | 218 | PheRS_alpha_core Phenylalanyl-tRNA synthetase (Phe | 96.99 | |
| CHL00201 | 430 | syh histidine-tRNA synthetase; Provisional | 96.98 | |
| cd00778 | 261 | ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) | 96.96 | |
| cd04487 | 73 | RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB f | 96.94 | |
| COG0124 | 429 | HisS Histidyl-tRNA synthetase [Translation, riboso | 96.92 | |
| cd04483 | 92 | hOBFC1_like hOBFC1_like: A subfamily of OB folds s | 96.85 | |
| PF13742 | 99 | tRNA_anti_2: OB-fold nucleic acid binding domain | 96.82 | |
| PLN02530 | 487 | histidine-tRNA ligase | 96.81 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.8 | |
| PRK12292 | 391 | hisZ ATP phosphoribosyltransferase regulatory subu | 96.77 | |
| TIGR00414 | 418 | serS seryl-tRNA synthetase. This model represents | 96.69 | |
| TIGR00418 | 563 | thrS threonyl-tRNA synthetase. This model represen | 96.67 | |
| cd00770 | 297 | SerRS_core Seryl-tRNA synthetase (SerRS) class II | 96.63 | |
| PRK04172 | 489 | pheS phenylalanyl-tRNA synthetase subunit alpha; P | 96.63 | |
| cd04485 | 84 | DnaE_OBF DnaE_OBF: A subfamily of OB folds corresp | 96.6 | |
| PF13393 | 311 | tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI | 96.55 | |
| cd04492 | 83 | YhaM_OBF_like YhaM_OBF_like: A subfamily of OB fol | 96.52 | |
| PRK08661 | 477 | prolyl-tRNA synthetase; Provisional | 96.51 | |
| PRK12420 | 423 | histidyl-tRNA synthetase; Provisional | 96.5 | |
| PRK12293 | 281 | hisZ ATP phosphoribosyltransferase regulatory subu | 96.49 | |
| PRK12325 | 439 | prolyl-tRNA synthetase; Provisional | 96.48 | |
| PTZ00326 | 494 | phenylalanyl-tRNA synthetase alpha chain; Provisio | 96.47 | |
| PRK12444 | 639 | threonyl-tRNA synthetase; Reviewed | 96.45 | |
| PLN02972 | 763 | Histidyl-tRNA synthetase | 96.44 | |
| cd03524 | 75 | RPA2_OBF_family RPA2_OBF_family: A family of oligo | 96.44 | |
| PF01409 | 247 | tRNA-synt_2d: tRNA synthetases class II core domai | 96.37 | |
| PRK00488 | 339 | pheS phenylalanyl-tRNA synthetase subunit alpha; V | 96.29 | |
| TIGR00408 | 472 | proS_fam_I prolyl-tRNA synthetase, family I. Proly | 96.25 | |
| PRK12421 | 392 | ATP phosphoribosyltransferase regulatory subunit; | 96.25 | |
| PLN02853 | 492 | Probable phenylalanyl-tRNA synthetase alpha chain | 96.24 | |
| COG0016 | 335 | PheS Phenylalanyl-tRNA synthetase alpha subunit [T | 96.2 | |
| PLN02908 | 686 | threonyl-tRNA synthetase | 96.12 | |
| cd04490 | 79 | PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds | 96.09 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 96.03 | |
| cd04482 | 91 | RPA2_OBF_like RPA2_OBF_like: A subgroup of unchara | 95.98 | |
| TIGR00468 | 294 | pheS phenylalanyl-tRNA synthetase, alpha subunit. | 95.94 | |
| PRK14799 | 545 | thrS threonyl-tRNA synthetase; Provisional | 95.83 | |
| PRK07373 | 449 | DNA polymerase III subunit alpha; Reviewed | 95.82 | |
| PLN02837 | 614 | threonine-tRNA ligase | 95.64 | |
| PLN02788 | 402 | phenylalanine-tRNA synthetase | 95.63 | |
| PF10451 | 256 | Stn1: Telomere regulation protein Stn1; InterPro: | 95.62 | |
| PF04076 | 103 | BOF: Bacterial OB fold (BOF) protein; InterPro: IP | 95.3 | |
| TIGR00156 | 126 | conserved hypothetical protein TIGR00156. As of th | 95.23 | |
| COG4085 | 204 | Predicted RNA-binding protein, contains TRAM domai | 95.17 | |
| PRK12295 | 373 | hisZ ATP phosphoribosyltransferase regulatory subu | 95.11 | |
| PLN02678 | 448 | seryl-tRNA synthetase | 94.66 | |
| PRK06826 | 1151 | dnaE DNA polymerase III DnaE; Reviewed | 94.62 | |
| COG3111 | 128 | Periplasmic protein with OB-fold [Function unknown | 94.57 | |
| PRK04173 | 456 | glycyl-tRNA synthetase; Provisional | 94.57 | |
| PF12869 | 144 | tRNA_anti-like: tRNA_anti-like; InterPro: IPR02442 | 94.55 | |
| PRK05672 | 1046 | dnaE2 error-prone DNA polymerase; Validated | 94.5 | |
| COG5235 | 258 | RFA2 Single-stranded DNA-binding replication prote | 94.42 | |
| PRK03991 | 613 | threonyl-tRNA synthetase; Validated | 94.34 | |
| PRK07374 | 1170 | dnaE DNA polymerase III subunit alpha; Validated | 94.22 | |
| PRK10053 | 130 | hypothetical protein; Provisional | 94.21 | |
| PLN02320 | 502 | seryl-tRNA synthetase | 94.2 | |
| PRK06461 | 129 | single-stranded DNA-binding protein; Reviewed | 94.06 | |
| PRK06920 | 1107 | dnaE DNA polymerase III DnaE; Reviewed | 94.06 | |
| cd04488 | 75 | RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB f | 93.8 | |
| PRK15491 | 374 | replication factor A; Provisional | 93.63 | |
| PRK05673 | 1135 | dnaE DNA polymerase III subunit alpha; Validated | 93.53 | |
| cd04479 | 101 | RPA3 RPA3: A subfamily of OB folds similar to huma | 93.33 | |
| PRK13480 | 314 | 3'-5' exoribonuclease YhaM; Provisional | 93.26 | |
| PRK07279 | 1034 | dnaE DNA polymerase III DnaE; Reviewed | 92.86 | |
| cd04474 | 104 | RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds cor | 92.73 | |
| PF03100 | 131 | CcmE: CcmE; InterPro: IPR004329 CcmE is the produc | 92.66 | |
| KOG2784 | 483 | consensus Phenylalanyl-tRNA synthetase, beta subun | 92.17 | |
| cd04484 | 82 | polC_OBF polC_OBF: A subfamily of OB folds corresp | 92.0 | |
| PF08661 | 109 | Rep_fac-A_3: Replication factor A protein 3; Inter | 91.98 | |
| COG1570 | 440 | XseA Exonuclease VII, large subunit [DNA replicati | 91.93 | |
| PRK14699 | 484 | replication factor A; Provisional | 91.1 | |
| PRK00286 | 438 | xseA exodeoxyribonuclease VII large subunit; Revie | 91.03 | |
| cd04491 | 82 | SoSSB_OBF SoSSB_OBF: A subfamily of OB folds simil | 90.25 | |
| TIGR00237 | 432 | xseA exodeoxyribonuclease VII, large subunit. This | 89.97 | |
| PRK12366 | 637 | replication factor A; Reviewed | 89.68 | |
| PRK12294 | 272 | hisZ ATP phosphoribosyltransferase regulatory subu | 89.66 | |
| PRK15491 | 374 | replication factor A; Provisional | 89.35 | |
| PRK12366 | 637 | replication factor A; Reviewed | 89.06 | |
| PRK07459 | 121 | single-stranded DNA-binding protein; Provisional | 88.13 | |
| PRK08486 | 182 | single-stranded DNA-binding protein; Provisional | 87.74 | |
| PRK13254 | 148 | cytochrome c-type biogenesis protein CcmE; Reviewe | 87.56 | |
| PRK00960 | 517 | seryl-tRNA synthetase; Provisional | 87.56 | |
| COG0441 | 589 | ThrS Threonyl-tRNA synthetase [Translation, riboso | 87.41 | |
| COG3705 | 390 | HisZ ATP phosphoribosyltransferase involved in his | 87.05 | |
| PRK07211 | 485 | replication factor A; Reviewed | 86.99 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 86.91 | |
| PRK07275 | 162 | single-stranded DNA-binding protein; Provisional | 86.38 | |
| PF15072 | 86 | DUF4539: Domain of unknown function (DUF4539) | 86.37 | |
| TIGR00617 | 608 | rpa1 replication factor-a protein 1 (rpa1). This f | 86.23 | |
| PRK06863 | 168 | single-stranded DNA-binding protein; Provisional | 85.98 | |
| PRK06751 | 173 | single-stranded DNA-binding protein; Provisional | 85.68 | |
| KOG3108 | 265 | consensus Single-stranded DNA-binding replication | 85.48 | |
| PRK14699 | 484 | replication factor A; Provisional | 84.42 | |
| PRK06293 | 161 | single-stranded DNA-binding protein; Provisional | 84.37 | |
| PRK13150 | 159 | cytochrome c-type biogenesis protein CcmE; Reviewe | 84.28 | |
| PRK07135 | 973 | dnaE DNA polymerase III DnaE; Validated | 83.38 | |
| COG0172 | 429 | SerS Seryl-tRNA synthetase [Translation, ribosomal | 83.2 | |
| PRK13165 | 160 | cytochrome c-type biogenesis protein CcmE; Reviewe | 82.55 | |
| COG0442 | 500 | ProS Prolyl-tRNA synthetase [Translation, ribosoma | 82.49 | |
| PRK08402 | 355 | replication factor A; Reviewed | 81.41 | |
| PRK07217 | 311 | replication factor A; Reviewed | 81.33 | |
| TIGR00470 | 533 | sepS O-phosphoseryl-tRNA(Cys) synthetase. This fam | 80.64 | |
| PRK06386 | 358 | replication factor A; Reviewed | 80.62 | |
| PRK08763 | 164 | single-stranded DNA-binding protein; Provisional | 80.06 |
| >PLN02221 asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.1e-80 Score=641.03 Aligned_cols=358 Identities=74% Similarity=1.195 Sum_probs=323.7
Q ss_pred CCCCCC-Cccccccccccccc--ccccccccceeehhhhcCCCCCCCCCCCEEEEEEEEeecccCCCceeEEEEEecCCC
Q 018229 1 MADNEL-PVDQVATMDLNDDA--VQRHQFSDRVLIKSILTRPDGGAGLAGRQVRVGGWVKTGREQGKGSFAFLEVNDGSC 77 (359)
Q Consensus 1 ~~~~~~-~~~~~~~~~~~~~~--~~~~~~~~r~~i~di~~~~~l~~~~~gk~V~I~GwV~siR~~Gk~kl~Fi~LRDgsg 77 (359)
|.|.-. |.+|||+++++.++ +|-.+++.+++|++|+...+.+..++|+.|+|+|||+++|.+|+++++||+|||+++
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~V~I~GWV~~iR~~Gk~~i~Fl~LRDgs~ 80 (572)
T PLN02221 1 MGDEIVPPANQLAAVSLENDGSTVQKAQFSDRVLIRSILDRPDGGAGLAGQKVRIGGWVKTGREQGKGTFAFLEVNDGSC 80 (572)
T ss_pred CCCCCCChHHhhhheeccCCCcccccccccCceEHHHHhccccCChhcCCCEEEEEEEEEehhhCCCceEEEEEEeCCcc
Confidence 445444 56899999999987 344679999999999876666788999999999999999999942389999999995
Q ss_pred CceEEEEEeCChhhhccCCCCCcEEEEEeEEeCCCC--CCcccEEEEEeEEEEeecCCCCCCCCCCcCcchhhhccCcCc
Q 018229 78 PANLQVIVDKDVADLGQLVPTGTCVYVEGMLKNPPE--GTKQKIELRVQKVVDVGMVDPAKYPIPKTKLTLEFLRDRIPF 155 (359)
Q Consensus 78 ~~~lQVVv~~~~~~~~~~L~~esvV~V~G~v~~s~~--~~~g~lEL~a~~i~vLs~a~~~~~Pi~~k~~~~e~lr~~r~L 155 (359)
.+.||||+.++.....+.|+.||+|.|+|+|+.++. +++|++||++++|+|||++.+.+||++.+.++.|++|+++||
T Consensus 81 ~g~iQvVv~~~~~~~~~~L~~ES~V~V~G~V~~~~~~~~~~~~iEl~v~~i~vl~~a~~~~~Pi~~~~~~~e~lrr~~hL 160 (572)
T PLN02221 81 PANLQVMVDSSLYDLSTLVATGTCVTVDGVLKVPPEGKGTKQKIELSVEKVIDVGTVDPTKYPLPKTKLTLEFLRDVLHL 160 (572)
T ss_pred cccEEEEEcCchhhHHhcCCCceEEEEEEEEEeCCccCCCCccEEEEEeEEEEEecCCCCCCCCCCCcCChHHHhhcchh
Confidence 445999998764333346899999999999998763 256799999999999999975689999888899999999999
Q ss_pred cCCchHHHHHHHHHHHHHHHHHHHHHhCCcEEEccCeeecCCCCCCCCcceeeccccchhhhhhhhcCCCCCChhhHHHH
Q 018229 156 RPRTNTIAAVARIRNALAYATHTFLQKQGFLYIHTPIITTSDCEGAGEMFQVTTLISDADKLEKELIKNPPPSEADIEAA 235 (359)
Q Consensus 156 ~lR~~~~~ai~riRS~I~~~iR~fL~~~gF~EV~TPiLt~~~~EGa~e~F~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 235 (359)
|+|++.++++||+||.|.++||+||.++||+||+||+|++++||||+++|+|+|+.+..+..+....++++......||+
T Consensus 161 R~R~~~~~Ai~RiRS~i~~aiR~ff~~~gFiEI~TP~Lt~s~~EGg~e~F~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 240 (572)
T PLN02221 161 RSRTNSISAVARIRNALAFATHSFFQEHSFLYIHTPIITTSDCEGAGEMFQVTTLINYTERLEQDLIDNPPPTEADVEAA 240 (572)
T ss_pred hcCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEeCCeeccccCCCCccceeeeecccccccccccccccCcccchhhhhh
Confidence 99999999999999999999999999999999999999999999999999999887655556666777887777889999
Q ss_pred HHHHHHhhhHHHhhhcccchhhhhhhhHHHHHHHHHHHHHHHhhhccCCCCCCCCCCccccccccCccccccccHHHHHH
Q 018229 236 KLVIKEKGEAVAKLKSDKAGREAISASVTELTKAKENLAKLEERSKLKPGIPQKDGKIDYTQDFFARQAFLTVSGQLQVE 315 (359)
Q Consensus 236 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~f~~~~~L~~S~ql~~e 315 (359)
+++++++++.|+.|+++++|.|+++|++||+++|++..+.+|++++++++.|.+.|+..|+.||||+++||+||||||||
T Consensus 241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dyFg~~ayLtqS~QLy~e 320 (572)
T PLN02221 241 RLIVKERGEVVAQLKAAKASKEEITAAVAELKIAKESLAHIEERSKLKPGLPKKDGKIDYSKDFFGRQAFLTVSGQLQVE 320 (572)
T ss_pred hhhhhhhcchhhhhhccccchhhhhhhhhhhhhhhhhhhhhhhhhhcccCCcccccccccccccCCCCeeeccCHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHccccceEEEeceeecCCCCCCCccccccccceeecccCCC
Q 018229 316 TYACAVSNVYTFGPTFRAEHSHTSRHLAEFWMVEPEMAFSDLK 358 (359)
Q Consensus 316 ~~~~~~~~Vy~~~p~fRaE~~~t~rHl~EF~mle~E~af~~l~ 358 (359)
++++||+|||+|||+||||+++|+|||+||||||+||+|+|++
T Consensus 321 ~~~~~l~rVfeIgP~FRAE~s~T~RHL~EFtmlE~Emaf~d~~ 363 (572)
T PLN02221 321 TYACALSSVYTFGPTFRAENSHTSRHLAEFWMVEPEIAFADLE 363 (572)
T ss_pred HHHHhcCCeEEEccceecCCCCCCcccccccceeeeeecCCHH
Confidence 9999999999999999999999999999999999999999863
|
|
| >PLN02532 asparagine-tRNA synthetase | Back alignment and domain information |
|---|
| >PLN02603 asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00425 asparagine-tRNA ligase; Provisional | Back alignment and domain information |
|---|
| >KOG0554 consensus Asparaginyl-tRNA synthetase (mitochondrial) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK03932 asnC asparaginyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR00457 asnS asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type | Back alignment and domain information |
|---|
| >PRK05159 aspC aspartyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02850 aspartate-tRNA ligase | Back alignment and domain information |
|---|
| >PTZ00401 aspartyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional | Back alignment and domain information |
|---|
| >TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type | Back alignment and domain information |
|---|
| >PRK00476 aspS aspartyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >PLN02903 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >KOG0556 consensus Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00484 lysS lysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02502 lysyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial | Back alignment and domain information |
|---|
| >PRK12445 lysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00385 lysyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00417 lysine-tRNA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK02983 lysS lysyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0555 consensus Asparaginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1885 consensus Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2411 consensus Aspartyl-tRNA synthetase, mitochondrial [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00152 tRNA-synt_2: tRNA synthetases class II (D, K and N) ; InterPro: IPR004364 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain | Back alignment and domain information |
|---|
| >PRK06462 asparagine synthetase A; Reviewed | Back alignment and domain information |
|---|
| >cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain | Back alignment and domain information |
|---|
| >TIGR00462 genX lysyl-tRNA synthetase-like protein GenX | Back alignment and domain information |
|---|
| >cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain | Back alignment and domain information |
|---|
| >PRK09350 poxB regulator PoxA; Provisional | Back alignment and domain information |
|---|
| >cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS | Back alignment and domain information |
|---|
| >cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) | Back alignment and domain information |
|---|
| >cd04319 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) | Back alignment and domain information |
|---|
| >cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) | Back alignment and domain information |
|---|
| >cd04320 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) | Back alignment and domain information |
|---|
| >COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04318 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS | Back alignment and domain information |
|---|
| >cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs | Back alignment and domain information |
|---|
| >cd04321 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae mitochondrial (mt) aspartyl-tRNA synthetase (AspRS) | Back alignment and domain information |
|---|
| >cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) | Back alignment and domain information |
|---|
| >PF01336 tRNA_anti-codon: OB-fold nucleic acid binding domain; InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands | Back alignment and domain information |
|---|
| >PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain | Back alignment and domain information |
|---|
| >TIGR02367 PylS pyrrolysyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain | Back alignment and domain information |
|---|
| >PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes | Back alignment and domain information |
|---|
| >cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >PRK00037 hisS histidyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00442 hisS histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain | Back alignment and domain information |
|---|
| >cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit | Back alignment and domain information |
|---|
| >PRK09194 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) | Back alignment and domain information |
|---|
| >cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II | Back alignment and domain information |
|---|
| >PRK00413 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12305 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit | Back alignment and domain information |
|---|
| >cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain | Back alignment and domain information |
|---|
| >CHL00201 syh histidine-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ | Back alignment and domain information |
|---|
| >COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04483 hOBFC1_like hOBFC1_like: A subfamily of OB folds similar to that found in human OB fold containing protein 1 (hOBFC1) | Back alignment and domain information |
|---|
| >PF13742 tRNA_anti_2: OB-fold nucleic acid binding domain | Back alignment and domain information |
|---|
| >PLN02530 histidine-tRNA ligase | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00414 serS seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00418 thrS threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) | Back alignment and domain information |
|---|
| >PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A | Back alignment and domain information |
|---|
| >cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) | Back alignment and domain information |
|---|
| >PRK08661 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12420 histidyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12325 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional | Back alignment and domain information |
|---|
| >PRK12444 threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02972 Histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd03524 RPA2_OBF_family RPA2_OBF_family: A family of oligonucleotide binding (OB) folds with similarity to the OB fold of the single strand (ss) DNA-binding domain (DBD)-D of human RPA2 (also called RPA32) | Back alignment and domain information |
|---|
| >PF01409 tRNA-synt_2d: tRNA synthetases class II core domain (F); InterPro: IPR002319 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I | Back alignment and domain information |
|---|
| >PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain | Back alignment and domain information |
|---|
| >COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02908 threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) | Back alignment and domain information |
|---|
| >TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit | Back alignment and domain information |
|---|
| >PRK14799 thrS threonyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07373 DNA polymerase III subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN02837 threonine-tRNA ligase | Back alignment and domain information |
|---|
| >PLN02788 phenylalanine-tRNA synthetase | Back alignment and domain information |
|---|
| >PF10451 Stn1: Telomere regulation protein Stn1; InterPro: IPR018856 The budding yeast protein Stn1 is a DNA-binding protein which has specificity for telomeric DNA | Back alignment and domain information |
|---|
| >PF04076 BOF: Bacterial OB fold (BOF) protein; InterPro: IPR005220 Proteins in this entry have an OB-fold fold (oligonucleotide/oligosaccharide binding motif) | Back alignment and domain information |
|---|
| >TIGR00156 conserved hypothetical protein TIGR00156 | Back alignment and domain information |
|---|
| >COG4085 Predicted RNA-binding protein, contains TRAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02678 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK06826 dnaE DNA polymerase III DnaE; Reviewed | Back alignment and domain information |
|---|
| >COG3111 Periplasmic protein with OB-fold [Function unknown] | Back alignment and domain information |
|---|
| >PRK04173 glycyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF12869 tRNA_anti-like: tRNA_anti-like; InterPro: IPR024422 The function of the proteins in this entry is not known, but they contain a novel variant of the nucleic acid-binding OB fold [] | Back alignment and domain information |
|---|
| >PRK05672 dnaE2 error-prone DNA polymerase; Validated | Back alignment and domain information |
|---|
| >COG5235 RFA2 Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK03991 threonyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07374 dnaE DNA polymerase III subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK10053 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02320 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK06461 single-stranded DNA-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06920 dnaE DNA polymerase III DnaE; Reviewed | Back alignment and domain information |
|---|
| >cd04488 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG | Back alignment and domain information |
|---|
| >PRK15491 replication factor A; Provisional | Back alignment and domain information |
|---|
| >PRK05673 dnaE DNA polymerase III subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd04479 RPA3 RPA3: A subfamily of OB folds similar to human RPA3 (also called RPA14) | Back alignment and domain information |
|---|
| >PRK13480 3'-5' exoribonuclease YhaM; Provisional | Back alignment and domain information |
|---|
| >PRK07279 dnaE DNA polymerase III DnaE; Reviewed | Back alignment and domain information |
|---|
| >cd04474 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds corresponding to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70) | Back alignment and domain information |
|---|
| >PF03100 CcmE: CcmE; InterPro: IPR004329 CcmE is the product of one of a cluster of Ccm genes that are necessary for cytochrome c biosynthesis in eubacteria | Back alignment and domain information |
|---|
| >KOG2784 consensus Phenylalanyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04484 polC_OBF polC_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold nucleic acid binding domain of Bacillus subtilis type C replicative DNA polymerase III alpha subunit (polC) | Back alignment and domain information |
|---|
| >PF08661 Rep_fac-A_3: Replication factor A protein 3; InterPro: IPR013970 Replication factor A is involved in eukaryotic DNA replication, recombination and repair | Back alignment and domain information |
|---|
| >COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14699 replication factor A; Provisional | Back alignment and domain information |
|---|
| >PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04491 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds similar to the OB fold of the crenarchaeote Sulfolobus solfataricus single-stranded (ss) DNA-binding protein (SSoSSB) | Back alignment and domain information |
|---|
| >TIGR00237 xseA exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >PRK12366 replication factor A; Reviewed | Back alignment and domain information |
|---|
| >PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15491 replication factor A; Provisional | Back alignment and domain information |
|---|
| >PRK12366 replication factor A; Reviewed | Back alignment and domain information |
|---|
| >PRK07459 single-stranded DNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK08486 single-stranded DNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13254 cytochrome c-type biogenesis protein CcmE; Reviewed | Back alignment and domain information |
|---|
| >PRK00960 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07211 replication factor A; Reviewed | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK07275 single-stranded DNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF15072 DUF4539: Domain of unknown function (DUF4539) | Back alignment and domain information |
|---|
| >TIGR00617 rpa1 replication factor-a protein 1 (rpa1) | Back alignment and domain information |
|---|
| >PRK06863 single-stranded DNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06751 single-stranded DNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG3108 consensus Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14699 replication factor A; Provisional | Back alignment and domain information |
|---|
| >PRK06293 single-stranded DNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13150 cytochrome c-type biogenesis protein CcmE; Reviewed | Back alignment and domain information |
|---|
| >PRK07135 dnaE DNA polymerase III DnaE; Validated | Back alignment and domain information |
|---|
| >COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13165 cytochrome c-type biogenesis protein CcmE; Reviewed | Back alignment and domain information |
|---|
| >COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK08402 replication factor A; Reviewed | Back alignment and domain information |
|---|
| >PRK07217 replication factor A; Reviewed | Back alignment and domain information |
|---|
| >TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase | Back alignment and domain information |
|---|
| >PRK06386 replication factor A; Reviewed | Back alignment and domain information |
|---|
| >PRK08763 single-stranded DNA-binding protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 359 | ||||
| 3nel_A | 438 | Aspartyl-Trna Synthetase Complexed With Aspartic Ac | 3e-10 | ||
| 3nel_A | 438 | Aspartyl-Trna Synthetase Complexed With Aspartic Ac | 9e-07 | ||
| 1b8a_A | 438 | Aspartyl-trna Synthetase Length = 438 | 6e-10 | ||
| 1b8a_A | 438 | Aspartyl-trna Synthetase Length = 438 | 4e-07 | ||
| 1x54_A | 434 | Crystal Structure Of Asparaginyl-trna Synthetase Fr | 2e-09 | ||
| 1wyd_A | 429 | Crystal Structure Of Aspartyl-Trna Synthetase From | 2e-08 | ||
| 1wyd_A | 429 | Crystal Structure Of Aspartyl-Trna Synthetase From | 1e-07 | ||
| 2xgt_A | 435 | Asparaginyl-Trna Synthetase From Brugia Malayi Comp | 4e-08 | ||
| 2xti_A | 437 | Asparaginyl-Trna Synthetase From Brugia Malayi Comp | 4e-08 | ||
| 1eov_A | 487 | Free Aspartyl-Trna Synthetase (Asprs) (E.C. 6.1.1.1 | 6e-07 | ||
| 1asy_A | 490 | Class Ii Aminoacyl Transfer Rna Synthetases: Crysta | 7e-07 | ||
| 1n9w_A | 422 | Crystal Structure Of The Non-Discriminating And Arc | 3e-06 | ||
| 3m4p_A | 456 | Entamoeba Histolytica Asparaginyl-Trna Synthetase ( | 3e-05 | ||
| 3i7f_A | 548 | Aspartyl Trna Synthetase From Entamoeba Histolytica | 2e-04 | ||
| 1eqr_A | 590 | Crystal Structure Of Free Aspartyl-Trna Synthetase | 3e-04 | ||
| 1c0a_A | 585 | Crystal Structure Of The E. Coli Aspartyl-Trna Synt | 3e-04 |
| >pdb|3NEL|A Chain A, Aspartyl-Trna Synthetase Complexed With Aspartic Acid Length = 438 | Back alignment and structure |
|
| >pdb|3NEL|A Chain A, Aspartyl-Trna Synthetase Complexed With Aspartic Acid Length = 438 | Back alignment and structure |
| >pdb|1B8A|A Chain A, Aspartyl-trna Synthetase Length = 438 | Back alignment and structure |
| >pdb|1B8A|A Chain A, Aspartyl-trna Synthetase Length = 438 | Back alignment and structure |
| >pdb|1X54|A Chain A, Crystal Structure Of Asparaginyl-trna Synthetase From Pyrococcus Horikoshii Complexed With Asparaginyl-adenylate Length = 434 | Back alignment and structure |
| >pdb|1WYD|A Chain A, Crystal Structure Of Aspartyl-Trna Synthetase From Sulfolobus Tokodaii Length = 429 | Back alignment and structure |
| >pdb|1WYD|A Chain A, Crystal Structure Of Aspartyl-Trna Synthetase From Sulfolobus Tokodaii Length = 429 | Back alignment and structure |
| >pdb|2XGT|A Chain A, Asparaginyl-Trna Synthetase From Brugia Malayi Complexed With The Sulphamoyl Analogue Of Asparaginyl-Adenylate Length = 435 | Back alignment and structure |
| >pdb|2XTI|A Chain A, Asparaginyl-Trna Synthetase From Brugia Malayi Complexed With Atp:mg And L-Asp-Beta-Noh Adenylate:ppi:mg Length = 437 | Back alignment and structure |
| >pdb|1EOV|A Chain A, Free Aspartyl-Trna Synthetase (Asprs) (E.C. 6.1.1.12) From Yeast Length = 487 | Back alignment and structure |
| >pdb|1ASY|A Chain A, Class Ii Aminoacyl Transfer Rna Synthetases: Crystal Structure Of Yeast Aspartyl-Trna Synthetase Complexed With Trna Asp Length = 490 | Back alignment and structure |
| >pdb|1N9W|A Chain A, Crystal Structure Of The Non-Discriminating And Archaeal- Type Aspartyl-Trna Synthetase From Thermus Thermophilus Length = 422 | Back alignment and structure |
| >pdb|3M4P|A Chain A, Entamoeba Histolytica Asparaginyl-Trna Synthetase (Asnrs) In Complex With Asparaginyl-Adenylate Length = 456 | Back alignment and structure |
| >pdb|3I7F|A Chain A, Aspartyl Trna Synthetase From Entamoeba Histolytica Length = 548 | Back alignment and structure |
| >pdb|1EQR|A Chain A, Crystal Structure Of Free Aspartyl-Trna Synthetase From Escherichia Coli Length = 590 | Back alignment and structure |
| >pdb|1C0A|A Chain A, Crystal Structure Of The E. Coli Aspartyl-Trna Synthetase : Trnaasp : Aspartyl-Adenylate Complex Length = 585 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Length = 434 | Back alignment and structure |
|---|
Score = 185 bits (473), Expect = 3e-55
Identities = 45/182 (24%), Positives = 82/182 (45%), Gaps = 11/182 (6%)
Query: 31 LIKSILTRPDGGAGLAGRQVRVGGWVKTGREQGKGSFAFLEVNDGSCPANLQVIVDKDVA 90
+I+ + + + L G++VR+ GWV T GK FL + D + +Q +V K+V
Sbjct: 1 MIEKVYCQ-EVKPELDGKKVRLAGWVYTNMRVGK--KIFLWIRDSTG--IVQAVVAKNVV 55
Query: 91 -----DLGQLVPTGTCVYVEGMLKNPPEGTKQKIELRVQKVVDVGMVDPAKYPIPKTKLT 145
+ + + + V VEG++K E+ V+K+ + V P + +
Sbjct: 56 GEETFEKAKKLGRESSVIVEGIVKADE-RAPGGAEVHVEKLEVIQAVSEFPIPENPEQAS 114
Query: 146 LEFLRDRIPFRPRTNTIAAVARIRNALAYATHTFLQKQGFLYIHTPIITTSDCEGAGEMF 205
E L D RT +A+ +++ L A +L K G+ + PI+ T EG +F
Sbjct: 115 PELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLF 174
Query: 206 QV 207
++
Sbjct: 175 KL 176
|
| >1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Length = 434 | Back alignment and structure |
|---|
| >2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Length = 435 | Back alignment and structure |
|---|
| >2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Length = 435 | Back alignment and structure |
|---|
| >3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Length = 456 | Back alignment and structure |
|---|
| >3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Length = 456 | Back alignment and structure |
|---|
| >3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Length = 438 | Back alignment and structure |
|---|
| >3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Length = 438 | Back alignment and structure |
|---|
| >1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Length = 429 | Back alignment and structure |
|---|
| >1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Length = 429 | Back alignment and structure |
|---|
| >1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Length = 422 | Back alignment and structure |
|---|
| >1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Length = 422 | Back alignment and structure |
|---|
| >1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Length = 294 | Back alignment and structure |
|---|
| >1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Length = 294 | Back alignment and structure |
|---|
| >1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Length = 487 | Back alignment and structure |
|---|
| >1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Length = 487 | Back alignment and structure |
|---|
| >3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Length = 548 | Back alignment and structure |
|---|
| >3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Length = 548 | Back alignment and structure |
|---|
| >3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Length = 548 | Back alignment and structure |
|---|
| >2djv_A Methionyl-tRNA synthetase; EC 6.1.1.10, WHEP-TRS domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Length = 585 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Length = 580 | Back alignment and structure |
|---|
| >1d2d_A TRNA synthetase, tRNA ligase; tRNA synthetase (ligase), protein transcription; NMR {Cricetulus griseus} SCOP: a.16.1.3 PDB: 1r1b_A Length = 59 | Back alignment and structure |
|---|
| >1fyj_A Multifunctional aminoacyl-tRNA synthetase; helix-turn-helix, ligase; NMR {Homo sapiens} SCOP: a.16.1.3 Length = 57 | Back alignment and structure |
|---|
| >2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Length = 693 | Back alignment and structure |
|---|
| >1x59_A Histidyl-tRNA synthetase; hisrs, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 359 | |||
| 3nem_A | 438 | Aspartyl-tRNA synthetase; rossmann fold, OB fold, | 100.0 | |
| 3m4p_A | 456 | Ehasnrs, asparaginyl-tRNA synthetase, putative; am | 100.0 | |
| 2xgt_A | 435 | Asparaginyl-tRNA synthetase, cytoplasmic; ligase, | 100.0 | |
| 3i7f_A | 548 | Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi | 100.0 | |
| 1c0a_A | 585 | Aspartyl tRNA synthetase; protein-RNA complex, lig | 100.0 | |
| 1l0w_A | 580 | Aspartyl-tRNA synthetase; space-grown crystal, dim | 100.0 | |
| 1wyd_A | 429 | Hypothetical aspartyl-tRNA synthetase; archaea, LI | 100.0 | |
| 3bju_A | 521 | Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 100.0 | |
| 1eov_A | 487 | ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy | 100.0 | |
| 1n9w_A | 422 | Aspartyl-tRNA synthetase 2; biosynthetic protein; | 100.0 | |
| 1x54_A | 434 | Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe | 100.0 | |
| 1e1o_A | 504 | Lysyl-tRNA synthetase, heat inducible; ligase, ami | 100.0 | |
| 4ex5_A | 529 | Lysine--tRNA ligase; structural genomics, niaid, n | 100.0 | |
| 3a74_A | 493 | Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, | 100.0 | |
| 4ah6_A | 617 | Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo | 100.0 | |
| 3a5y_A | 345 | GENX, putative lysyl-tRNA synthetase; aminoacyl-tR | 99.97 | |
| 1nnh_A | 294 | Asparaginyl-tRNA synthetase-related peptide; struc | 99.96 | |
| 3qtc_A | 290 | Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet | 99.83 | |
| 3dsq_A | 288 | Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t | 98.02 | |
| 2rhq_A | 294 | Phenylalanyl-tRNA synthetase alpha chain; heterote | 98.02 | |
| 1b7y_A | 350 | Phers, protein (phenylalanyl-tRNA synthetase); enz | 97.75 | |
| 2i4l_A | 458 | Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud | 97.75 | |
| 1qe0_A | 420 | Histidyl-tRNA synthetase; class II tRNA synthetase | 97.74 | |
| 1wu7_A | 434 | Histidyl-tRNA synthetase; ligase, structural genom | 97.54 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 97.53 | |
| 1hc7_A | 477 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 97.52 | |
| 1h4v_B | 421 | Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA | 97.48 | |
| 1evl_A | 401 | Threonyl-tRNA synthetase; amino acid recognition, | 97.45 | |
| 4e51_A | 467 | Histidine--tRNA ligase; seattle structural genomic | 97.44 | |
| 1z7m_A | 344 | ATP phosphoribosyltransferase regulatory subunit; | 97.43 | |
| 1htt_A | 423 | Histidyl-tRNA synthetase; complex (tRNA synthetase | 97.42 | |
| 1nyr_A | 645 | Threonyl-tRNA synthetase 1; ATP, threonine, ligase | 97.39 | |
| 4g84_A | 464 | Histidine--tRNA ligase, cytoplasmic; synthetase; 2 | 97.38 | |
| 2j3l_A | 572 | Prolyl-tRNA synthetase; class II aminoacyl- T synt | 97.38 | |
| 3net_A | 465 | Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas | 97.34 | |
| 3od1_A | 400 | ATP phosphoribosyltransferase regulatory subunit; | 97.3 | |
| 1nj8_A | 459 | Proline-tRNA synthetase, proline--tRNA ligase; cla | 97.25 | |
| 2k50_A | 115 | Replication factor A related protein; uncharacteri | 97.21 | |
| 3uh0_A | 460 | Threonyl-tRNA synthetase, mitochondrial; threonine | 97.17 | |
| 3rac_A | 373 | Histidine-tRNA ligase; structural genomics, PSI-bi | 97.13 | |
| 1qf6_A | 642 | THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m | 97.08 | |
| 1nj1_A | 501 | PROR, proline-tRNA synthetase, proline--tRNA ligas | 97.04 | |
| 4g85_A | 517 | Histidine-tRNA ligase, cytoplasmic; synthetase; 3. | 97.04 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 97.02 | |
| 3kdf_D | 132 | Replication protein A 32 kDa subunit; wheat GERM c | 97.02 | |
| 3a32_A | 471 | Probable threonyl-tRNA synthetase 1; aeropyrum per | 97.01 | |
| 3kf6_A | 159 | Protein STN1; OB fold, chromosomal protein, DNA-bi | 97.0 | |
| 3dm3_A | 105 | Replication factor A; probably plays AN essential | 97.0 | |
| 3lc0_A | 456 | Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t | 96.94 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 96.92 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 96.88 | |
| 4hvc_A | 519 | Bifunctional glutamate/proline--tRNA ligase; ligas | 96.88 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 96.84 | |
| 4gop_B | 136 | Putative uncharacterized protein; OB fold, ssDNA b | 96.83 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 96.81 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 96.76 | |
| 3e0e_A | 97 | Replication protein A; structural genomics, PSI-2, | 96.71 | |
| 3vbb_A | 522 | Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l | 96.63 | |
| 3ial_A | 518 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 96.36 | |
| 3pco_A | 327 | Phenylalanyl-tRNA synthetase, alpha subunit; amino | 96.26 | |
| 1ati_A | 505 | Glycyl-tRNA synthetase; protein biosynthesis, liga | 96.14 | |
| 2pi2_A | 270 | Replication protein A 32 kDa subunit; FULL-length | 96.12 | |
| 12as_A | 330 | Asparagine synthetase; ligase, nitrogen fixation; | 96.01 | |
| 1usy_A | 275 | ATP phosphoribosyltransferase regulatory subunit; | 95.69 | |
| 1nnx_A | 109 | Protein YGIW; structural genomics, hypothetical pr | 95.64 | |
| 2zt5_A | 693 | Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP | 95.38 | |
| 3l4g_A | 508 | Phenylalanyl-tRNA synthetase alpha chain; aminoacy | 95.0 | |
| 1o7i_A | 119 | SSB, SSO2364, single stranded DNA binding protein; | 94.94 | |
| 2cja_A | 522 | Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE | 94.83 | |
| 3mf2_A | 346 | BLL0957 protein; aminoacyl-tRNA synthetase, seryl- | 94.78 | |
| 3kf8_A | 220 | Protein STN1; OB fold; 2.40A {Candida tropicalis m | 94.13 | |
| 2kbn_A | 109 | Conserved protein; nucleic acid binding protein, b | 94.1 | |
| 3kdf_A | 121 | Replication protein A 14 kDa subunit; wheat GERM c | 93.48 | |
| 1ynx_A | 114 | Replication factor-A protein 1; canonical OB fold, | 93.45 | |
| 3au7_A | 402 | TIAS, putative uncharacterized protein; ATP hydrol | 93.42 | |
| 3ikl_A | 459 | DNA polymerase subunit gamma-2, mitochondrial; tra | 92.87 | |
| 2k75_A | 106 | Uncharacterized protein TA0387; closed beta barrel | 92.61 | |
| 3fhw_A | 115 | Primosomal replication protein N; PRIB BPR162 X-RA | 92.08 | |
| 1g5h_A | 454 | Mitochondrial DNA polymerase accessory subunit; in | 91.99 | |
| 2hpi_A | 1220 | DNA polymerase III alpha subunit; POL-beta-like nu | 91.38 | |
| 3cmq_A | 415 | Phenylalanyl-tRNA synthetase, mitochondrial; class | 91.14 | |
| 1jmc_A | 246 | Protein (replication protein A (RPA)); human ssDNA | 89.66 | |
| 2pi2_E | 142 | Replication protein A 14 kDa subunit; FULL-length | 89.64 | |
| 1j6q_A | 136 | Cytochrome C maturation protein E; all-beta protei | 89.34 | |
| 4gop_A | 114 | Putative uncharacterized protein; OB fold, ssDNA b | 87.47 | |
| 1sr3_A | 136 | APO-CCME; OB fold, beta barrel, flexible C-termina | 87.24 | |
| 3k8a_A | 103 | Putative primosomal replication protein; beta-barr | 86.44 | |
| 1txy_A | 104 | Primosomal replication protein N; OB fold, dimer, | 85.27 | |
| 3tqy_A | 158 | Single-stranded DNA-binding protein; DNA replicati | 84.67 | |
| 4gop_C | 444 | Putative uncharacterized protein; OB fold, ssDNA b | 82.09 |
| >3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.8e-59 Score=473.22 Aligned_cols=227 Identities=31% Similarity=0.502 Sum_probs=206.6
Q ss_pred cceeehhhhcCCCCCCCCCCCEEEEEEEEeecccCCCceeEEEEEecCCCCceEEEEEeCCh-----hhhccCCCCCcEE
Q 018229 28 DRVLIKSILTRPDGGAGLAGRQVRVGGWVKTGREQGKGSFAFLEVNDGSCPANLQVIVDKDV-----ADLGQLVPTGTCV 102 (359)
Q Consensus 28 ~r~~i~di~~~~~l~~~~~gk~V~I~GwV~siR~~Gk~kl~Fi~LRDgsg~~~lQVVv~~~~-----~~~~~~L~~esvV 102 (359)
++++|.+|. ..++|++|+|+|||+++|.+| |++|++|||++|. ||||++++. .+..+.|+.||+|
T Consensus 3 rt~~~~~l~------~~~~g~~V~v~Gwv~~~R~~g--~~~Fi~LrD~~g~--iQ~v~~~~~~~~~~~~~~~~l~~~~~V 72 (438)
T 3nem_A 3 RTHYSSEIT------EELNGQKVKVAGWVWEVKDLG--GIKFLWIRDRDGI--VQITAPKKKVDPELFKLIPKLRSEDVV 72 (438)
T ss_dssp CSCCGGGCC------GGGTTCEEEEEEEEEEEEEET--TEEEEEEEETTEE--EEEEEETTTSCHHHHHHGGGCCTTCEE
T ss_pred eEEEHHHcc------hhcCCCEEEEEEEEEEEecCC--CeEEEEEEECCee--EEEEEeCCcCCHHHHHHHhcCCCCCEE
Confidence 556676664 456899999999999999999 8999999999986 999998764 1235679999999
Q ss_pred EEEeEEeCCCCCCcccEEEEEeEEEEeecCCCCCCCCCCcC---cchhhhccCcCccCCchHHHHHHHHHHHHHHHHHHH
Q 018229 103 YVEGMLKNPPEGTKQKIELRVQKVVDVGMVDPAKYPIPKTK---LTLEFLRDRIPFRPRTNTIAAVARIRNALAYATHTF 179 (359)
Q Consensus 103 ~V~G~v~~s~~~~~g~lEL~a~~i~vLs~a~~~~~Pi~~k~---~~~e~lr~~r~L~lR~~~~~ai~riRS~I~~~iR~f 179 (359)
.|+|+|.+++. .+|++||++++|+||++|. .++|++.+. ++.|+++++||||+|++.++++|++||.|++++|+|
T Consensus 73 ~V~G~v~~~~~-~~~~~el~~~~i~vl~~~~-~~lP~~~~~~~~~~~e~r~~~R~Ldlr~~~~~~~~~~Rs~i~~~iR~f 150 (438)
T 3nem_A 73 AVEGVVNFTPK-AKLGFEILPEKIVVLNRAE-TPLPLDPTGKVKAELDTRLDNRFMDLRRPEVMAIFKIRSSVFKAVRDF 150 (438)
T ss_dssp EEEEEEEECTT-STTSEEEEEEEEEEEECBC-SSCSSCTTSSSCCCHHHHHHTHHHHTTSHHHHHHHHHHHHHHHHHHHH
T ss_pred EEEEEEEeCCC-CCCcEEEEEEEEEEEecCC-CCCCCCccccccCCHHHHhhchHHHhcCHHHHHHHHHHHHHHHHHHHH
Confidence 99999999873 5689999999999999997 689987654 688999999999999999999999999999999999
Q ss_pred HHhCCcEEEccCeeecCCCCCCCCcceeeccccchhhhhhhhcCCCCCChhhHHHHHHHHHHhhhHHHhhhcccchhhhh
Q 018229 180 LQKQGFLYIHTPIITTSDCEGAGEMFQVTTLISDADKLEKELIKNPPPSEADIEAAKLVIKEKGEAVAKLKSDKAGREAI 259 (359)
Q Consensus 180 L~~~gF~EV~TPiLt~~~~EGa~e~F~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 259 (359)
|.++||+||+||+|++++||||+++|.+
T Consensus 151 ~~~~gF~EVeTPiL~~~~~eg~~~~f~~---------------------------------------------------- 178 (438)
T 3nem_A 151 FHENGFIEIHTPKIIATATEGGTELFPM---------------------------------------------------- 178 (438)
T ss_dssp HHHTTCEECCCCSEESSCSSCSSSCCEE----------------------------------------------------
T ss_pred HHHCCcEEEeCCEEecCCCCCCccceeE----------------------------------------------------
Confidence 9999999999999999999999998865
Q ss_pred hhhHHHHHHHHHHHHHHHhhhccCCCCCCCCCCccccccccCccccccccHHHHHHHH-HccccceEEEeceeecCCCCC
Q 018229 260 SASVTELTKAKENLAKLEERSKLKPGIPQKDGKIDYTQDFFARQAFLTVSGQLQVETY-ACAVSNVYTFGPTFRAEHSHT 338 (359)
Q Consensus 260 ~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~f~~~~~L~~S~ql~~e~~-~~~~~~Vy~~~p~fRaE~~~t 338 (359)
+||++++||+||||||+|++ ++|++|||+||||||||+++|
T Consensus 179 --------------------------------------~~~~~~~yL~~Spql~~q~l~~~g~~rvf~i~~~FR~E~~~t 220 (438)
T 3nem_A 179 --------------------------------------KYFEEDAFLAQSPQLYKQIMMASGLDRVYEIAPIFRAEEHNT 220 (438)
T ss_dssp --------------------------------------EETTEEEEECSCSHHHHHHGGGTTCCEEEEEEEEECCCSSCC
T ss_pred --------------------------------------eeCCccEEEecChHHHHHHHHhcCCCceEEEcceEECCCCCC
Confidence 47899999999999999986 588999999999999999999
Q ss_pred CCccccccccceeecccC
Q 018229 339 SRHLAEFWMVEPEMAFSD 356 (359)
Q Consensus 339 ~rHl~EF~mle~E~af~~ 356 (359)
.||++||||||+||+|+|
T Consensus 221 ~RH~pEFt~le~e~a~~~ 238 (438)
T 3nem_A 221 TRHLNEAWSIDSEMAFIE 238 (438)
T ss_dssp TTCCSEEEEEEEEEESCS
T ss_pred cccccceeeeeeeeccCc
Confidence 999999999999999998
|
| >3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A | Back alignment and structure |
|---|
| >2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* | Back alignment and structure |
|---|
| >3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* | Back alignment and structure |
|---|
| >1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A | Back alignment and structure |
|---|
| >1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* | Back alignment and structure |
|---|
| >1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* | Back alignment and structure |
|---|
| >1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A | Back alignment and structure |
|---|
| >1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A | Back alignment and structure |
|---|
| >4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* | Back alignment and structure |
|---|
| >4ah6_A Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* | Back alignment and structure |
|---|
| >1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* | Back alignment and structure |
|---|
| >3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* | Back alignment and structure |
|---|
| >3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A | Back alignment and structure |
|---|
| >2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* | Back alignment and structure |
|---|
| >1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 3teh_A* 2aly_A* 2akw_A* 2amc_A* | Back alignment and structure |
|---|
| >2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* | Back alignment and structure |
|---|
| >1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A | Back alignment and structure |
|---|
| >1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A | Back alignment and structure |
|---|
| >1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* | Back alignment and structure |
|---|
| >4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* | Back alignment and structure |
|---|
| >1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* | Back alignment and structure |
|---|
| >1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* | Back alignment and structure |
|---|
| >4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* | Back alignment and structure |
|---|
| >3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} | Back alignment and structure |
|---|
| >3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 | Back alignment and structure |
|---|
| >2k50_A Replication factor A related protein; uncharacterized protein, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* | Back alignment and structure |
|---|
| >3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* | Back alignment and structure |
|---|
| >4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 2pqa_A 1quq_A 1l1o_B | Back alignment and structure |
|---|
| >3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A | Back alignment and structure |
|---|
| >3kf6_A Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3dm3_A Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* | Back alignment and structure |
|---|
| >4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >4gop_B Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >3e0e_A Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A | Back alignment and structure |
|---|
| >3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} | Back alignment and structure |
|---|
| >3pco_A Phenylalanyl-tRNA synthetase, alpha subunit; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} | Back alignment and structure |
|---|
| >1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* | Back alignment and structure |
|---|
| >2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A | Back alignment and structure |
|---|
| >12as_A Asparagine synthetase; ligase, nitrogen fixation; HET: AMP; 2.20A {Escherichia coli K12} SCOP: d.104.1.1 PDB: 11as_A* | Back alignment and structure |
|---|
| >1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* | Back alignment and structure |
|---|
| >1nnx_A Protein YGIW; structural genomics, hypothetical protein, OB-fold, structure 2 function project, S2F, unknown function; 1.45A {Escherichia coli} SCOP: b.40.10.1 | Back alignment and structure |
|---|
| >2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A | Back alignment and structure |
|---|
| >3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1o7i_A SSB, SSO2364, single stranded DNA binding protein; OB fold; 1.2A {Sulfolobus solfataricus} SCOP: b.40.4.3 | Back alignment and structure |
|---|
| >2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A | Back alignment and structure |
|---|
| >3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* | Back alignment and structure |
|---|
| >3kf8_A Protein STN1; OB fold; 2.40A {Candida tropicalis mya-3404} | Back alignment and structure |
|---|
| >2kbn_A Conserved protein; nucleic acid binding protein, beta barrel, structural genomics, PSI-2, protein structure initiative; NMR {Methanosarcina mazei} PDB: 2ken_A | Back alignment and structure |
|---|
| >3kdf_A Replication protein A 14 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 1quq_B 1l1o_A | Back alignment and structure |
|---|
| >1ynx_A Replication factor-A protein 1; canonical OB fold, DNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3au7_A TIAS, putative uncharacterized protein; ATP hydrolysis, RNA binding protein; 2.60A {Archaeoglobus fulgidus} PDB: 3amt_A* 3amu_A* | Back alignment and structure |
|---|
| >3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2k75_A Uncharacterized protein TA0387; closed beta barrel, OB fold, structural genomics, PSI-2, protein structure initiative; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3fhw_A Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A | Back alignment and structure |
|---|
| >1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* | Back alignment and structure |
|---|
| >2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold, transferase; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* | Back alignment and structure |
|---|
| >3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* 3teg_A* 3tup_A | Back alignment and structure |
|---|
| >1jmc_A Protein (replication protein A (RPA)); human ssDNA binding replication protein A(RPA), single stranded DNA-binding protein, protein-ssDNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 1fgu_A | Back alignment and structure |
|---|
| >2pi2_E Replication protein A 14 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2pqa_B 2z6k_C | Back alignment and structure |
|---|
| >1j6q_A Cytochrome C maturation protein E; all-beta protein, heme delivery,cytochrome C maturation, OB- (oligonucleotide binding)fold; NMR {Shewanella putrefaciens} SCOP: b.40.9.1 PDB: 1lm0_A | Back alignment and structure |
|---|
| >4gop_A Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} | Back alignment and structure |
|---|
| >1sr3_A APO-CCME; OB fold, beta barrel, flexible C-terminal domain, chaperone; NMR {Escherichia coli} SCOP: b.40.9.1 | Back alignment and structure |
|---|
| >3k8a_A Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090} | Back alignment and structure |
|---|
| >1txy_A Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} SCOP: b.40.4.3 PDB: 1woc_A 2pnh_A 4apv_A | Back alignment and structure |
|---|
| >3tqy_A Single-stranded DNA-binding protein; DNA replication, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4gop_C Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 359 | ||||
| d1n9wa2 | 304 | d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (As | 1e-12 | |
| d1n9wa2 | 304 | d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (As | 1e-05 | |
| d1nnha_ | 293 | d.104.1.1 (A:) Hypothetical protein PF1951 {Archae | 1e-12 | |
| d1nnha_ | 293 | d.104.1.1 (A:) Hypothetical protein PF1951 {Archae | 2e-10 | |
| d1e1oa2 | 342 | d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS | 1e-11 | |
| d1c0aa3 | 346 | d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synt | 2e-11 | |
| d1c0aa3 | 346 | d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synt | 4e-07 | |
| d1eova2 | 353 | d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (As | 1e-10 | |
| d1eova2 | 353 | d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (As | 6e-04 | |
| d1l0wa3 | 356 | d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synt | 3e-09 | |
| d1l0wa3 | 356 | d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synt | 0.004 | |
| d1n9wa1 | 93 | b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) | 8e-09 | |
| d1b8aa2 | 335 | d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (As | 1e-08 | |
| d1eova1 | 134 | b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspR | 3e-08 | |
| d1l0wa1 | 104 | b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS | 3e-06 | |
| d1c0aa1 | 106 | b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS | 2e-05 | |
| d1d2da_ | 56 | a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthas | 0.001 | |
| d1fyja_ | 57 | a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthas | 0.002 |
| >d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Length = 304 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: Aspartyl-tRNA synthetase (AspRS) species: Thermus thermophilus, AspRS-2 [TaxId: 274]
Score = 65.6 bits (159), Expect = 1e-12
Identities = 14/53 (26%), Positives = 22/53 (41%)
Query: 158 RTNTIAAVARIRNALAYATHTFLQKQGFLYIHTPIITTSDCEGAGEMFQVTTL 210
R A +++ AL +L +Q F I TP + + EG +F V
Sbjct: 7 RGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYF 59
|
| >d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Length = 304 | Back information, alignment and structure |
|---|
| >d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 293 | Back information, alignment and structure |
|---|
| >d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 293 | Back information, alignment and structure |
|---|
| >d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Length = 342 | Back information, alignment and structure |
|---|
| >d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 353 | Back information, alignment and structure |
|---|
| >d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 353 | Back information, alignment and structure |
|---|
| >d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Length = 356 | Back information, alignment and structure |
|---|
| >d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Length = 356 | Back information, alignment and structure |
|---|
| >d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Length = 93 | Back information, alignment and structure |
|---|
| >d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Length = 335 | Back information, alignment and structure |
|---|
| >d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 134 | Back information, alignment and structure |
|---|
| >d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Length = 104 | Back information, alignment and structure |
|---|
| >d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Length = 106 | Back information, alignment and structure |
|---|
| >d1d2da_ a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 56 | Back information, alignment and structure |
|---|
| >d1fyja_ a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 359 | |||
| d1e1oa2 | 342 | Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g | 100.0 | |
| d1eova2 | 353 | Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S | 100.0 | |
| d1l0wa3 | 356 | Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph | 100.0 | |
| d1c0aa3 | 346 | Aspartyl-tRNA synthetase (AspRS) {Escherichia coli | 100.0 | |
| d1n9wa2 | 304 | Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph | 99.97 | |
| d1b8aa2 | 335 | Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ | 99.97 | |
| d1nnha_ | 293 | Hypothetical protein PF1951 {Archaeon Pyrococcus f | 99.97 | |
| d1n9wa1 | 93 | Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph | 99.85 | |
| d1c0aa1 | 106 | Aspartyl-tRNA synthetase (AspRS) {Escherichia coli | 99.84 | |
| d1b8aa1 | 103 | Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ | 99.84 | |
| d1l0wa1 | 104 | Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph | 99.83 | |
| d1eova1 | 134 | Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S | 99.79 | |
| d1e1oa1 | 143 | Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g | 99.68 | |
| d1z7ma1 | 318 | ATP phosphoribosyltransferase regulatory subunit H | 97.69 | |
| d1qe0a2 | 325 | Histidyl-tRNA synthetase (HisRS) {Staphylococcus a | 97.44 | |
| d1hc7a2 | 272 | Prolyl-tRNA synthetase (ProRS) {Thermus thermophil | 97.11 | |
| d1wu7a2 | 327 | Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop | 96.9 | |
| d1nyra4 | 291 | Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a | 96.86 | |
| d1h4vb2 | 324 | Histidyl-tRNA synthetase (HisRS) {Thermus thermoph | 96.84 | |
| d1kmma2 | 322 | Histidyl-tRNA synthetase (HisRS) {Escherichia coli | 96.68 | |
| d1nj8a3 | 268 | Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc | 96.58 | |
| d1qf6a4 | 291 | Threonyl-tRNA synthetase (ThrRS) {Escherichia coli | 96.44 | |
| d2pi2a1 | 128 | Replication protein A 32 KDa subunit (RPA32) fragm | 96.39 | |
| d1jjca_ | 266 | Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS | 96.36 | |
| d1jmca1 | 116 | Replication protein A 70 KDa subunit (RPA70) {Huma | 96.09 | |
| d1nnxa_ | 106 | Hypothetical protein YgiW {Escherichia coli [TaxId | 95.93 | |
| d1nj1a3 | 265 | Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth | 95.79 | |
| d1o7ia_ | 115 | Archaeal ssDNA-binding protein {Archaeon Sulfolobu | 95.68 | |
| d2pi2e1 | 115 | Replication protein A 14 KDa (RPA14) subunit {Huma | 95.17 | |
| d1b76a2 | 331 | Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil | 94.98 | |
| d1seta2 | 311 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 94.58 | |
| d1usya_ | 275 | ATP phosphoribosyltransferase regulatory subunit H | 90.53 | |
| d1v1qa_ | 111 | Primosomal replication protein N, PriB {Escherichi | 85.05 | |
| d1sr3a_ | 114 | Heme chaperone CcmE {Escherichia coli [TaxId: 562] | 84.26 | |
| d1se8a_ | 231 | ssDNA-binding protein {Deinococcus radiodurans [Ta | 83.19 | |
| d1gm5a2 | 180 | RecG "wedge" domain {Thermotoga maritima [TaxId: 2 | 83.15 |
| >d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: Lysyl-tRNA synthetase (LysRS) species: Escherichia coli, gene lysU [TaxId: 562]
Probab=100.00 E-value=2.4e-37 Score=300.06 Aligned_cols=123 Identities=20% Similarity=0.311 Sum_probs=113.3
Q ss_pred hhhhccCcCccC-CchHHHHHHHHHHHHHHHHHHHHHhCCcEEEccCeeecCCCCCCCCcceeeccccchhhhhhhhcCC
Q 018229 146 LEFLRDRIPFRP-RTNTIAAVARIRNALAYATHTFLQKQGFLYIHTPIITTSDCEGAGEMFQVTTLISDADKLEKELIKN 224 (359)
Q Consensus 146 ~e~lr~~r~L~l-R~~~~~ai~riRS~I~~~iR~fL~~~gF~EV~TPiLt~~~~EGa~e~F~v~~~~~~~~~~~~~~~~~ 224 (359)
.|++++|||||+ |++.++++|++||.|++++|+||.++||+||+||+|++++|||++++|.|+
T Consensus 2 ~~~Rl~~R~lDl~r~~~~~~~~r~Rs~i~~~iR~ff~~~gFiEV~TPil~~~~~~~~~~~f~~~---------------- 65 (342)
T d1e1oa2 2 QEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITH---------------- 65 (342)
T ss_dssp TTHHHHTHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHTTTCEECCCCSEESSCCSSCCCCCEEE----------------
T ss_pred hHhhhhcchhhhcCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCccccCCCCCCcceeec----------------
Confidence 578899999999 889999999999999999999999999999999999999999999999874
Q ss_pred CCCChhhHHHHHHHHHHhhhHHHhhhcccchhhhhhhhHHHHHHHHHHHHHHHhhhccCCCCCCCCCCccccccccCccc
Q 018229 225 PPPSEADIEAAKLVIKEKGEAVAKLKSDKAGREAISASVTELTKAKENLAKLEERSKLKPGIPQKDGKIDYTQDFFARQA 304 (359)
Q Consensus 225 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~f~~~~ 304 (359)
.++|+.++
T Consensus 66 ------------------------------------------------------------------------~~~~~~~~ 73 (342)
T d1e1oa2 66 ------------------------------------------------------------------------HNALDLDM 73 (342)
T ss_dssp ------------------------------------------------------------------------ETTTTEEE
T ss_pred ------------------------------------------------------------------------ccCCCccc
Confidence 25789999
Q ss_pred cccccHHHHHHH-HHccccceEEEeceeecCCCCCCCccccccccceeecccCC
Q 018229 305 FLTVSGQLQVET-YACAVSNVYTFGPTFRAEHSHTSRHLAEFWMVEPEMAFSDL 357 (359)
Q Consensus 305 ~L~~S~ql~~e~-~~~~~~~Vy~~~p~fRaE~~~t~rHl~EF~mle~E~af~~l 357 (359)
||+||||||+|+ +++|++|||+||||||+|++. +|||+||||||+||+|+|+
T Consensus 74 yL~~Spql~~k~~l~~g~~~vf~i~p~FR~E~~~-~rHl~EFtmlE~e~a~~~~ 126 (342)
T d1e1oa2 74 YLRIAPELYLKRLVVGGFERVFEINRNFRNEGIS-VRHNPEFTMMELYMAYADY 126 (342)
T ss_dssp EECSCSHHHHHHHHHHTCCEEEEEEEEECCCCCC-C-CCSEEEEEEEEEESCCH
T ss_pred ccchhhHHHHHHHhhhcccceeeecccccccccc-ccchHHHHHHHHHHHhhhh
Confidence 999999999995 678899999999999999875 5999999999999999986
|
| >d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} | Back information, alignment and structure |
|---|
| >d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} | Back information, alignment and structure |
|---|
| >d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e1oa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pi2a1 b.40.4.3 (A:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnxa_ b.40.10.1 (A:) Hypothetical protein YgiW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2pi2e1 b.40.4.3 (E:3-117) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sr3a_ b.40.9.1 (A:) Heme chaperone CcmE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|