Citrus Sinensis ID: 018851
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 349 | 2.2.26 [Sep-21-2011] | |||||||
| Q9T034 | 485 | Probable phenylalanine--t | yes | no | 0.971 | 0.698 | 0.841 | 1e-169 | |
| Q5ZJQ2 | 443 | Phenylalanine--tRNA ligas | yes | no | 0.902 | 0.711 | 0.519 | 5e-87 | |
| Q1JPX3 | 497 | Phenylalanine--tRNA ligas | yes | no | 0.957 | 0.672 | 0.505 | 2e-86 | |
| Q505J8 | 508 | Phenylalanine--tRNA ligas | yes | no | 0.965 | 0.663 | 0.473 | 2e-85 | |
| Q9Y285 | 508 | Phenylalanine--tRNA ligas | yes | no | 0.957 | 0.657 | 0.491 | 2e-84 | |
| Q5RFA2 | 508 | Phenylalanine--tRNA ligas | yes | no | 0.957 | 0.657 | 0.488 | 6e-84 | |
| Q7SYV0 | 499 | Phenylalanine--tRNA ligas | N/A | no | 0.914 | 0.639 | 0.498 | 9e-83 | |
| Q6AZG6 | 498 | Phenylalanine--tRNA ligas | N/A | no | 0.916 | 0.642 | 0.485 | 1e-82 | |
| Q8C0C7 | 508 | Phenylalanine--tRNA ligas | yes | no | 0.916 | 0.629 | 0.482 | 2e-82 | |
| Q9W3J5 | 498 | Probable phenylalanine--t | yes | no | 0.957 | 0.670 | 0.473 | 9e-74 |
| >sp|Q9T034|SYFA_ARATH Probable phenylalanine--tRNA ligase alpha subunit OS=Arabidopsis thaliana GN=At4g39280 PE=2 SV=3 | Back alignment and function desciption |
|---|
Score = 596 bits (1536), Expect = e-169, Method: Compositional matrix adjust.
Identities = 287/341 (84%), Positives = 308/341 (90%), Gaps = 2/341 (0%)
Query: 1 MAEEAILGYLEKNEQISDSGNFAAERGFDHNDVVNVIKSLHGFRYIDAQDIKRETWVLTG 60
MAEEAILG+L+ NEQI+DSG F+AE DHN++VNVIKSLHGFRYID QDIK+ETW+LT
Sbjct: 1 MAEEAILGFLQNNEQITDSGQFSAEFNIDHNELVNVIKSLHGFRYIDVQDIKKETWILTD 60
Query: 61 EGKKYAAEGSPEVQLFLAVPAEGSISKDELQKKLDPAVFKIGCSQAGKNKWVEMGKQVSR 120
EGKKYAAEGSPEVQLFLAVP EGSISKDELQKKL PAVFKIGCSQAGKNKWVEMGKQVSR
Sbjct: 61 EGKKYAAEGSPEVQLFLAVPEEGSISKDELQKKLAPAVFKIGCSQAGKNKWVEMGKQVSR 120
Query: 121 KVQNVEDKVKDLLLQVQNGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAA 180
KV++VEDKVK LLQ+Q G KE I+SLKARKLIVPQ WKGYSV+KGPNYAP+RKK A
Sbjct: 121 KVKDVEDKVKGQLLQIQQGKEFDKESINSLKARKLIVPQIWKGYSVKKGPNYAPERKKVA 180
Query: 181 TDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTN 240
TDLTRENLQ +WKELEFKEYNF AKG P + GHLH LLKVRKQ KDIF+QMGFEEMPTN
Sbjct: 181 TDLTRENLQ--NWKELEFKEYNFKAKGAPVDAGHLHALLKVRKQFKDIFVQMGFEEMPTN 238
Query: 241 NFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHESGGYGSRG 300
N+VESSFWNFDALFQPQQHPARDSHDTFFL+ PSTTR LPEDYVERVKRVHESGGYGSRG
Sbjct: 239 NYVESSFWNFDALFQPQQHPARDSHDTFFLKVPSTTRTLPEDYVERVKRVHESGGYGSRG 298
Query: 301 YGYEWKREEANKNLLRTHTTAVSSRMLKALAEKPFAPKKVF 341
Y Y+WKREEANKNLLRTHTTAVSSRML ALA+KPF PKK F
Sbjct: 299 YNYDWKREEANKNLLRTHTTAVSSRMLYALAQKPFVPKKYF 339
|
Arabidopsis thaliana (taxid: 3702) EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 0 |
| >sp|Q5ZJQ2|SYFA_CHICK Phenylalanine--tRNA ligase alpha subunit OS=Gallus gallus GN=FARSA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q1JPX3|SYFA_DANRE Phenylalanine--tRNA ligase alpha subunit OS=Danio rerio GN=farsa PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q505J8|SYFA_RAT Phenylalanine--tRNA ligase alpha subunit OS=Rattus norvegicus GN=Farsa PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y285|SYFA_HUMAN Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens GN=FARSA PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q5RFA2|SYFA_PONAB Phenylalanine--tRNA ligase alpha subunit OS=Pongo abelii GN=FARSA PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q7SYV0|SYFAB_XENLA Phenylalanine--tRNA ligase alpha subunit B OS=Xenopus laevis GN=farsa-b PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6AZG6|SYFAA_XENLA Phenylalanine--tRNA ligase alpha subunit A OS=Xenopus laevis GN=farsa-a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8C0C7|SYFA_MOUSE Phenylalanine--tRNA ligase alpha subunit OS=Mus musculus GN=Farsa PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9W3J5|SYFA_DROME Probable phenylalanine--tRNA ligase alpha subunit OS=Drosophila melanogaster GN=CG2263 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 349 | ||||||
| 255640993 | 349 | unknown [Glycine max] | 0.997 | 0.997 | 0.8 | 1e-168 | |
| 334187316 | 485 | phenylalanyl-tRNA synthetase alpha chain | 0.971 | 0.698 | 0.841 | 1e-168 | |
| 22329256 | 485 | phenylalanyl-tRNA synthetase alpha chain | 0.971 | 0.698 | 0.841 | 1e-168 | |
| 297802028 | 485 | hypothetical protein ARALYDRAFT_912388 [ | 0.971 | 0.698 | 0.847 | 1e-168 | |
| 356545225 | 488 | PREDICTED: probable phenylalanyl-tRNA sy | 0.974 | 0.696 | 0.812 | 1e-164 | |
| 356538769 | 488 | PREDICTED: probable phenylalanyl-tRNA sy | 0.974 | 0.696 | 0.804 | 1e-163 | |
| 356538771 | 493 | PREDICTED: probable phenylalanyl-tRNA sy | 0.974 | 0.689 | 0.792 | 1e-161 | |
| 357473243 | 560 | Phenylalanyl-tRNA synthetase beta subuni | 0.974 | 0.607 | 0.771 | 1e-159 | |
| 255536841 | 492 | phenylalanyl-tRNA synthetase beta chain, | 0.977 | 0.693 | 0.823 | 1e-158 | |
| 356564085 | 493 | PREDICTED: probable phenylalanyl-tRNA sy | 0.977 | 0.691 | 0.765 | 1e-156 |
| >gi|255640993|gb|ACU20776.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 597 bits (1538), Expect = e-168, Method: Compositional matrix adjust.
Identities = 280/350 (80%), Positives = 315/350 (90%), Gaps = 2/350 (0%)
Query: 1 MAEEAILGYLEKNEQISDSGNFAAERGFDHNDVVNVIKSLHGFRYIDAQDIKRETWVLTG 60
MAEEAILG+LEKN++I DSG FAAERG +HN++VNVIKSLHGFRY+DAQDIKRETWVLT
Sbjct: 1 MAEEAILGFLEKNDEIRDSGEFAAERGIEHNEIVNVIKSLHGFRYVDAQDIKRETWVLTD 60
Query: 61 EGKKYAAEGSPEVQLFLAVPAEGSISKDELQKKLDPAVFKIGCSQAGKNKWVEMGKQ-VS 119
EG+ YA GSPEVQLFLA+P EG ISK+ELQKKLDP++FKIGC+QA KNKWVEMGKQ +S
Sbjct: 61 EGETYATVGSPEVQLFLAIPQEG-ISKEELQKKLDPSLFKIGCAQAAKNKWVEMGKQLIS 119
Query: 120 RKVQNVEDKVKDLLLQVQNGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKA 179
RKVQ+V+DKVKDLLLQ+Q G + +EI +LK RKLI+PQTWKGYS+++GPNYAPKRKK
Sbjct: 120 RKVQHVDDKVKDLLLQIQQGLNIGSDEIKALKVRKLIIPQTWKGYSLKRGPNYAPKRKKV 179
Query: 180 ATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPT 239
TDLTR+N Q G+WKELEFKEYN++AKG P EGG+LHPLLKVR QLK IFL MGFEEMPT
Sbjct: 180 VTDLTRDNFQSGEWKELEFKEYNYSAKGAPLEGGNLHPLLKVRAQLKQIFLCMGFEEMPT 239
Query: 240 NNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHESGGYGSR 299
NNFVESSFWN DALFQPQQHPARDSHDTFFLE PSTT+ LPEDYV+RVK VHESGGYGSR
Sbjct: 240 NNFVESSFWNLDALFQPQQHPARDSHDTFFLETPSTTKILPEDYVQRVKHVHESGGYGSR 299
Query: 300 GYGYEWKREEANKNLLRTHTTAVSSRMLKALAEKPFAPKKVFLHRSCFQK 349
GY Y+WKREEANKNLLRTHTTAVSSRML LA+KPFAPKK+FL+RSC QK
Sbjct: 300 GYAYDWKREEANKNLLRTHTTAVSSRMLYQLAQKPFAPKKIFLYRSCIQK 349
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|334187316|ref|NP_001190964.1| phenylalanyl-tRNA synthetase alpha chain [Arabidopsis thaliana] gi|332661651|gb|AEE87051.1| phenylalanyl-tRNA synthetase alpha chain [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22329256|ref|NP_195639.2| phenylalanyl-tRNA synthetase alpha chain [Arabidopsis thaliana] gi|30316394|sp|Q9T034.3|SYFA_ARATH RecName: Full=Probable phenylalanine--tRNA ligase alpha subunit; AltName: Full=Phenylalanyl-tRNA synthetase alpha subunit; Short=PheRS gi|20453179|gb|AAM19830.1| AT4g39280/T22F8_180 [Arabidopsis thaliana] gi|25141225|gb|AAN73307.1| At4g39280/T22F8_180 [Arabidopsis thaliana] gi|332661650|gb|AEE87050.1| phenylalanyl-tRNA synthetase alpha chain [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297802028|ref|XP_002868898.1| hypothetical protein ARALYDRAFT_912388 [Arabidopsis lyrata subsp. lyrata] gi|297314734|gb|EFH45157.1| hypothetical protein ARALYDRAFT_912388 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356545225|ref|XP_003541045.1| PREDICTED: probable phenylalanyl-tRNA synthetase alpha chain-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356538769|ref|XP_003537873.1| PREDICTED: probable phenylalanyl-tRNA synthetase alpha chain-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356538771|ref|XP_003537874.1| PREDICTED: probable phenylalanyl-tRNA synthetase alpha chain-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357473243|ref|XP_003606906.1| Phenylalanyl-tRNA synthetase beta subunit [Medicago truncatula] gi|355507961|gb|AES89103.1| Phenylalanyl-tRNA synthetase beta subunit [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255536841|ref|XP_002509487.1| phenylalanyl-tRNA synthetase beta chain, putative [Ricinus communis] gi|223549386|gb|EEF50874.1| phenylalanyl-tRNA synthetase beta chain, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356564085|ref|XP_003550287.1| PREDICTED: probable phenylalanyl-tRNA synthetase alpha chain-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 349 | ||||||
| TAIR|locus:2136328 | 485 | AT4G39280 [Arabidopsis thalian | 0.971 | 0.698 | 0.812 | 1e-148 | |
| ZFIN|ZDB-GENE-050512-2 | 497 | farsa "phenylalanyl-tRNA synth | 0.965 | 0.678 | 0.478 | 7.6e-80 | |
| UNIPROTKB|E2QU31 | 508 | FARSA "Uncharacterized protein | 0.957 | 0.657 | 0.477 | 1.9e-76 | |
| UNIPROTKB|Q5ZJQ2 | 443 | FARSA "Phenylalanine--tRNA lig | 0.957 | 0.753 | 0.477 | 1.3e-75 | |
| RGD|1310314 | 508 | Farsa "phenylalanyl-tRNA synth | 0.965 | 0.663 | 0.453 | 3.5e-75 | |
| UNIPROTKB|A7MBD4 | 508 | FARSA "Uncharacterized protein | 0.957 | 0.657 | 0.465 | 4.5e-75 | |
| UNIPROTKB|K7ER00 | 548 | FARSA "Phenylalanine--tRNA lig | 0.957 | 0.609 | 0.468 | 4.5e-75 | |
| UNIPROTKB|Q9Y285 | 508 | FARSA "Phenylalanine--tRNA lig | 0.957 | 0.657 | 0.468 | 4.5e-75 | |
| UNIPROTKB|F1SD97 | 509 | FARSA "Uncharacterized protein | 0.957 | 0.656 | 0.472 | 6.5e-74 | |
| MGI|MGI:1913840 | 508 | Farsa "phenylalanyl-tRNA synth | 0.965 | 0.663 | 0.450 | 3.6e-73 |
| TAIR|locus:2136328 AT4G39280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1452 (516.2 bits), Expect = 1.0e-148, P = 1.0e-148
Identities = 277/341 (81%), Positives = 298/341 (87%)
Query: 1 MAEEAILGYLEKNEQISDSGNFAAERGFDHNDVVNVIKSLHGFRYIDAQDIKRETWVLTG 60
MAEEAILG+L+ NEQI+DSG F+AE DHN++VNVIKSLHGFRYID QDIK+ETW+LT
Sbjct: 1 MAEEAILGFLQNNEQITDSGQFSAEFNIDHNELVNVIKSLHGFRYIDVQDIKKETWILTD 60
Query: 61 EGKKYAAEGSPEVQLFLAVPAEGSISKDELQKKLDPAVFKIGCSQAGKNKWVEMGKQVSR 120
EGKKYAAEGSPEVQLFLAVP EGSISKDELQKKL PAVFKIGCSQAGKNKWVEMGKQVSR
Sbjct: 61 EGKKYAAEGSPEVQLFLAVPEEGSISKDELQKKLAPAVFKIGCSQAGKNKWVEMGKQVSR 120
Query: 121 KVQNVEDKVKDLLLQVQNGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAA 180
KV++VEDKVK LLQ+Q G KE I+SLKARKLIVPQ WKGYSV+KGPNYAP+RKK A
Sbjct: 121 KVKDVEDKVKGQLLQIQQGKEFDKESINSLKARKLIVPQIWKGYSVKKGPNYAPERKKVA 180
Query: 181 TDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTN 240
TDLTRENLQ +WKELEFKEYNF AKG P + GHLH LLKVRKQ KDIF+QMGFEEMPTN
Sbjct: 181 TDLTRENLQ--NWKELEFKEYNFKAKGAPVDAGHLHALLKVRKQFKDIFVQMGFEEMPTN 238
Query: 241 NFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXX 300
N+VESSFWNFDALFQPQQHPARDSHDTFFL+ PSTTR LPEDYVERVKRVHE
Sbjct: 239 NYVESSFWNFDALFQPQQHPARDSHDTFFLKVPSTTRTLPEDYVERVKRVHESGGYGSRG 298
Query: 301 XXXEWKREEANKNLLRTHTTAVSSRMLKALAEKPFAPKKVF 341
+WKREEANKNLLRTHTTAVSSRML ALA+KPF PKK F
Sbjct: 299 YNYDWKREEANKNLLRTHTTAVSSRMLYALAQKPFVPKKYF 339
|
|
| ZFIN|ZDB-GENE-050512-2 farsa "phenylalanyl-tRNA synthetase, alpha subunit" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QU31 FARSA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJQ2 FARSA "Phenylalanine--tRNA ligase alpha subunit" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1310314 Farsa "phenylalanyl-tRNA synthetase, alpha subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MBD4 FARSA "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7ER00 FARSA "Phenylalanine--tRNA ligase alpha subunit" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y285 FARSA "Phenylalanine--tRNA ligase alpha subunit" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SD97 FARSA "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913840 Farsa "phenylalanyl-tRNA synthetase, alpha subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9T034 | SYFA_ARATH | 6, ., 1, ., 1, ., 2, 0 | 0.8416 | 0.9713 | 0.6989 | yes | no |
| Q5ZJQ2 | SYFA_CHICK | 6, ., 1, ., 1, ., 2, 0 | 0.5197 | 0.9025 | 0.7110 | yes | no |
| Q1JPX3 | SYFA_DANRE | 6, ., 1, ., 1, ., 2, 0 | 0.5057 | 0.9570 | 0.6720 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 4th Layer | 6.1.1.20 | 0.824 |
| 3rd Layer | 6.1.1 | 0.766 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | AT4G39280 | phenylalanyl-tRNA synthetase, putative / phenylalanine--tRNA ligase, putative; phenylalanyl-tRNA synthetase, putative / phenylalanine--tRNA ligase, putative; FUNCTIONS IN- phenylalanine-tRNA ligase activity, aminoacyl-tRNA ligase activity, nucleotide binding, ATP binding; INVOLVED IN- phenylalanyl-tRNA aminoacylation, translation, tRNA aminoacylation for protein translation; LOCATED IN- cytoplasm; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Phenylalanyl-tRNA synthetase, class IIc, C-terminal (InterPro-IPR018157), Phenylalanyl-tRNA [...] (485 aa) | |||||||||
(Arabidopsis thaliana) | |||||||||||
 | AT1G72550 | • | • | • | • | • | • | 0.999 | |||
 | AT3G04600 | • | • | • | 0.975 | ||||||
 | AT4G10320 | • | • | • | 0.926 | ||||||
 | AT3G62120 | • | • | 0.909 | |||||||
 | AT2G33840 | • | • | • | 0.903 | ||||||
 | AT5G26830 | • | • | • | 0.899 | ||||||
 | AT5G27470 | • | • | 0.890 | |||||||
 | AT4G13780 | • | • | 0.889 | |||||||
 | AT1G16740 | • | • | • | 0.866 | ||||||
 | ATKRS-1 | • | • | • | 0.862 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 349 | |||
| PLN02853 | 492 | PLN02853, PLN02853, Probable phenylalanyl-tRNA syn | 0.0 | |
| PTZ00326 | 494 | PTZ00326, PTZ00326, phenylalanyl-tRNA synthetase a | 1e-152 | |
| PRK04172 | 489 | PRK04172, pheS, phenylalanyl-tRNA synthetase subun | 3e-84 | |
| COG0016 | 335 | COG0016, PheS, Phenylalanyl-tRNA synthetase alpha | 5e-41 | |
| pfam01409 | 245 | pfam01409, tRNA-synt_2d, tRNA synthetases class II | 5e-38 | |
| cd00496 | 218 | cd00496, PheRS_alpha_core, Phenylalanyl-tRNA synth | 8e-32 | |
| TIGR00468 | 293 | TIGR00468, pheS, phenylalanyl-tRNA synthetase, alp | 1e-31 | |
| PRK00488 | 339 | PRK00488, pheS, phenylalanyl-tRNA synthetase subun | 4e-20 |
| >gnl|CDD|215458 PLN02853, PLN02853, Probable phenylalanyl-tRNA synthetase alpha chain | Back alignment and domain information |
|---|
Score = 669 bits (1727), Expect = 0.0
Identities = 273/344 (79%), Positives = 300/344 (87%), Gaps = 3/344 (0%)
Query: 1 MAEEAILGYLEKNEQISDSGNFAAERGFDHNDVVNVIKSLHGFRYIDAQDIKRETWVLTG 60
MAEEA+LG L NE+ISDSG FAA G DHN+VV VIKSLHGFRY+DAQDIKRETWVLT
Sbjct: 3 MAEEALLGALSNNEEISDSGQFAASHGLDHNEVVGVIKSLHGFRYVDAQDIKRETWVLTE 62
Query: 61 EGKKYAAEGSPEVQLFLAVPAEGSISKDELQKKLDPAVFKIGCSQAGKNKWVEM--GKQV 118
EGKKYAAEGSPEVQLF AVPAEGSISKDELQKKLDPAVF IG QA KNKW+EM QV
Sbjct: 63 EGKKYAAEGSPEVQLFAAVPAEGSISKDELQKKLDPAVFDIGFKQAMKNKWLEMGGKPQV 122
Query: 119 SRKVQNVEDKVKDLLLQVQNGHALSKEEISSLKARK-LIVPQTWKGYSVRKGPNYAPKRK 177
SRKVQ+VED+VK+LLL +Q G + ++I +LK R+ LI +TWKGYS++KGPNYAP+RK
Sbjct: 123 SRKVQHVEDEVKELLLAIQEGKEVDDKDIDALKKRRKLITLETWKGYSIKKGPNYAPERK 182
Query: 178 KAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEM 237
KAATDLTRE LQ GDWK+LEFKEYNFNA G P EGGHLHPLLKVR+Q + IFLQMGFEEM
Sbjct: 183 KAATDLTREMLQSGDWKDLEFKEYNFNALGAPPEGGHLHPLLKVRQQFRKIFLQMGFEEM 242
Query: 238 PTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHESGGYG 297
PTNNFVESSFWNFDALFQPQQHPARDSHDTFFL+ P+TTR+LPEDYVERVK VHESGGYG
Sbjct: 243 PTNNFVESSFWNFDALFQPQQHPARDSHDTFFLKAPATTRQLPEDYVERVKTVHESGGYG 302
Query: 298 SRGYGYEWKREEANKNLLRTHTTAVSSRMLKALAEKPFAPKKVF 341
S GYGY+WKREEANKNLLRTHTTAVSSRML LA+K F PK+ F
Sbjct: 303 SIGYGYDWKREEANKNLLRTHTTAVSSRMLYKLAQKGFKPKRYF 346
|
Length = 492 |
| >gnl|CDD|240361 PTZ00326, PTZ00326, phenylalanyl-tRNA synthetase alpha chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235239 PRK04172, pheS, phenylalanyl-tRNA synthetase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223095 COG0016, PheS, Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216483 pfam01409, tRNA-synt_2d, tRNA synthetases class II core domain (F) | Back alignment and domain information |
|---|
| >gnl|CDD|238277 cd00496, PheRS_alpha_core, Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain | Back alignment and domain information |
|---|
| >gnl|CDD|232988 TIGR00468, pheS, phenylalanyl-tRNA synthetase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234780 PRK00488, pheS, phenylalanyl-tRNA synthetase subunit alpha; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 349 | |||
| KOG2784 | 483 | consensus Phenylalanyl-tRNA synthetase, beta subun | 100.0 | |
| PLN02853 | 492 | Probable phenylalanyl-tRNA synthetase alpha chain | 100.0 | |
| PTZ00326 | 494 | phenylalanyl-tRNA synthetase alpha chain; Provisio | 100.0 | |
| PRK04172 | 489 | pheS phenylalanyl-tRNA synthetase subunit alpha; P | 100.0 | |
| COG0016 | 335 | PheS Phenylalanyl-tRNA synthetase alpha subunit [T | 100.0 | |
| PF01409 | 247 | tRNA-synt_2d: tRNA synthetases class II core domai | 100.0 | |
| PRK00488 | 339 | pheS phenylalanyl-tRNA synthetase subunit alpha; V | 99.98 | |
| PLN02788 | 402 | phenylalanine-tRNA synthetase | 99.97 | |
| TIGR00468 | 294 | pheS phenylalanyl-tRNA synthetase, alpha subunit. | 99.94 | |
| TIGR00469 | 460 | pheS_mito phenylalanyl-tRNA synthetase, mitochondr | 99.94 | |
| TIGR00470 | 533 | sepS O-phosphoseryl-tRNA(Cys) synthetase. This fam | 99.61 | |
| COG2024 | 536 | Phenylalanyl-tRNA synthetase alpha subunit (archae | 99.41 | |
| KOG2783 | 436 | consensus Phenylalanyl-tRNA synthetase [Translatio | 99.26 | |
| PRK06253 | 529 | O-phosphoseryl-tRNA synthetase; Reviewed | 99.14 | |
| cd00496 | 218 | PheRS_alpha_core Phenylalanyl-tRNA synthetase (Phe | 98.98 | |
| TIGR02367 | 453 | PylS pyrrolysyl-tRNA synthetase. PylS is the archa | 98.62 | |
| PRK09616 | 552 | pheT phenylalanyl-tRNA synthetase subunit beta; Re | 98.56 | |
| PRK09537 | 417 | pylS pyrolysyl-tRNA synthetase; Reviewed | 98.54 | |
| TIGR00442 | 397 | hisS histidyl-tRNA synthetase. This model finds a | 97.84 | |
| PRK00037 | 412 | hisS histidyl-tRNA synthetase; Reviewed | 97.74 | |
| PF13601 | 80 | HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 | 97.64 | |
| PF14947 | 77 | HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ | 97.63 | |
| TIGR02337 | 118 | HpaR homoprotocatechuate degradation operon regula | 97.63 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 97.57 | |
| PRK11512 | 144 | DNA-binding transcriptional repressor MarR; Provis | 97.46 | |
| smart00347 | 101 | HTH_MARR helix_turn_helix multiple antibiotic resi | 97.43 | |
| PRK03573 | 144 | transcriptional regulator SlyA; Provisional | 97.3 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 97.29 | |
| COG1846 | 126 | MarR Transcriptional regulators [Transcription] | 97.25 | |
| cd00768 | 211 | class_II_aaRS-like_core Class II tRNA amino-acyl s | 97.15 | |
| cd00773 | 261 | HisRS-like_core Class II Histidinyl-tRNA synthetas | 97.13 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 96.98 | |
| PF03551 | 75 | PadR: Transcriptional regulator PadR-like family; | 96.97 | |
| PRK10870 | 176 | transcriptional repressor MprA; Provisional | 96.96 | |
| TIGR01889 | 109 | Staph_reg_Sar staphylococcal accessory regulator f | 96.96 | |
| TIGR00471 | 551 | pheT_arch phenylalanyl-tRNA synthetase, beta subun | 96.86 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 96.78 | |
| TIGR03433 | 100 | padR_acidobact transcriptional regulator, Acidobac | 96.78 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 96.77 | |
| PRK13777 | 185 | transcriptional regulator Hpr; Provisional | 96.76 | |
| PRK03902 | 142 | manganese transport transcriptional regulator; Pro | 96.71 | |
| PLN02265 | 597 | probable phenylalanyl-tRNA synthetase beta chain | 96.61 | |
| PF07381 | 90 | DUF1495: Winged helix DNA-binding domain (DUF1495) | 96.56 | |
| TIGR02702 | 203 | SufR_cyano iron-sulfur cluster biosynthesis transc | 96.54 | |
| PRK12293 | 281 | hisZ ATP phosphoribosyltransferase regulatory subu | 96.51 | |
| TIGR00443 | 314 | hisZ_biosyn_reg ATP phosphoribosyltransferase, reg | 96.48 | |
| TIGR01884 | 203 | cas_HTH CRISPR locus-related DNA-binding protein. | 96.46 | |
| PF10007 | 92 | DUF2250: Uncharacterized protein conserved in arch | 96.44 | |
| PRK14165 | 217 | winged helix-turn-helix domain-containing protein/ | 96.4 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 96.37 | |
| PF03501 | 95 | S10_plectin: Plectin/S10 domain; InterPro: IPR0053 | 96.29 | |
| PTZ00034 | 124 | 40S ribosomal protein S10; Provisional | 96.28 | |
| PRK12420 | 423 | histidyl-tRNA synthetase; Provisional | 96.15 | |
| COG1321 | 154 | TroR Mn-dependent transcriptional regulator [Trans | 96.12 | |
| cd00670 | 235 | Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t | 96.09 | |
| PRK12292 | 391 | hisZ ATP phosphoribosyltransferase regulatory subu | 96.09 | |
| PRK12295 | 373 | hisZ ATP phosphoribosyltransferase regulatory subu | 96.04 | |
| PLN02530 | 487 | histidine-tRNA ligase | 96.02 | |
| PF13393 | 311 | tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI | 95.97 | |
| cd00769 | 198 | PheRS_beta_core Phenylalanyl-tRNA synthetase (PheR | 95.94 | |
| smart00529 | 96 | HTH_DTXR Helix-turn-helix diphteria tox regulatory | 95.86 | |
| PRK11050 | 152 | manganese transport regulator MntR; Provisional | 95.82 | |
| COG4754 | 157 | Uncharacterized conserved protein [Function unknow | 95.58 | |
| CHL00201 | 430 | syh histidine-tRNA synthetase; Provisional | 95.56 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 95.55 | |
| PF01638 | 90 | HxlR: HxlR-like helix-turn-helix; InterPro: IPR002 | 95.55 | |
| COG1497 | 260 | Predicted transcriptional regulator [Transcription | 95.51 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 95.48 | |
| cd00771 | 298 | ThrRS_core Threonyl-tRNA synthetase (ThrRS) class | 95.48 | |
| PRK09416 | 135 | lstR lineage-specific thermal regulator protein; P | 95.47 | |
| COG1695 | 138 | Predicted transcriptional regulators [Transcriptio | 95.41 | |
| PRK12421 | 392 | ATP phosphoribosyltransferase regulatory subunit; | 95.41 | |
| COG2345 | 218 | Predicted transcriptional regulator [Transcription | 95.39 | |
| PF03444 | 78 | HrcA_DNA-bdg: Winged helix-turn-helix transcriptio | 95.38 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 95.31 | |
| TIGR02719 | 138 | repress_PhaQ poly-beta-hydroxybutyrate-responsive | 95.27 | |
| COG0124 | 429 | HisS Histidyl-tRNA synthetase [Translation, riboso | 95.12 | |
| COG5045 | 105 | Ribosomal protein S10E [Translation, ribosomal str | 94.99 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 94.92 | |
| PRK05638 | 442 | threonine synthase; Validated | 94.86 | |
| COG4742 | 260 | Predicted transcriptional regulator [Transcription | 94.77 | |
| PHA02943 | 165 | hypothetical protein; Provisional | 94.71 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 94.7 | |
| PRK12294 | 272 | hisZ ATP phosphoribosyltransferase regulatory subu | 94.67 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 94.62 | |
| CHL00192 | 704 | syfB phenylalanyl-tRNA synthetase beta chain; Prov | 94.59 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 94.52 | |
| cd00779 | 255 | ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla | 94.51 | |
| PF08461 | 66 | HTH_12: Ribonuclease R winged-helix domain; InterP | 94.43 | |
| cd00772 | 264 | ProRS_core Prolyl-tRNA synthetase (ProRS) class II | 94.41 | |
| COG2512 | 258 | Predicted membrane-associated trancriptional regul | 94.35 | |
| COG0072 | 650 | PheT Phenylalanyl-tRNA synthetase beta subunit [Tr | 94.26 | |
| COG3355 | 126 | Predicted transcriptional regulator [Transcription | 94.15 | |
| PRK09350 | 306 | poxB regulator PoxA; Provisional | 94.14 | |
| PLN02972 | 763 | Histidyl-tRNA synthetase | 94.11 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 94.07 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 94.05 | |
| PF02295 | 66 | z-alpha: Adenosine deaminase z-alpha domain; Inter | 94.0 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 93.94 | |
| PRK09194 | 565 | prolyl-tRNA synthetase; Provisional | 93.89 | |
| PRK12305 | 575 | thrS threonyl-tRNA synthetase; Reviewed | 93.82 | |
| COG3432 | 95 | Predicted transcriptional regulator [Transcription | 93.72 | |
| PF04458 | 591 | DUF505: Protein of unknown function (DUF505); Inte | 93.71 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 93.65 | |
| COG1733 | 120 | Predicted transcriptional regulators [Transcriptio | 93.63 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 93.52 | |
| PF05158 | 327 | RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter | 93.42 | |
| PRK00629 | 791 | pheT phenylalanyl-tRNA synthetase subunit beta; Re | 93.34 | |
| PRK00413 | 638 | thrS threonyl-tRNA synthetase; Reviewed | 93.3 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 93.22 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 93.21 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 93.15 | |
| COG1339 | 214 | Transcriptional regulator of a riboflavin/FAD bios | 92.97 | |
| PRK09834 | 263 | DNA-binding transcriptional activator MhpR; Provis | 92.79 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 92.72 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 92.6 | |
| TIGR01610 | 95 | phage_O_Nterm phage replication protein O, N-termi | 92.54 | |
| PHA00738 | 108 | putative HTH transcription regulator | 92.42 | |
| PF04703 | 62 | FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. | 92.37 | |
| TIGR00472 | 798 | pheT_bact phenylalanyl-tRNA synthetase, beta subun | 92.35 | |
| PRK10141 | 117 | DNA-binding transcriptional repressor ArsR; Provis | 92.33 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 92.32 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 92.21 | |
| TIGR02698 | 130 | CopY_TcrY copper transport repressor, CopY/TcrY fa | 92.19 | |
| TIGR00418 | 563 | thrS threonyl-tRNA synthetase. This model represen | 92.19 | |
| PRK00215 | 205 | LexA repressor; Validated | 92.05 | |
| KOG3344 | 150 | consensus 40s ribosomal protein s10 [Translation, | 92.02 | |
| TIGR00409 | 568 | proS_fam_II prolyl-tRNA synthetase, family II. Pro | 91.82 | |
| PF10771 | 65 | DUF2582: Protein of unknown function (DUF2582); In | 91.8 | |
| PF09821 | 120 | AAA_assoc_C: C-terminal AAA-associated domain; Int | 91.62 | |
| TIGR02277 | 280 | PaaX_trns_reg phenylacetic acid degradation operon | 91.57 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 91.35 | |
| PF00587 | 173 | tRNA-synt_2b: tRNA synthetase class II core domain | 91.31 | |
| TIGR02787 | 251 | codY_Gpos GTP-sensing transcriptional pleiotropic | 91.17 | |
| PF02082 | 83 | Rrf2: Transcriptional regulator; InterPro: IPR0009 | 91.05 | |
| PF07848 | 70 | PaaX: PaaX-like protein; InterPro: IPR012906 This | 90.78 | |
| PRK12325 | 439 | prolyl-tRNA synthetase; Provisional | 90.74 | |
| PF09202 | 82 | Rio2_N: Rio2, N-terminal; InterPro: IPR015285 This | 90.72 | |
| COG1378 | 247 | Predicted transcriptional regulators [Transcriptio | 90.72 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 90.54 | |
| cd00770 | 297 | SerRS_core Seryl-tRNA synthetase (SerRS) class II | 90.53 | |
| TIGR00498 | 199 | lexA SOS regulatory protein LexA. LexA acts as a h | 90.26 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 90.06 | |
| PF14338 | 92 | Mrr_N: Mrr N-terminal domain | 90.0 | |
| cd07377 | 66 | WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi | 89.82 | |
| PRK10163 | 271 | DNA-binding transcriptional repressor AllR; Provis | 89.71 | |
| TIGR02431 | 248 | pcaR_pcaU beta-ketoadipate pathway transcriptional | 89.66 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 89.53 | |
| PF10771 | 65 | DUF2582: Protein of unknown function (DUF2582); In | 89.19 | |
| PRK11569 | 274 | transcriptional repressor IclR; Provisional | 89.16 | |
| PRK15090 | 257 | DNA-binding transcriptional regulator KdgR; Provis | 89.14 | |
| PF03965 | 115 | Penicillinase_R: Penicillinase repressor; InterPro | 89.0 | |
| TIGR00738 | 132 | rrf2_super rrf2 family protein (putative transcrip | 88.72 | |
| COG4189 | 308 | Predicted transcriptional regulator [Transcription | 88.68 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 88.51 | |
| cd00778 | 261 | ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) | 88.47 | |
| TIGR00637 | 99 | ModE_repress ModE molybdate transport repressor do | 88.41 | |
| COG1349 | 253 | GlpR Transcriptional regulators of sugar metabolis | 88.28 | |
| PF00126 | 60 | HTH_1: Bacterial regulatory helix-turn-helix prote | 88.26 | |
| PRK08661 | 477 | prolyl-tRNA synthetase; Provisional | 88.02 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 88.0 | |
| PF14277 | 163 | DUF4364: Domain of unknown function (DUF4364) | 87.74 | |
| cd07153 | 116 | Fur_like Ferric uptake regulator(Fur) and related | 87.72 | |
| PRK09954 | 362 | putative kinase; Provisional | 87.66 | |
| PF04182 | 75 | B-block_TFIIIC: B-block binding subunit of TFIIIC; | 87.61 | |
| PRK06474 | 178 | hypothetical protein; Provisional | 87.56 | |
| PF09639 | 88 | YjcQ: YjcQ protein; InterPro: IPR018597 YjcQ is a | 87.51 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 87.15 | |
| PF06969 | 66 | HemN_C: HemN C-terminal domain; InterPro: IPR01072 | 87.12 | |
| PRK10434 | 256 | srlR DNA-bindng transcriptional repressor SrlR; Pr | 87.11 | |
| PF02002 | 105 | TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 | 87.06 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 86.99 | |
| PF05584 | 72 | Sulfolobus_pRN: Sulfolobus plasmid regulatory prot | 86.96 | |
| PF13814 | 191 | Replic_Relax: Replication-relaxation | 86.9 | |
| PRK13509 | 251 | transcriptional repressor UlaR; Provisional | 86.89 | |
| COG3373 | 108 | Uncharacterized protein conserved in archaea [Func | 86.41 | |
| PRK10906 | 252 | DNA-binding transcriptional repressor GlpR; Provis | 86.41 | |
| TIGR00414 | 418 | serS seryl-tRNA synthetase. This model represents | 86.28 | |
| cd00774 | 254 | GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik | 86.23 | |
| PRK12444 | 639 | threonyl-tRNA synthetase; Reviewed | 86.17 | |
| PF14502 | 48 | HTH_41: Helix-turn-helix domain | 86.16 | |
| PRK00135 | 188 | scpB segregation and condensation protein B; Revie | 86.03 | |
| PRK03601 | 275 | transcriptional regulator HdfR; Provisional | 85.37 | |
| PF08784 | 102 | RPA_C: Replication protein A C terminal; InterPro: | 85.15 | |
| COG1725 | 125 | Predicted transcriptional regulators [Transcriptio | 85.11 | |
| COG1414 | 246 | IclR Transcriptional regulator [Transcription] | 84.74 | |
| PRK11242 | 296 | DNA-binding transcriptional regulator CynR; Provis | 84.73 | |
| PRK14799 | 545 | thrS threonyl-tRNA synthetase; Provisional | 84.23 | |
| TIGR00408 | 472 | proS_fam_I prolyl-tRNA synthetase, family I. Proly | 84.03 | |
| COG4190 | 144 | Predicted transcriptional regulator [Transcription | 83.91 | |
| TIGR02944 | 130 | suf_reg_Xantho FeS assembly SUF system regulator, | 83.89 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 83.69 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 83.61 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 83.52 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 83.5 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 83.44 | |
| PRK11014 | 141 | transcriptional repressor NsrR; Provisional | 83.11 | |
| PF00392 | 64 | GntR: Bacterial regulatory proteins, gntR family; | 83.01 | |
| PRK09802 | 269 | DNA-binding transcriptional regulator AgaR; Provis | 82.13 | |
| PF11313 | 85 | DUF3116: Protein of unknown function (DUF3116); In | 82.06 | |
| PF09756 | 188 | DDRGK: DDRGK domain; InterPro: IPR019153 This is a | 81.88 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 81.67 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 81.61 | |
| PRK10837 | 290 | putative DNA-binding transcriptional regulator; Pr | 80.86 | |
| COG1959 | 150 | Predicted transcriptional regulator [Transcription | 80.83 | |
| PRK10094 | 308 | DNA-binding transcriptional activator AllS; Provis | 80.66 | |
| TIGR03339 | 279 | phn_lysR aminoethylphosphonate catabolism associat | 80.59 | |
| TIGR02036 | 302 | dsdC D-serine deaminase transcriptional activator. | 80.33 | |
| PRK09791 | 302 | putative DNA-binding transcriptional regulator; Pr | 80.24 | |
| PLN02678 | 448 | seryl-tRNA synthetase | 80.04 |
| >KOG2784 consensus Phenylalanyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-107 Score=787.49 Aligned_cols=342 Identities=53% Similarity=0.875 Sum_probs=329.8
Q ss_pred CHHHHHHHHHhhCCCCCChHHHHHHhCCCHHHHHHHHHHhccCCcEEEEeeeeEEEEeChhHHHHhhcCChHHHHHHhcC
Q 018851 1 MAEEAILGYLEKNEQISDSGNFAAERGFDHNDVVNVIKSLHGFRYIDAQDIKRETWVLTGEGKKYAAEGSPEVQLFLAVP 80 (349)
Q Consensus 1 ~~e~~iL~~L~~~~~~~~~~~la~~~g~~~~~v~~~~~~L~~kgli~~~~~~~~~~~LTeEG~~~l~~G~PE~rl~~~l~ 80 (349)
+++.+||..|...++ .++.+++...+.+|++++++++||++.|+|+++..+++.|.||+||++++++||||++|+++++
T Consensus 3 ~~~~~iL~~L~~~de-~~s~~l~a~~~~~h~~~v~al~SL~a~~~i~~~~~~~~~~~LT~EG~~i~~eGS~E~~v~~~i~ 81 (483)
T KOG2784|consen 3 ALAEKILEKLQESDE-VDSSDLAAPFNEDHQQVVGALKSLQAGGVIEVKDVETKTYELTAEGEEIAREGSHEALVFESIP 81 (483)
T ss_pred hHHHHHHHHHHhccC-CChhhhcCchhhhhHHHHHHHHHHhhcCceEEEeeeeEEEeeChhHHHHHhcCCcceeeeeccC
Confidence 367899999999888 7888999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCHHHHHhhcCchhhhhHHHHHhhCCcEeeCce-eeeccccchHHHHHHHHHHHcCCCCCHHHHHHHhhcCceeee
Q 018851 81 AEGSISKDELQKKLDPAVFKIGCSQAGKNKWVEMGKQ-VSRKVQNVEDKVKDLLLQVQNGHALSKEEISSLKARKLIVPQ 159 (349)
Q Consensus 81 ~~g~~~~~el~~~~~~~~~~ig~g~~~k~~wi~i~~~-i~~~~~~~~d~~~~~L~~i~~g~~~~~~~~~~LkkRkLi~~~ 159 (349)
+.| +.++||++.+ ..||+++|+|+|||+++++ +.++++++.|.+++.|+.|..|.. +.+++++|||||||.+.
T Consensus 82 ~~g-l~~~el~~k~----~giG~~~A~~nkWI~~d~~~~~r~v~~itD~v~~~l~~ik~g~~-~ake~~dlkKrKLi~~~ 155 (483)
T KOG2784|consen 82 EEG-LAIAELMKKL----VGIGQSKAFKNKWIRVDKSRVVRDVDSITDEVRNQLQQIKRGSA-DAKEVEDLKKRKLISEV 155 (483)
T ss_pred ccc-cCHHHHHhhh----hccchhhhhccceEEecCcccccchhhhhHHHHHHHHHHHcCcc-hHHHHHHHHhhhhhccc
Confidence 887 9999999875 2399999999999999999 778899999999999999998764 37899999999999999
Q ss_pred EEEEEEEecCCCCCcchhhhhcccccccccCCCcccccccccccccCCCCCCCCCCChHHHHHHHHHHHHhhCCceecCC
Q 018851 160 TWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPT 239 (349)
Q Consensus 160 ~~~~~~i~kg~~~~~~~~~~~~~lt~e~l~sg~Wk~~~fk~yn~~~~~~~~~~g~~HPl~~~~~~ir~if~~mGF~e~~~ 239 (349)
+++.|.++||++|+.++.+..||||+|||.||+|++..||+|||++.|.++.+|++|||++|++++|+||.+|||+||+|
T Consensus 156 ~~~~f~v~KGp~Fst~l~k~eTdLT~emi~~gsw~dl~FK~YNF~a~G~~p~~G~lHPLmKvR~eFRqiF~emGFsEMpt 235 (483)
T KOG2784|consen 156 KIKVFSVTKGPNFSTSLTKLETDLTSEMIASGSWKDLKFKPYNFNAEGVPPSSGHLHPLMKVREEFRQIFFEMGFSEMPT 235 (483)
T ss_pred eeEEEEEecCCcccchHHHHhhhccHHHhccCchhhccCcccCcccCCCCCCCCccchHHHHHHHHHHHHHHcccccccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCceeeeehhhhccCCCCCCCCCCCCCeeeecCCCCCCCCCHHHHHHHHHHhhcCCCCCCCcccccchhhhhccccCCCC
Q 018851 240 NNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHESGGYGSRGYGYEWKREEANKNLLRTHT 319 (349)
Q Consensus 240 ~~~Ves~fwNFDaLf~PqdHPARd~~DTFyl~~p~~~~~~p~~~~erVk~vHe~Gg~gS~Gw~Y~W~~~~a~~~vLRTHT 319 (349)
|++|||+|||||||||||+|||||.||||||++|+.+..+|+||++|||++|+.|||||+||+|+|+.+||+++||||||
T Consensus 236 n~yVEssFWNFDALfqPQqHpARDahDTFfl~~Pa~s~~~p~dY~~rVk~vH~~G~ygs~GY~y~wk~eEaqKnvLRTHT 315 (483)
T KOG2784|consen 236 NNYVESSFWNFDALFQPQQHPARDAHDTFFLKDPATSTKFPEDYLERVKAVHEQGGYGSIGYRYNWKLEEAQKNVLRTHT 315 (483)
T ss_pred ccchhhccccchhhcCcccCCccccccceEecChhhcccCCHHHHHHHHHHHhcCCcCCcccCCCCCHHHHHHHHHhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred chhHHHHHHHhhcCCCCCceEEecCceecC
Q 018851 320 TAVSSRMLKALAEKPFAPKKVFLHRSCFQK 349 (349)
Q Consensus 320 Tavs~r~L~~l~~~~~~p~k~fsi~rVfR~ 349 (349)
||||||+||+||+++|.|.||||||||||+
T Consensus 316 TavSArmLy~LAk~~f~p~K~FSIDrVFRN 345 (483)
T KOG2784|consen 316 TAVSARMLYRLAKKGFKPAKYFSIDRVFRN 345 (483)
T ss_pred HHhhHHHHHHHHhCCCCcccccchhhhhhc
Confidence 999999999999999999999999999995
|
|
| >PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain | Back alignment and domain information |
|---|
| >PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional | Back alignment and domain information |
|---|
| >PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01409 tRNA-synt_2d: tRNA synthetases class II core domain (F); InterPro: IPR002319 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PLN02788 phenylalanine-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR00469 pheS_mito phenylalanyl-tRNA synthetase, mitochondrial | Back alignment and domain information |
|---|
| >TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase | Back alignment and domain information |
|---|
| >COG2024 Phenylalanyl-tRNA synthetase alpha subunit (archaeal type) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2783 consensus Phenylalanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain | Back alignment and domain information |
|---|
| >TIGR02367 PylS pyrrolysyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00442 hisS histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK00037 hisS histidyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A | Back alignment and domain information |
|---|
| >PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A | Back alignment and domain information |
|---|
| >TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >PRK11512 DNA-binding transcriptional repressor MarR; Provisional | Back alignment and domain information |
|---|
| >smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein | Back alignment and domain information |
|---|
| >PRK03573 transcriptional regulator SlyA; Provisional | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >COG1846 MarR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain | Back alignment and domain information |
|---|
| >cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >PF03551 PadR: Transcriptional regulator PadR-like family; InterPro: IPR005149 Phenolic acids, also called substituted hydroxycinnamic acids, are abundant in the plant kingdom because they are involved in the structure of plant cell walls and are present in some vacuoles | Back alignment and domain information |
|---|
| >PRK10870 transcriptional repressor MprA; Provisional | Back alignment and domain information |
|---|
| >TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family | Back alignment and domain information |
|---|
| >TIGR00471 pheT_arch phenylalanyl-tRNA synthetase, beta subunit | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >TIGR03433 padR_acidobact transcriptional regulator, Acidobacterial, PadR-family | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >PRK13777 transcriptional regulator Hpr; Provisional | Back alignment and domain information |
|---|
| >PRK03902 manganese transport transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PLN02265 probable phenylalanyl-tRNA synthetase beta chain | Back alignment and domain information |
|---|
| >PF07381 DUF1495: Winged helix DNA-binding domain (DUF1495); InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length | Back alignment and domain information |
|---|
| >TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR | Back alignment and domain information |
|---|
| >PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit | Back alignment and domain information |
|---|
| >TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein | Back alignment and domain information |
|---|
| >PF10007 DUF2250: Uncharacterized protein conserved in archaea (DUF2250); InterPro: IPR019254 Members of this family of hypothetical archaeal proteins have no known function | Back alignment and domain information |
|---|
| >PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >PF03501 S10_plectin: Plectin/S10 domain; InterPro: IPR005326 This presumed domain is found at the N terminus of some isoforms of the cytoskeletal muscle protein plectin as well as the ribosomal S10 protein | Back alignment and domain information |
|---|
| >PTZ00034 40S ribosomal protein S10; Provisional | Back alignment and domain information |
|---|
| >PRK12420 histidyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1321 TroR Mn-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02530 histidine-tRNA ligase | Back alignment and domain information |
|---|
| >PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A | Back alignment and domain information |
|---|
| >cd00769 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain | Back alignment and domain information |
|---|
| >smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element | Back alignment and domain information |
|---|
| >PRK11050 manganese transport regulator MntR; Provisional | Back alignment and domain information |
|---|
| >COG4754 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >CHL00201 syh histidine-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >PF01638 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002577 The hxlR-type HTH domain is a domain of ~90-100 amino acids present in putative transcription regulators with a winged helix-turn-helix (wHTH) structure | Back alignment and domain information |
|---|
| >COG1497 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK09416 lstR lineage-specific thermal regulator protein; Provisional | Back alignment and domain information |
|---|
| >COG1695 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >COG2345 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >TIGR02719 repress_PhaQ poly-beta-hydroxybutyrate-responsive repressor | Back alignment and domain information |
|---|
| >COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG5045 Ribosomal protein S10E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >PRK05638 threonine synthase; Validated | Back alignment and domain information |
|---|
| >COG4742 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PHA02943 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >CHL00192 syfB phenylalanyl-tRNA synthetase beta chain; Provisional | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea | Back alignment and domain information |
|---|
| >cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >COG2512 Predicted membrane-associated trancriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG0072 PheT Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3355 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK09350 poxB regulator PoxA; Provisional | Back alignment and domain information |
|---|
| >PLN02972 Histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >PF02295 z-alpha: Adenosine deaminase z-alpha domain; InterPro: IPR000607 Double-stranded RNA-specific adenosine deaminase (3 | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >PRK09194 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12305 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >COG3432 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF04458 DUF505: Protein of unknown function (DUF505); InterPro: IPR007548 This is a family of uncharacterised prokaryotic proteins | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >COG1733 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase | Back alignment and domain information |
|---|
| >PRK00629 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK00413 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon [Transcription / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09834 DNA-binding transcriptional activator MhpR; Provisional | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain | Back alignment and domain information |
|---|
| >PHA00738 putative HTH transcription regulator | Back alignment and domain information |
|---|
| >PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A | Back alignment and domain information |
|---|
| >TIGR00472 pheT_bact phenylalanyl-tRNA synthetase, beta subunit, non-spirochete bacterial | Back alignment and domain information |
|---|
| >PRK10141 DNA-binding transcriptional repressor ArsR; Provisional | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family | Back alignment and domain information |
|---|
| >TIGR00418 thrS threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK00215 LexA repressor; Validated | Back alignment and domain information |
|---|
| >KOG3344 consensus 40s ribosomal protein s10 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II | Back alignment and domain information |
|---|
| >PF10771 DUF2582: Protein of unknown function (DUF2582); InterPro: IPR019707 This entry represents conserved proteins found in bacteria and archaea | Back alignment and domain information |
|---|
| >PF09821 AAA_assoc_C: C-terminal AAA-associated domain; InterPro: IPR018632 Members of this family are found in various prokaryotic ABC transporters, predominantly involved in nitrate, sulphonate and bicarbonate translocation | Back alignment and domain information |
|---|
| >TIGR02277 PaaX_trns_reg phenylacetic acid degradation operon negative regulatory protein PaaX | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes | Back alignment and domain information |
|---|
| >TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY | Back alignment and domain information |
|---|
| >PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp | Back alignment and domain information |
|---|
| >PF07848 PaaX: PaaX-like protein; InterPro: IPR012906 This entry describes the N-terminal region of proteins that are similar to, and nclude, the product of the paaX gene of Escherichia coli (P76086 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK12325 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF09202 Rio2_N: Rio2, N-terminal; InterPro: IPR015285 This N-terminal domain is found in RIO2 kinases, and is structurally homologous to the winged helix (wHTH) domain | Back alignment and domain information |
|---|
| >COG1378 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >TIGR00498 lexA SOS regulatory protein LexA | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >PF14338 Mrr_N: Mrr N-terminal domain | Back alignment and domain information |
|---|
| >cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators | Back alignment and domain information |
|---|
| >PRK10163 DNA-binding transcriptional repressor AllR; Provisional | Back alignment and domain information |
|---|
| >TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >PF10771 DUF2582: Protein of unknown function (DUF2582); InterPro: IPR019707 This entry represents conserved proteins found in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK11569 transcriptional repressor IclR; Provisional | Back alignment and domain information |
|---|
| >PRK15090 DNA-binding transcriptional regulator KdgR; Provisional | Back alignment and domain information |
|---|
| >PF03965 Penicillinase_R: Penicillinase repressor; InterPro: IPR005650 Proteins in this entry are transcriptional regulators found in a variety of bacteria and a small number of archaea | Back alignment and domain information |
|---|
| >TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) | Back alignment and domain information |
|---|
| >COG4189 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >TIGR00637 ModE_repress ModE molybdate transport repressor domain | Back alignment and domain information |
|---|
| >COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK08661 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF14277 DUF4364: Domain of unknown function (DUF4364) | Back alignment and domain information |
|---|
| >cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators | Back alignment and domain information |
|---|
| >PRK09954 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PF04182 B-block_TFIIIC: B-block binding subunit of TFIIIC; InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks | Back alignment and domain information |
|---|
| >PRK06474 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF09639 YjcQ: YjcQ protein; InterPro: IPR018597 YjcQ is a protein of approx | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >PF06969 HemN_C: HemN C-terminal domain; InterPro: IPR010723 Proteins containing this domain are all oxygen-independent coproporphyrinogen-III oxidases (HemN) | Back alignment and domain information |
|---|
| >PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional | Back alignment and domain information |
|---|
| >PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PF05584 Sulfolobus_pRN: Sulfolobus plasmid regulatory protein; InterPro: IPR008848 This family consists of several plasmid regulatory proteins from the extreme thermophilic and acidophilic archaea Sulfolobus | Back alignment and domain information |
|---|
| >PF13814 Replic_Relax: Replication-relaxation | Back alignment and domain information |
|---|
| >PRK13509 transcriptional repressor UlaR; Provisional | Back alignment and domain information |
|---|
| >COG3373 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PRK10906 DNA-binding transcriptional repressor GlpR; Provisional | Back alignment and domain information |
|---|
| >TIGR00414 serS seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK12444 threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PF14502 HTH_41: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PRK00135 scpB segregation and condensation protein B; Reviewed | Back alignment and domain information |
|---|
| >PRK03601 transcriptional regulator HdfR; Provisional | Back alignment and domain information |
|---|
| >PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) | Back alignment and domain information |
|---|
| >COG1725 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >COG1414 IclR Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK11242 DNA-binding transcriptional regulator CynR; Provisional | Back alignment and domain information |
|---|
| >PRK14799 thrS threonyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I | Back alignment and domain information |
|---|
| >COG4190 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11014 transcriptional repressor NsrR; Provisional | Back alignment and domain information |
|---|
| >PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PRK09802 DNA-binding transcriptional regulator AgaR; Provisional | Back alignment and domain information |
|---|
| >PF11313 DUF3116: Protein of unknown function (DUF3116); InterPro: IPR021464 This family of proteins with unknown function appears to be restricted to Bacillales | Back alignment and domain information |
|---|
| >PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PRK10837 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG1959 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK10094 DNA-binding transcriptional activator AllS; Provisional | Back alignment and domain information |
|---|
| >TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator | Back alignment and domain information |
|---|
| >TIGR02036 dsdC D-serine deaminase transcriptional activator | Back alignment and domain information |
|---|
| >PRK09791 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PLN02678 seryl-tRNA synthetase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 349 | ||||
| 3l4g_A | 508 | Crystal Structure Of Homo Sapiens Cytoplasmic Pheny | 1e-78 | ||
| 1pys_A | 350 | Phenylalanyl-Trna Synthetase From Thermus Thermophi | 1e-10 | ||
| 2akw_A | 266 | Crystal Structure Of T.thermophilus Phenylalanyl-tr | 8e-09 | ||
| 2rhq_A | 294 | Phers From Staphylococcus Haemolyticus- Rational Pr | 8e-08 | ||
| 3pco_A | 327 | Crystal Structure Of E. Coli Phenylalanine-Trna Syn | 2e-07 |
| >pdb|3L4G|A Chain A, Crystal Structure Of Homo Sapiens Cytoplasmic Phenylalanyl-T Synthetase Length = 508 | Back alignment and structure |
|
| >pdb|1PYS|A Chain A, Phenylalanyl-Trna Synthetase From Thermus Thermophilus Length = 350 | Back alignment and structure |
| >pdb|2AKW|A Chain A, Crystal Structure Of T.thermophilus Phenylalanyl-trna Synthetase Complexed With P-cl-phenylalanine Length = 266 | Back alignment and structure |
| >pdb|2RHQ|A Chain A, Phers From Staphylococcus Haemolyticus- Rational Protein Engineering And Inhibitor Studies Length = 294 | Back alignment and structure |
| >pdb|3PCO|A Chain A, Crystal Structure Of E. Coli Phenylalanine-Trna Synthetase Complexed With Phenylalanine And Amp Length = 327 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Length = 508 | Back alignment and structure |
|---|
Score = 384 bits (988), Expect = e-131
Identities = 170/349 (48%), Positives = 223/349 (63%), Gaps = 14/349 (4%)
Query: 3 EEAILGYLEKNEQISDSGNFAAERGFDHNDVVNVIKSLHGFRY-IDAQDIKRETWVLTGE 61
E +L LE ++ DS AAE G +H VV +KSL I+A+ + W LT E
Sbjct: 7 AELLLRRLEASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKHWELTAE 66
Query: 62 GKKYAAEGSPEVQLFLAVPAEGSISKDELQKKLDPAVFKIGCSQAGKNKWVEMGK----- 116
G++ A EGS E ++F ++P EG +++ EL + K+G S+A NKW+ + K
Sbjct: 67 GEEIAREGSHEARVFRSIPPEG-LAQSELMRL---PSGKVGFSKAMSNKWIRVDKSAADG 122
Query: 117 -QVSRKVQNVEDKVKDLLLQVQNGHA--LSKEEISSLKARKLIVPQTWKGYSVRKGPNYA 173
+V R V ++ED+V+ L V+ G A L ++E S L+ RKL+ T K Y V KG ++
Sbjct: 123 PRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFS 182
Query: 174 PKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMG 233
K T+L+ E + G W++ FK YNF A G + GHLHPLLKVR Q + IFL+MG
Sbjct: 183 TSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG 242
Query: 234 FEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHES 293
F EMPT+NF+ESSFWNFDALFQPQQHPARD HDTFFL +P+ +LP DYV+RVKR H
Sbjct: 243 FTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQ 302
Query: 294 GGYGSRGYGYEWKREEANKNLLRTHTTAVSSRMLKALA-EKPFAPKKVF 341
GGYGS+GY Y WK +EA KNLLRTHTT+ S+R L LA +KPF P K F
Sbjct: 303 GGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKYF 351
|
| >2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Length = 685 | Back alignment and structure |
|---|
| >2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Length = 701 | Back alignment and structure |
|---|
| >2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Length = 665 | Back alignment and structure |
|---|
| >2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Length = 648 | Back alignment and structure |
|---|
| >1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 3teh_A* 2aly_A* 2akw_A* 2amc_A* Length = 350 | Back alignment and structure |
|---|
| >2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* Length = 294 | Back alignment and structure |
|---|
| >3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* 3teg_A* 3tup_A Length = 415 | Back alignment and structure |
|---|
| >2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* Length = 534 | Back alignment and structure |
|---|
| >3pco_A Phenylalanyl-tRNA synthetase, alpha subunit; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Length = 327 | Back alignment and structure |
|---|
| >2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Length = 549 | Back alignment and structure |
|---|
| >3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* Length = 290 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 349 | |||
| 3l4g_A | 508 | Phenylalanyl-tRNA synthetase alpha chain; aminoacy | 100.0 | |
| 2odr_B | 648 | Phosphoseryl-tRNA synthetase; phosphoserine tRNA s | 100.0 | |
| 2odr_D | 685 | Phosphoseryl-tRNA synthetase; phosphoserine tRNA s | 100.0 | |
| 2odr_A | 665 | Phosphoseryl-tRNA synthetase; phosphoserine tRNA s | 100.0 | |
| 2odr_C | 701 | Phosphoseryl-tRNA synthetase; phosphoserine tRNA s | 100.0 | |
| 2du7_A | 549 | O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l | 100.0 | |
| 3cmq_A | 415 | Phenylalanyl-tRNA synthetase, mitochondrial; class | 99.96 | |
| 3pco_A | 327 | Phenylalanyl-tRNA synthetase, alpha subunit; amino | 99.94 | |
| 1b7y_A | 350 | Phers, protein (phenylalanyl-tRNA synthetase); enz | 99.93 | |
| 2du3_A | 534 | O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l | 99.83 | |
| 2rhq_A | 294 | Phenylalanyl-tRNA synthetase alpha chain; heterote | 99.83 | |
| 3l4g_B | 589 | Phenylalanyl-tRNA synthetase beta chain; aminoacyl | 99.09 | |
| 2rhq_B | 795 | Phenylalanyl-tRNA synthetase beta chain; heterotet | 99.06 | |
| 3qtc_A | 290 | Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet | 99.05 | |
| 3dsq_A | 288 | Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t | 99.0 | |
| 1b7y_B | 785 | Phers, protein (phenylalanyl-tRNA synthetase); enz | 98.66 | |
| 3ig2_A | 213 | Phenylalanyl-tRNA synthetase beta chain; phers, MC | 98.22 | |
| 3ica_A | 213 | Phenylalanyl-tRNA synthetase beta chain; APC61692. | 98.08 | |
| 2xvc_A | 59 | ESCRT-III, SSO0910; cell cycle, cell division, cyt | 97.88 | |
| 1nnh_A | 294 | Asparaginyl-tRNA synthetase-related peptide; struc | 97.84 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 97.77 | |
| 1tbx_A | 99 | ORF F-93, hypothetical 11.0 kDa protein; sulfolobu | 97.75 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 97.74 | |
| 1x54_A | 434 | Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe | 97.74 | |
| 1bja_A | 95 | Transcription regulatory protein MOTA; activation | 97.69 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 97.68 | |
| 3fm5_A | 150 | Transcriptional regulator; MCSG, PF04017, PSI, MAR | 97.66 | |
| 2fbh_A | 146 | Transcriptional regulator PA3341; MARR, transcript | 97.64 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 97.64 | |
| 3hsr_A | 140 | HTH-type transcriptional regulator SARZ; helix-tur | 97.63 | |
| 3bro_A | 141 | Transcriptional regulator; helix_TURN_helix, multi | 97.62 | |
| 3oop_A | 143 | LIN2960 protein; protein structure initiative, PSI | 97.61 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 97.59 | |
| 2pex_A | 153 | Transcriptional regulator OHRR; transcription regu | 97.59 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 97.58 | |
| 2bv6_A | 142 | MGRA, HTH-type transcriptional regulator MGRA; mul | 97.57 | |
| 3k0l_A | 162 | Repressor protein; helix-turn-helix, structural ge | 97.57 | |
| 3eco_A | 139 | MEPR; mutlidrug efflux pump regulator winged helix | 97.57 | |
| 3s2w_A | 159 | Transcriptional regulator, MARR family; structural | 97.57 | |
| 2rdp_A | 150 | Putative transcriptional regulator MARR; PFAM PF01 | 97.56 | |
| 2fbi_A | 142 | Probable transcriptional regulator; MARR, APC5816, | 97.56 | |
| 1lj9_A | 144 | Transcriptional regulator SLYA; HTH DNA binding pr | 97.55 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 97.55 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 97.55 | |
| 3f3x_A | 144 | Transcriptional regulator, MARR family, putative; | 97.55 | |
| 2eth_A | 154 | Transcriptional regulator, putative, MAR family; M | 97.54 | |
| 4aik_A | 151 | Transcriptional regulator SLYA; transcription, tra | 97.54 | |
| 3cjn_A | 162 | Transcriptional regulator, MARR family; silicibact | 97.53 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 97.51 | |
| 2hr3_A | 147 | Probable transcriptional regulator; MCSG, structur | 97.51 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 97.51 | |
| 2qvo_A | 95 | Uncharacterized protein AF_1382; PSI, structural g | 97.5 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 97.49 | |
| 3g3z_A | 145 | NMB1585, transcriptional regulator, MARR family; t | 97.47 | |
| 3bj6_A | 152 | Transcriptional regulator, MARR family; helix-turn | 97.47 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 97.47 | |
| 2qww_A | 154 | Transcriptional regulator, MARR family; YP_013417. | 97.46 | |
| 3kp7_A | 151 | Transcriptional regulator TCAR; multiple drug resi | 97.46 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 97.45 | |
| 2pg4_A | 95 | Uncharacterized protein; structural genomics, join | 97.45 | |
| 3bja_A | 139 | Transcriptional regulator, MARR family, putative; | 97.45 | |
| 3e6m_A | 161 | MARR family transcriptional regulator; APC88769, s | 97.44 | |
| 3deu_A | 166 | Transcriptional regulator SLYA; MARR, WING-helix, | 97.44 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 97.42 | |
| 1r7j_A | 95 | Conserved hypothetical protein SSO10A; winged heli | 97.42 | |
| 4esf_A | 117 | PADR-like transcriptional regulator; PADR family, | 97.37 | |
| 4hbl_A | 149 | Transcriptional regulator, MARR family; HTH, trans | 97.37 | |
| 1s3j_A | 155 | YUSO protein; structural genomics, MARR transcript | 97.35 | |
| 3hhh_A | 116 | Transcriptional regulator, PADR family; PF03551, s | 97.35 | |
| 3nqo_A | 189 | MARR-family transcriptional regulator; structural | 97.35 | |
| 3cdh_A | 155 | Transcriptional regulator, MARR family; helix-turn | 97.34 | |
| 3f8b_A | 116 | Transcriptional regulator, PADR-like family; winge | 97.32 | |
| 1z91_A | 147 | Organic hydroperoxide resistance transcriptional; | 97.3 | |
| 3jw4_A | 148 | Transcriptional regulator, MARR/EMRR family; DNA-b | 97.29 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 97.29 | |
| 2nyx_A | 168 | Probable transcriptional regulatory protein, RV14; | 97.29 | |
| 3l7w_A | 108 | Putative uncharacterized protein SMU.1704; PADR, t | 97.27 | |
| 1z7u_A | 112 | Hypothetical protein EF0647; winged-helix-turn-hel | 97.25 | |
| 3df8_A | 111 | Possible HXLR family transcriptional factor; APC89 | 97.23 | |
| 3u2r_A | 168 | Regulatory protein MARR; structural genomics, PSI- | 97.22 | |
| 1wyd_A | 429 | Hypothetical aspartyl-tRNA synthetase; archaea, LI | 97.22 | |
| 4b8x_A | 147 | SCO5413, possible MARR-transcriptional regulator; | 97.2 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 97.2 | |
| 4esb_A | 115 | Transcriptional regulator, PADR family; DNA bindin | 97.18 | |
| 2frh_A | 127 | SARA, staphylococcal accessory regulator A; winged | 97.15 | |
| 1xma_A | 145 | Predicted transcriptional regulator; southea colla | 97.11 | |
| 2fsw_A | 107 | PG_0823 protein; alpha-beta structure, helix-turn- | 97.1 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 97.07 | |
| 3boq_A | 160 | Transcriptional regulator, MARR family; MARR famil | 97.06 | |
| 3elk_A | 117 | Putative transcriptional regulator TA0346; structu | 97.05 | |
| 1z7m_A | 344 | ATP phosphoribosyltransferase regulatory subunit; | 97.04 | |
| 2obp_A | 96 | Putative DNA-binding protein; structural genomics, | 97.04 | |
| 2esh_A | 118 | Conserved hypothetical protein TM0937; APC5794, st | 97.03 | |
| 1n9w_A | 422 | Aspartyl-tRNA synthetase 2; biosynthetic protein; | 97.0 | |
| 1okr_A | 123 | MECI, methicillin resistance regulatory protein ME | 96.99 | |
| 1p4x_A | 250 | Staphylococcal accessory regulator A homologue; wi | 96.97 | |
| 1yyv_A | 131 | Putative transcriptional regulator; reductive meth | 96.95 | |
| 3ri2_A | 123 | Transcriptional regulator, PADR-like family; PSI-b | 96.93 | |
| 1yg2_A | 179 | Gene activator APHA; virulence factor, winged heli | 96.91 | |
| 4fx0_A | 148 | Probable transcriptional repressor protein; helix- | 96.9 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 96.9 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 96.87 | |
| 2fxa_A | 207 | Protease production regulatory protein HPR; protea | 96.87 | |
| 3hrs_A | 214 | Metalloregulator SCAR; DTXR/MNTR family member, tr | 96.86 | |
| 2f2e_A | 146 | PA1607; transcription factor, helix-TRUN-helix, AP | 96.8 | |
| 2dql_A | 115 | PEX protein; circadian clock associated protein, c | 96.79 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 96.79 | |
| 4a5n_A | 131 | Uncharacterized HTH-type transcriptional regulato; | 96.77 | |
| 2wte_A | 244 | CSA3; antiviral protein, viral resistance, winged | 96.77 | |
| 3rac_A | 373 | Histidine-tRNA ligase; structural genomics, PSI-bi | 96.76 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 96.74 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 96.64 | |
| 2fbk_A | 181 | Transcriptional regulator, MARR family; winged-hel | 96.61 | |
| 2co5_A | 99 | Viral protein F93; viral protein-winged helix comp | 96.6 | |
| 2p8t_A | 200 | Hypothetical protein PH0730; pyrococcus horikoshii | 96.6 | |
| 1qe0_A | 420 | Histidyl-tRNA synthetase; class II tRNA synthetase | 96.6 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 96.6 | |
| 2h09_A | 155 | Transcriptional regulator MNTR; transcription regu | 96.43 | |
| 2lnb_A | 80 | Z-DNA-binding protein 1; structural genomics, nort | 96.39 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 96.33 | |
| 1p4x_A | 250 | Staphylococcal accessory regulator A homologue; wi | 96.3 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 96.27 | |
| 1sd4_A | 126 | Penicillinase repressor; BLAI, MECI, methicillin, | 96.16 | |
| 3lc0_A | 456 | Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t | 96.15 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 96.13 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 96.1 | |
| 3net_A | 465 | Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas | 96.04 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 96.03 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 96.01 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 95.93 | |
| 3lmm_A | 583 | Uncharacterized protein; multi-domained alpha-beta | 95.91 | |
| 3od1_A | 400 | ATP phosphoribosyltransferase regulatory subunit; | 95.9 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 95.9 | |
| 1hsj_A | 487 | Fusion protein consisting of staphylococcus access | 95.88 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 95.85 | |
| 2qq9_A | 226 | Diphtheria toxin repressor; regulator, DTXR, helix | 95.85 | |
| 3l9f_A | 204 | Putative uncharacterized protein SMU.1604C; PADR, | 95.84 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 95.82 | |
| 2e1n_A | 138 | PEX, period extender; circadian clock, DNA binding | 95.78 | |
| 1fx7_A | 230 | Iron-dependent repressor IDER; DTXR, iron-dependen | 95.76 | |
| 4g84_A | 464 | Histidine--tRNA ligase, cytoplasmic; synthetase; 2 | 95.75 | |
| 3u1d_A | 151 | Uncharacterized protein; GNTR-superfamily, structu | 95.69 | |
| 2dk5_A | 91 | DNA-directed RNA polymerase III 39 kDa polypeptide | 95.67 | |
| 2xzm_7 | 162 | Plectin/S10 domain containing protein; ribosome, t | 95.62 | |
| 3u5c_K | 105 | 40S ribosomal protein S10-A; translation, ribosome | 95.58 | |
| 3cta_A | 230 | Riboflavin kinase; structural genomics, transferas | 95.56 | |
| 4g85_A | 517 | Histidine-tRNA ligase, cytoplasmic; synthetase; 3. | 95.56 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 95.39 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 95.38 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 95.35 | |
| 2zfw_A | 148 | PEX; five alpha-helices + one beta-sheet, circadia | 95.35 | |
| 2qlz_A | 232 | Transcription factor PF0095; 2.50A {Pyrococcus fur | 95.35 | |
| 1wu7_A | 434 | Histidyl-tRNA synthetase; ligase, structural genom | 95.33 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 95.33 | |
| 1htt_A | 423 | Histidyl-tRNA synthetase; complex (tRNA synthetase | 95.22 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 95.1 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 95.1 | |
| 1h4v_B | 421 | Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA | 95.06 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 94.88 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 94.86 | |
| 2g9w_A | 138 | Conserved hypothetical protein; DNA-binding domain | 94.77 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 94.65 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 94.64 | |
| 2o0m_A | 345 | Transcriptional regulator, SORC family; structural | 94.6 | |
| 4e51_A | 467 | Histidine--tRNA ligase; seattle structural genomic | 94.55 | |
| 1p6r_A | 82 | Penicillinase repressor; transcription regulation, | 94.4 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 94.35 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 94.29 | |
| 2vxz_A | 165 | Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Py | 94.07 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 93.99 | |
| 2p4w_A | 202 | Transcriptional regulatory protein ARSR family; ar | 93.69 | |
| 2v79_A | 135 | DNA replication protein DNAD; primosome, DNA-bindi | 93.66 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 93.65 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 93.65 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 93.62 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 93.38 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 93.36 | |
| 3pco_B | 795 | Phenylalanyl-tRNA synthetase, beta chain; aminoacy | 93.28 | |
| 2vn2_A | 128 | DNAD, chromosome replication initiation protein; D | 93.17 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 93.17 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 93.16 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 93.15 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 92.87 | |
| 2y75_A | 129 | HTH-type transcriptional regulator CYMR; DNA bindi | 92.85 | |
| 2i4l_A | 458 | Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud | 92.8 | |
| 2g7u_A | 257 | Transcriptional regulator; ICLR family, structural | 92.45 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 92.42 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 92.13 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 92.11 | |
| 2xrn_A | 241 | HTH-type transcriptional regulator TTGV; DNA-bindi | 91.97 | |
| 2hgc_A | 102 | YJCQ protein; SR346, structure, autostructure, NES | 91.74 | |
| 1bm9_A | 122 | RTP, TER, replication terminator protein; DNA-bind | 91.47 | |
| 2k4b_A | 99 | Transcriptional regulator; DNA binding protein, wi | 91.15 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 90.97 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 90.7 | |
| 2b0l_A | 102 | GTP-sensing transcriptional pleiotropic repressor; | 90.62 | |
| 3a32_A | 471 | Probable threonyl-tRNA synthetase 1; aeropyrum per | 90.57 | |
| 3l09_A | 266 | Putative transcriptional regulator; structural gen | 90.47 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 90.43 | |
| 1usy_A | 275 | ATP phosphoribosyltransferase regulatory subunit; | 90.31 | |
| 2o0y_A | 260 | Transcriptional regulator; ICLR-family, structural | 90.16 | |
| 1nyr_A | 645 | Threonyl-tRNA synthetase 1; ATP, threonine, ligase | 89.96 | |
| 3a5y_A | 345 | GENX, putative lysyl-tRNA synthetase; aminoacyl-tR | 89.8 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 89.77 | |
| 3eyi_A | 72 | Z-DNA-binding protein 1; alternative splicing, DNA | 89.6 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 89.25 | |
| 1hc7_A | 477 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 89.19 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 88.48 | |
| 2rkh_A | 180 | Putative APHA-like transcription factor; ZP_002083 | 88.29 | |
| 1uly_A | 192 | Hypothetical protein PH1932; helix-turn-helix, str | 88.16 | |
| 2yu3_A | 95 | DNA-directed RNA polymerase III 39 kDa polypeptide | 88.14 | |
| 3mq0_A | 275 | Transcriptional repressor of the blcabc operon; he | 87.97 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 87.68 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 87.4 | |
| 1nj1_A | 501 | PROR, proline-tRNA synthetase, proline--tRNA ligas | 87.26 | |
| 2o03_A | 131 | Probable zinc uptake regulation protein FURB; DNA- | 87.16 | |
| 2ia2_A | 265 | Putative transcriptional regulator; SAD, PSI-2, st | 87.12 | |
| 2l02_A | 82 | Uncharacterized protein; structural genomics, nort | 86.93 | |
| 1j5y_A | 187 | Transcriptional regulator, biotin repressor famil; | 86.34 | |
| 1nj8_A | 459 | Proline-tRNA synthetase, proline--tRNA ligase; cla | 86.31 | |
| 2fe3_A | 145 | Peroxide operon regulator; oxidative stress regula | 86.29 | |
| 3a74_A | 493 | Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, | 86.16 | |
| 1ylf_A | 149 | RRF2 family protein; structural genomics, transcri | 86.0 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 85.86 | |
| 2j3l_A | 572 | Prolyl-tRNA synthetase; class II aminoacyl- T synt | 85.76 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 85.75 | |
| 4hvc_A | 519 | Bifunctional glutamate/proline--tRNA ligase; ligas | 85.59 | |
| 3r4k_A | 260 | Transcriptional regulator, ICLR family; DNA/RNA-bi | 85.44 | |
| 2ijl_A | 135 | AGR_C_4647P, molybdenum-binding transcriptional re | 85.4 | |
| 3rkx_A | 323 | Biotin-[acetyl-COA-carboxylase] ligase; biotin pro | 85.33 | |
| 4ham_A | 134 | LMO2241 protein; structural genomics, PSI-biology, | 84.82 | |
| 1evl_A | 401 | Threonyl-tRNA synthetase; amino acid recognition, | 84.16 | |
| 4g6q_A | 182 | Putative uncharacterized protein; structural genom | 83.96 | |
| 1v4r_A | 102 | Transcriptional repressor; helix-turn-helix, winge | 83.94 | |
| 3t8r_A | 143 | Staphylococcus aureus CYMR; transcriptional regula | 83.94 | |
| 3tqn_A | 113 | Transcriptional regulator, GNTR family; regulatory | 83.86 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 83.75 | |
| 2xig_A | 150 | Ferric uptake regulation protein; hpfur, transcrip | 83.75 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 83.44 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 83.36 | |
| 1mzb_A | 136 | Ferric uptake regulation protein; ferric uptake re | 83.36 | |
| 2v9v_A | 135 | Selenocysteine-specific elongation factor; transcr | 83.33 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 83.32 | |
| 2l01_A | 77 | Uncharacterized protein; structural genomics, nort | 83.26 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 83.16 | |
| 2l02_A | 82 | Uncharacterized protein; structural genomics, nort | 83.05 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 82.92 | |
| 3lwf_A | 159 | LIN1550 protein, putative transcriptional regulato | 82.91 | |
| 1sd4_A | 126 | Penicillinase repressor; BLAI, MECI, methicillin, | 82.58 | |
| 1t6s_A | 162 | Conserved hypothetical protein; A winged helix-tur | 82.23 | |
| 3neu_A | 125 | LIN1836 protein; structural genomics, PSI-2, prote | 81.96 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 81.94 | |
| 1bia_A | 321 | BIRA bifunctional protein; transcription regulatio | 81.93 | |
| 2gqq_A | 163 | Leucine-responsive regulatory protein; helix-turn- | 81.77 | |
| 1eov_A | 487 | ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy | 81.57 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 81.41 | |
| 1e1o_A | 504 | Lysyl-tRNA synthetase, heat inducible; ligase, ami | 80.58 | |
| 2l01_A | 77 | Uncharacterized protein; structural genomics, nort | 80.46 | |
| 3mwm_A | 139 | ZUR, putative metal uptake regulation protein; FUR | 80.08 |
| >3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-90 Score=706.59 Aligned_cols=344 Identities=50% Similarity=0.835 Sum_probs=169.2
Q ss_pred CHHHHHHHHHhhCC-CCCChHHHHHHhCCCHHHHHHHHHHhccCC-cEEEEeeeeEEEEeChhHHHHhhcCChHHHHHHh
Q 018851 1 MAEEAILGYLEKNE-QISDSGNFAAERGFDHNDVVNVIKSLHGFR-YIDAQDIKRETWVLTGEGKKYAAEGSPEVQLFLA 78 (349)
Q Consensus 1 ~~e~~iL~~L~~~~-~~~~~~~la~~~g~~~~~v~~~~~~L~~kg-li~~~~~~~~~~~LTeEG~~~l~~G~PE~rl~~~ 78 (349)
+++++||.+|.+.+ . .+++++|+.+|++|++|+++++||+++| ||++++.+.+.|+||+||++|+++||||+||+++
T Consensus 5 ~~~~~iL~~l~~~~~~-~~~~~~a~~~~~~~~~v~~~~~~L~~~~~~v~~~~~~~~~~~Lt~eg~~~~~~G~pE~~~~~~ 83 (508)
T 3l4g_A 5 QVAELLLRRLEASDGG-LDSAELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKHWELTAEGEEIAREGSHEARVFRS 83 (508)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred HHHHHHHHHHHhcCCC-cCHHHHHHHcCCCHHHHHHHHHHHHhCCCeEEEEEEEEEEEEECHHHHHHHHcCCHHHHHHHH
Confidence 37899999998776 5 5889999999999999999999999998 9999999999999999999999999999999999
Q ss_pred cCcCCCCCHHHHHhhcCchhhhhHHHHHhhCCcEeeCce------eeeccccchHHHHHHHHHHHcCC--CCCHHHHHHH
Q 018851 79 VPAEGSISKDELQKKLDPAVFKIGCSQAGKNKWVEMGKQ------VSRKVQNVEDKVKDLLLQVQNGH--ALSKEEISSL 150 (349)
Q Consensus 79 l~~~g~~~~~el~~~~~~~~~~ig~g~~~k~~wi~i~~~------i~~~~~~~~d~~~~~L~~i~~g~--~~~~~~~~~L 150 (349)
|+.+| ++++||.+ + +.++||+|||+|+|||+++++ +.++++.+.|.++..|+.|.++. .++++.+++|
T Consensus 84 ~~~~~-~~~~~l~~-~--~~~~i~~~~~~k~~wi~~~~~~~~~~~~~~~~~~~~d~~~~~l~~~~~~~~~~~~~~~~~~l 159 (508)
T 3l4g_A 84 IPPEG-LAQSELMR-L--PSGKVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSEL 159 (508)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred hhhcC-ccHHHHhc-C--cchhHHHHHHHHCCCEEecCCCcCcceEeeccCccchHHHHHHHHHHcCCCCCCCHHHHHHH
Confidence 98644 89999987 3 467999999999999999885 44566667788899999998654 3567889999
Q ss_pred hhcCceeeeEEEEEEEecCCCCCcchhhhhcccccccccCCCcccccccccccccCCCCCCCCCCChHHHHHHHHHHHHh
Q 018851 151 KARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFL 230 (349)
Q Consensus 151 kkRkLi~~~~~~~~~i~kg~~~~~~~~~~~~~lt~e~l~sg~Wk~~~fk~yn~~~~~~~~~~g~~HPl~~~~~~ir~if~ 230 (349)
||||||+..+.+.|.|++|++|+++..+++|+||+|||.||+||++.||+|||+++|+++..|..||+++++++||++|.
T Consensus 160 kkRklv~~~~~~~~~v~~g~~~~~~~~~~~t~lT~e~l~sg~Wk~~~f~~y~~~~~g~~~~~G~lHPl~~v~~~Ir~if~ 239 (508)
T 3l4g_A 160 RKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFL 239 (508)
T ss_dssp -----------------------CCSCCCCCSCCTTTTTSSTTTTSCCCCCCSSSCCCCCCCCBCCHHHHHHHHHHHHHH
T ss_pred HhcCCeEEEEEEEEEEecchhhhhhhhhhhccCCHHHhcCCCcCCCCceecccCCCCCCCCCCCCCHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hCCceecCCCCceeeeehhhhccCCCCCCCCCCCCCeeeecCCCCCCCCCHHHHHHHHHHhhcCCCCCCCcccccchhhh
Q 018851 231 QMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHESGGYGSRGYGYEWKREEA 310 (349)
Q Consensus 231 ~mGF~e~~~~~~Ves~fwNFDaLf~PqdHPARd~~DTFyl~~p~~~~~~p~~~~erVk~vHe~Gg~gS~Gw~Y~W~~~~a 310 (349)
+|||+||.+||+||++|||||+||+||||||||+||||||++|.....+|++|++||++|||+||+||+||+|.|+.+++
T Consensus 240 ~mGF~Ev~t~~~ves~~~NFDaLn~P~dHPaR~~~Dtfyi~~P~~~~~~~e~~~~~v~~~He~g~~~s~g~~~~~~~~~~ 319 (508)
T 3l4g_A 240 EMGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEA 319 (508)
T ss_dssp HTTCEECCCCCSEEEHHHHTGGGTCCSSSTTSSTTTSCBBSTTCBCSCCCHHHHHHHHHHHHTCBTTBCCCCSCCCHHHH
T ss_pred HCcCeEeccCCccccHHHHHHhcCCCCCCcccccCceEEEcCccccccccHHHHHhhhhhhhccccCCcccccccccccc
Confidence 99999987899999999999999999999999999999999998777889999999999999999999999999999999
Q ss_pred hccccCCCCchhHHHHHHHhhc-CCCCCceEEecCceecC
Q 018851 311 NKNLLRTHTTAVSSRMLKALAE-KPFAPKKVFLHRSCFQK 349 (349)
Q Consensus 311 ~~~vLRTHTTavs~r~L~~l~~-~~~~p~k~fsi~rVfR~ 349 (349)
.+.+||||||++++|+|+.+.. ...+|+|+|+||||||+
T Consensus 320 ~~~vLRThtsp~~lr~l~~N~~~~~~~PiriFeiGrVFR~ 359 (508)
T 3l4g_A 320 RKNLLRTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRN 359 (508)
T ss_dssp TBEEECCCTHHHHHHHHHHHHTSSSCCCEEEEEEEEEECC
T ss_pred ccccccCCChHHHHHHHHHhhhhcCCCCceEEEEccEEec
Confidence 9999999999999999987654 35579999999999996
|
| >2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* 3teg_A* 3tup_A | Back alignment and structure |
|---|
| >3pco_A Phenylalanyl-tRNA synthetase, alpha subunit; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} | Back alignment and structure |
|---|
| >1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 3teh_A* 2aly_A* 2akw_A* 2amc_A* | Back alignment and structure |
|---|
| >2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* | Back alignment and structure |
|---|
| >2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* | Back alignment and structure |
|---|
| >3l4g_B Phenylalanyl-tRNA synthetase beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2rhq_B Phenylalanyl-tRNA synthetase beta chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_B* | Back alignment and structure |
|---|
| >3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* | Back alignment and structure |
|---|
| >3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A | Back alignment and structure |
|---|
| >1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: a.6.1.1 a.6.1.1 b.40.4.4 b.153.1.1 d.58.13.1 d.104.1.1 PDB: 1b70_B* 1eiy_B 1jjc_B* 1pys_B 2akw_B* 2aly_B* 2amc_B* 3hfz_B* 3teh_B* 2iy5_B* | Back alignment and structure |
|---|
| >3ig2_A Phenylalanyl-tRNA synthetase beta chain; phers, MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.09A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ica_A Phenylalanyl-tRNA synthetase beta chain; APC61692.1, phenylalanyl-tRNA SYNT beta subunit, structural genomics, PSI-2; HET: TAM; 2.44A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A | Back alignment and structure |
|---|
| >1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A | Back alignment and structure |
|---|
| >3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} | Back alignment and structure |
|---|
| >3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* | Back alignment and structure |
|---|
| >3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} | Back alignment and structure |
|---|
| >3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A | Back alignment and structure |
|---|
| >4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} | Back alignment and structure |
|---|
| >4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} | Back alignment and structure |
|---|
| >3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3f8b_A Transcriptional regulator, PADR-like family; winged helix turn helix, transcription regulator; 2.00A {Lactococcus lactis subsp} SCOP: a.4.5.0 PDB: 3f8c_A* 3f8f_A* | Back alignment and structure |
|---|
| >1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* | Back alignment and structure |
|---|
| >3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >4esb_A Transcriptional regulator, PADR family; DNA binding protein, HTH fold; 2.50A {Bacillus cereus} | Back alignment and structure |
|---|
| >2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D | Back alignment and structure |
|---|
| >1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3elk_A Putative transcriptional regulator TA0346; structural genomics, PSI-2, prote structure initiative; 1.70A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* | Back alignment and structure |
|---|
| >2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 | Back alignment and structure |
|---|
| >2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* | Back alignment and structure |
|---|
| >1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A | Back alignment and structure |
|---|
| >1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 | Back alignment and structure |
|---|
| >1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A | Back alignment and structure |
|---|
| >2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2dql_A PEX protein; circadian clock associated protein, circadian clock protein; 1.70A {Anabaena SP} | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A | Back alignment and structure |
|---|
| >2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2co5_A Viral protein F93; viral protein-winged helix complex, winged helix, DNA-bindin WHTH, disulfide bond, STIV; 2.2A {Sulfolobus turreted icosahedral virus} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 | Back alignment and structure |
|---|
| >1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A | Back alignment and structure |
|---|
| >3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >3lmm_A Uncharacterized protein; multi-domained alpha-beta protein, structural genomics, PSI- 2, protein structure initiative; 3.00A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... | Back alignment and structure |
|---|
| >3l9f_A Putative uncharacterized protein SMU.1604C; PADR, transcription regulator; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >2e1n_A PEX, period extender; circadian clock, DNA binding protein, circadian clock protei; 1.80A {Synechococcus elongatus pcc 7942} | Back alignment and structure |
|---|
| >1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A | Back alignment and structure |
|---|
| >4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} | Back alignment and structure |
|---|
| >2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 | Back alignment and structure |
|---|
| >2xzm_7 Plectin/S10 domain containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_7 | Back alignment and structure |
|---|
| >3u5c_K 40S ribosomal protein S10-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_K | Back alignment and structure |
|---|
| >3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 | Back alignment and structure |
|---|
| >4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >2zfw_A PEX; five alpha-helices + one beta-sheet, circadian clock protein; 2.90A {Synechococcus SP} | Back alignment and structure |
|---|
| >2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A | Back alignment and structure |
|---|
| >1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 | Back alignment and structure |
|---|
| >4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2vxz_A Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus} | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 | Back alignment and structure |
|---|
| >2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >3pco_B Phenylalanyl-tRNA synthetase, beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} | Back alignment and structure |
|---|
| >2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* | Back alignment and structure |
|---|
| >2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A | Back alignment and structure |
|---|
| >2hgc_A YJCQ protein; SR346, structure, autostructure, NESG, PSI-2, northeast structural genomics consortium, protein structure initiative; NMR {Bacillus subtilis} SCOP: a.4.5.77 | Back alignment and structure |
|---|
| >1bm9_A RTP, TER, replication terminator protein; DNA-binding protein, contrahelicase; 2.00A {Bacillus subtilis} SCOP: a.4.5.7 PDB: 1f4k_A 1j0r_A 2dpd_A 2dpu_A 2efw_A* 2dqr_A | Back alignment and structure |
|---|
| >2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 | Back alignment and structure |
|---|
| >3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A | Back alignment and structure |
|---|
| >3l09_A Putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG, protein structure initiative transcription regulator; 2.81A {Jannaschia SP} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* | Back alignment and structure |
|---|
| >2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* | Back alignment and structure |
|---|
| >3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3eyi_A Z-DNA-binding protein 1; alternative splicing, DNA-binding, polymorphism, DNA binding protein/Z-DNA complex, DNA binding protein/DNA complex; 1.45A {Homo sapiens} PDB: 2l4m_A | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2rkh_A Putative APHA-like transcription factor; ZP_00208345.1, STRU genomics, joint center for structural genomics, JCSG; 2.00A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A | Back alignment and structure |
|---|
| >2yu3_A DNA-directed RNA polymerase III 39 kDa polypeptide F variant; winged helix domain, RNA polymerase III C39 subunit, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* | Back alignment and structure |
|---|
| >2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2l02_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 | Back alignment and structure |
|---|
| >1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 | Back alignment and structure |
|---|
| >2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* | Back alignment and structure |
|---|
| >3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* | Back alignment and structure |
|---|
| >1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} | Back alignment and structure |
|---|
| >2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural GE DNA-binding protein, PSI-2, PROT structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* | Back alignment and structure |
|---|
| >4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* | Back alignment and structure |
|---|
| >4g6q_A Putative uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.08A {Kribbella flavida} | Back alignment and structure |
|---|
| >1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 | Back alignment and structure |
|---|
| >3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A | Back alignment and structure |
|---|
| >3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 | Back alignment and structure |
|---|
| >2v9v_A Selenocysteine-specific elongation factor; transcription, protein conformational change, transcription elongation factor SELB; 1.10A {Moorella thermoacetica} SCOP: a.4.5.35 a.4.5.35 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2l01_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2l02_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A | Back alignment and structure |
|---|
| >1t6s_A Conserved hypothetical protein; A winged helix-turn-helix, structural genomics, BSGC structu by NIH, protein structure initiative, PSI; 1.95A {Chlorobium tepidum tls} SCOP: a.4.5.60 a.4.5.60 | Back alignment and structure |
|---|
| >3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* | Back alignment and structure |
|---|
| >2gqq_A Leucine-responsive regulatory protein; helix-turn-helix, transcription; 3.20A {Escherichia coli} PDB: 2l4a_A | Back alignment and structure |
|---|
| >1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A | Back alignment and structure |
|---|
| >2l01_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 349 | ||||
| d1jjca_ | 266 | d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alph | 4e-25 |
| >d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} Length = 266 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS species: Thermus thermophilus [TaxId: 274]
Score = 100 bits (249), Expect = 4e-25
Identities = 40/141 (28%), Positives = 58/141 (41%), Gaps = 29/141 (20%)
Query: 207 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHD 266
G G LHP+ + ++L +IF +G++ + VES F+NFDAL P+ HPARD D
Sbjct: 8 GASLFSGGLHPITLMERELVEIFRALGYQAVE-GPEVESEFFNFDALNIPEHHPARDMWD 66
Query: 267 TFFLEEPSTTRELPEDYVERVKRVHESGGYGSRGYGYEWKREEANKNLLRTHTTAVSSRM 326
TF+L E P E + LLRTHT+ + R
Sbjct: 67 TFWLTGEGFRLEGP------------------------LGEEVEGRLLLRTHTSPMQVRY 102
Query: 327 LKALAEKPFAPKKVFLHRSCF 347
P ++ + F
Sbjct: 103 ----MVAHTPPFRIVVPGRVF 119
|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 349 | |||
| d1jjca_ | 266 | Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS | 100.0 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 97.85 | |
| d2fbia1 | 136 | Probable transcriptional regulator PA4135 {Pseudom | 97.47 | |
| d2a61a1 | 139 | Transcriptional regulator TM0710 {Thermotoga marit | 97.43 | |
| d3ctaa1 | 85 | Ta1064 (RFK), N-terminal domain {Thermoplasma acid | 97.43 | |
| d2etha1 | 140 | Putative transcriptional regulator TM0816 {Thermot | 97.43 | |
| d1lnwa_ | 141 | MexR repressor {Pseudomonas aeruginosa [TaxId: 287 | 97.42 | |
| d1lj9a_ | 144 | Transcriptional regulator SlyA {Enterococcus faeca | 97.4 | |
| d2fbha1 | 137 | Transcriptional regulator PA3341 {Pseudomonas aeru | 97.36 | |
| d1jgsa_ | 138 | Multiple antibiotic resistance repressor, MarR {Es | 97.33 | |
| d1s3ja_ | 143 | Putative transcriptional regulator YusO {Bacillus | 97.3 | |
| d3deua1 | 140 | Transcriptional regulator SlyA {Salmonella typhimu | 97.3 | |
| d3broa1 | 135 | Transcriptional regulator OEOE1854 {Oenococcus oen | 97.29 | |
| d2hr3a1 | 145 | Probable transcriptional regulator PA3067 {Pseudom | 97.29 | |
| d1z91a1 | 137 | Organic hydroperoxide resistance transcriptional r | 97.17 | |
| d2bv6a1 | 136 | Transcriptional regulator MgrA {Staphylococcus aur | 97.13 | |
| d1xmaa_ | 103 | Predicted transcriptional regulator {Clostridium t | 97.03 | |
| d2fxaa1 | 162 | Protease production regulatory protein Hpr {Bacill | 96.92 | |
| d1xmka1 | 73 | Z-alpha domain of dsRNA-specific adenosine deamina | 96.89 | |
| d1p4xa2 | 125 | Staphylococcal accessory regulator A homolog, SarS | 96.86 | |
| d2frha1 | 115 | Pleiotropic regulator of virulence genes, SarA {St | 96.85 | |
| d1p4xa1 | 125 | Staphylococcal accessory regulator A homolog, SarS | 96.84 | |
| d1hsja1 | 115 | Staphylococcal accessory regulator A homolog, SarR | 96.76 | |
| d1r7ja_ | 90 | Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu | 96.76 | |
| d1z7ma1 | 318 | ATP phosphoribosyltransferase regulatory subunit H | 96.75 | |
| d1yg2a_ | 178 | Hypothetical protein AphA {Vibrio cholerae [TaxId: | 96.6 | |
| d1h4vb2 | 324 | Histidyl-tRNA synthetase (HisRS) {Thermus thermoph | 96.33 | |
| d1wu7a2 | 327 | Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop | 96.3 | |
| d2esha1 | 114 | Hypothetical protein TM0937 {Thermotoga maritima [ | 96.29 | |
| d1ku9a_ | 151 | DNA-binding protein Mj223 {Archaeon Methanococcus | 96.27 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 95.98 | |
| d1jjcb5 | 207 | Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, | 95.93 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 95.82 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 95.82 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 95.81 | |
| d2fbka1 | 172 | Transcriptional regulator DR1159 {Deinococcus radi | 95.78 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 95.76 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 95.72 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 95.67 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 95.57 | |
| d1kmma2 | 322 | Histidyl-tRNA synthetase (HisRS) {Escherichia coli | 95.47 | |
| d1fp2a1 | 101 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 95.42 | |
| d1qe0a2 | 325 | Histidyl-tRNA synthetase (HisRS) {Staphylococcus a | 94.79 | |
| d2p8ta1 | 69 | Hypothetical protein PH0730 {Pyrococcus horikoshii | 94.74 | |
| d1ulya_ | 190 | Hypothetical protein PH1932 {Pyrococcus horikoshii | 94.62 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 94.57 | |
| d2ev0a1 | 61 | Manganese transport regulator MntR {Bacillus subti | 94.53 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 94.5 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 94.47 | |
| d1tw3a1 | 85 | Carminomycin 4-O-methyltransferase {Streptomyces p | 94.41 | |
| d1qzza1 | 92 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 94.4 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 94.37 | |
| d1j75a_ | 57 | Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} | 94.36 | |
| d1usya_ | 275 | ATP phosphoribosyltransferase regulatory subunit H | 94.07 | |
| d2gxba1 | 59 | Z-alpha domain of dsRNA-specific adenosine deamina | 93.97 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 93.91 | |
| d1okra_ | 120 | Methicillin resistance regulatory protein MecI {St | 93.88 | |
| d2fswa1 | 102 | Hypothetical protein PG0823 {Porphyromonas gingiva | 93.84 | |
| d1z7ua1 | 108 | Hypothetical protein EF0647 {Enterococcus faecalis | 93.84 | |
| d2hzta1 | 95 | Putative transcriptional regulator YtcD {Bacillus | 93.83 | |
| d2isya1 | 63 | Iron-dependent regulator IdeR {Mycobacterium tuber | 93.72 | |
| d1stza1 | 87 | Heat-inducible transcription repressor HrcA, N-ter | 93.72 | |
| d1u2wa1 | 108 | Cadmium efflux system accessory protein CadC {Stap | 93.18 | |
| d1yyva1 | 114 | Putative transcriptional regulator YtfH {Salmonell | 93.16 | |
| d2p4wa1 | 194 | Transcriptional regulatory protein PF1790 {Pyrococ | 92.9 | |
| d2obpa1 | 81 | Putative DNA-binding protein ReutB4095 {Ralstonia | 92.87 | |
| d1z6ra1 | 70 | Mlc protein N-terminal domain {Escherichia coli [T | 92.36 | |
| d2f2ea1 | 142 | Hypothetical protein PA1607 {Pseudomonas aeruginos | 91.7 | |
| d1zara1 | 89 | Rio2 serine protein kinase N-terminal domain {Arch | 91.04 | |
| d1hw1a1 | 74 | Fatty acid responsive transcription factor FadR, N | 89.74 | |
| d3bwga1 | 78 | Transcriptional regulator YydK {Bacillus subtilis | 89.45 | |
| d1sfua_ | 70 | 34L {Yaba-like disease virus, YLDV [TaxId: 132475] | 88.71 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 88.58 | |
| d2hoea1 | 62 | N-acetylglucosamine kinase {Thermotoga maritima [T | 88.34 | |
| d1q1ha_ | 88 | Transcription factor E/IIe-alpha, N-terminal domai | 88.32 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 88.15 | |
| d1sd4a_ | 122 | Penicillinase repressor BlaI {Staphylococcus aureu | 88.08 | |
| d1nnha_ | 293 | Hypothetical protein PF1951 {Archaeon Pyrococcus f | 87.65 | |
| d2hs5a1 | 69 | Putative transcriptional regulator RHA1_ro03477 {R | 87.53 | |
| d1eova2 | 353 | Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S | 87.14 | |
| d1b8aa2 | 335 | Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ | 87.02 | |
| d1dpua_ | 69 | C-terminal domain of RPA32 {Human (Homo sapiens) [ | 86.7 | |
| d1xd7a_ | 127 | Hypothetical protein ywnA {Bacillus subtilis [TaxI | 85.56 | |
| d2dk5a1 | 78 | DNA-directed RNA polymerase III subunit RPC6, RPO3 | 84.85 | |
| d2esna1 | 89 | Probable LysR-type transcriptional regulator PA047 | 83.69 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 82.86 | |
| d1b9ma1 | 127 | N-terminal domain of molybdate-dependent transcrip | 82.31 | |
| d1n9wa2 | 304 | Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph | 82.04 | |
| d1c0aa3 | 346 | Aspartyl-tRNA synthetase (AspRS) {Escherichia coli | 81.77 | |
| d1ylfa1 | 138 | Hypothetical protein BC1842 {Bacillus cereus [TaxI | 81.2 | |
| d1kyza1 | 107 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 81.07 | |
| d1nyra4 | 291 | Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a | 81.03 | |
| d1hc7a2 | 272 | Prolyl-tRNA synthetase (ProRS) {Thermus thermophil | 80.8 | |
| d1nj8a3 | 268 | Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc | 80.64 | |
| d2g9wa1 | 122 | Hypothetical protein Rv1846c {Mycobacterium tuberc | 80.3 |
| >d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS species: Thermus thermophilus [TaxId: 274]
Probab=100.00 E-value=4.5e-40 Score=309.27 Aligned_cols=121 Identities=32% Similarity=0.512 Sum_probs=112.1
Q ss_pred ccccccCCCCCCCCCCChHHHHHHHHHHHHhhCCceecCCCCceeeeehhhhccCCCCCCCCCCCCCeeeecCCCCCCCC
Q 018851 200 EYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTREL 279 (349)
Q Consensus 200 ~yn~~~~~~~~~~g~~HPl~~~~~~ir~if~~mGF~e~~~~~~Ves~fwNFDaLf~PqdHPARd~~DTFyl~~p~~~~~~ 279 (349)
++|+++||..+..|+.|||++++++|++||.+|||+++. ||+||++|||||+||+|||||||++|||||++++.
T Consensus 1 kiDvtlPg~~~~~G~~HPl~~~~~~i~~if~~~GF~~~~-gp~ies~~~NFDaLn~P~dHPAR~~~DTfYi~~~~----- 74 (266)
T d1jjca_ 1 RVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVE-GPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEG----- 74 (266)
T ss_dssp CCCTTSCCCCCCCCBCCHHHHHHHHHHHHHHTTTCEECC-CCSEEEHHHHTGGGTCCTTSGGGGGSCCCBEECSS-----
T ss_pred CcceeCCCCCCCCCCCChHHHHHHHHHHHHHHcCCeEee-CCccccchhhhhcccCCcccchhcccceEEEeccc-----
Confidence 478999999999999999999999999999999999997 89999999999999999999999999999999742
Q ss_pred CHHHHHHHHHHhhcCCCCCCCcccccchhhhhccccCCCCchhHHHHHHHhhcCCCCCceEEecCceecC
Q 018851 280 PEDYVERVKRVHESGGYGSRGYGYEWKREEANKNLLRTHTTAVSSRMLKALAEKPFAPKKVFLHRSCFQK 349 (349)
Q Consensus 280 p~~~~erVk~vHe~Gg~gS~Gw~Y~W~~~~a~~~vLRTHTTavs~r~L~~l~~~~~~p~k~fsi~rVfR~ 349 (349)
..|.++|+.+.+.+.||||||||+|+|+|.+. .+|.++|++||||||
T Consensus 75 -------------------~~~~~~~~~~~~~~~lLRTHTS~~q~r~~~~~----~~p~~~~~~g~VyRr 121 (266)
T d1jjca_ 75 -------------------FRLEGPLGEEVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRF 121 (266)
T ss_dssp -------------------CCEECTTSCEECSCEEECSSSTHHHHHHHHHS----CSSEEEEEEEEEECC
T ss_pred -------------------ccccCcccccchhhhhhccCCcHHHHHHHhcc----CCCceEEecccceec
Confidence 35678899999999999999999999999742 359999999999997
|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} | Back information, alignment and structure |
|---|
| >d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1yg2a_ a.4.5.61 (A:) Hypothetical protein AphA {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2esha1 a.4.5.61 (A:4-117) Hypothetical protein TM0937 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jjcb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1zara1 a.4.5.56 (A:2-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} | Back information, alignment and structure |
|---|
| >d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2dk5a1 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esna1 a.4.5.37 (A:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|