Citrus Sinensis ID: 019214

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMFSLCFQDSVLN
cHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHcccccccEEcccccccHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHccccEEEEEccccccccccccccHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEEHHHcHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEcccccccEEEccHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcc
mvlaqlggSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVnlddlaaghnKRRIIQQAIFNELCkmldpgkpsftpkkgkpsvIMFVglqgsgktttctKYAYYhqkkgwkpalvcADTFRAGAFDQLKQNatkakipfygsytesdpvrIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKmdghakgggALSAVaatkspvifigtgehmdefevfdvkpFVSRllgmgdwsgfmdkihevvpmdqqpELLQKLSEGNFTLRIMFSLCFQDSVLN
mvlaqlggSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKivnlddlaaghNKRRIIQQAIFNELCKMLDPGKPsftpkkgkpSVIMFVglqgsgktTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKakipfygsytesdpVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMFSLCFQDSVLN
MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGqaafdqaqafkqSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMFSLCFQDSVLN
*************I*QMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLD*************SVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRH***AALFE*******ATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMFSLCFQ*****
MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHE*****************NFTLRIMFSLCFQDSV**
MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMFSLCFQDSVLN
**LAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMFSLCFQDSV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMFSLCFQDSVLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query344 2.2.26 [Sep-21-2011]
P49972 499 Signal recognition partic N/A no 0.970 0.669 0.955 0.0
P49971 496 Signal recognition partic N/A no 0.970 0.673 0.916 0.0
P49967 495 Signal recognition partic yes no 0.994 0.690 0.883 0.0
P49969 497 Signal recognition partic N/A no 0.970 0.672 0.859 1e-176
P49968 497 Signal recognition partic N/A no 0.970 0.672 0.856 1e-175
P37106 479 Signal recognition partic no no 0.970 0.697 0.850 1e-171
P49966 497 Signal recognition partic no no 0.970 0.672 0.794 1e-158
P49970 493 Signal recognition partic N/A no 0.968 0.675 0.766 1e-154
P14576 504 Signal recognition partic yes no 0.968 0.660 0.649 1e-129
Q5R4R6 504 Signal recognition partic yes no 0.968 0.660 0.646 1e-128
>sp|P49972|SR542_SOLLC Signal recognition particle 54 kDa protein 2 OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function desciption
 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/334 (95%), Positives = 332/334 (99%)

Query: 1   MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV 60
           MVLA+LGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQADVQFKLVR+M TNIKKIV
Sbjct: 1   MVLAELGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIV 60

Query: 61  NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTK 120
           NLDDLAAGHNKRRIIQQA+FNELCK+LDPGKPSFTPKKGKPS++MFVGLQGSGKTTTCTK
Sbjct: 61  NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKPSIVMFVGLQGSGKTTTCTK 120

Query: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFK 180
           YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPV+IAV+GVETFK
Sbjct: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVKIAVDGVETFK 180

Query: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSV 240
           KENCDLIIVDTSGRHKQEAALFEEMRQV+EAT PDLVIFVMDSSIGQAAFDQAQAFKQSV
Sbjct: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVAEATKPDLVIFVMDSSIGQAAFDQAQAFKQSV 240

Query: 241 SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300
           +VGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW
Sbjct: 241 AVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300

Query: 301 SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMF 334
           SGFMDKIHEVVPMDQQPELLQKLSEG+FTLRIM+
Sbjct: 301 SGFMDKIHEVVPMDQQPELLQKLSEGHFTLRIMY 334
Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
Solanum lycopersicum (taxid: 4081)
>sp|P49971|SR541_SOLLC Signal recognition particle 54 kDa protein 1 OS=Solanum lycopersicum PE=3 SV=1 Back     alignment and function description
>sp|P49967|SR543_ARATH Signal recognition particle 54 kDa protein 3 OS=Arabidopsis thaliana GN=SRP-54C PE=2 SV=2 Back     alignment and function description
>sp|P49969|SR542_HORVU Signal recognition particle 54 kDa protein 2 OS=Hordeum vulgare GN=SRP54-2 PE=2 SV=1 Back     alignment and function description
>sp|P49968|SR541_HORVU Signal recognition particle 54 kDa protein 1 OS=Hordeum vulgare GN=SRP54-1 PE=2 SV=1 Back     alignment and function description
>sp|P37106|SR541_ARATH Signal recognition particle 54 kDa protein 1 OS=Arabidopsis thaliana GN=SRP-54A PE=2 SV=1 Back     alignment and function description
>sp|P49966|SR542_ARATH Signal recognition particle 54 kDa protein 2 OS=Arabidopsis thaliana GN=SRP-54B PE=3 SV=2 Back     alignment and function description
>sp|P49970|SR543_HORVU Signal recognition particle 54 kDa protein 3 OS=Hordeum vulgare GN=SRP54-3 PE=2 SV=1 Back     alignment and function description
>sp|P14576|SRP54_MOUSE Signal recognition particle 54 kDa protein OS=Mus musculus GN=Srp54 PE=1 SV=2 Back     alignment and function description
>sp|Q5R4R6|SRP54_PONAB Signal recognition particle 54 kDa protein OS=Pongo abelii GN=SRP54 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
350535032 499 signal recognition particle 54 kDa prote 0.970 0.669 0.955 0.0
255553241 497 signal recognition particle 54 kD protei 0.970 0.672 0.961 0.0
449468938 495 PREDICTED: signal recognition particle 5 0.970 0.674 0.952 0.0
224139052 491 predicted protein [Populus trichocarpa] 0.970 0.680 0.952 0.0
224059270 493 predicted protein [Populus trichocarpa] 0.970 0.677 0.952 0.0
449522379392 PREDICTED: signal recognition particle 5 0.970 0.852 0.952 0.0
297743482431 unnamed protein product [Vitis vinifera] 0.970 0.774 0.943 0.0
225442910 495 PREDICTED: signal recognition particle 5 0.970 0.674 0.943 0.0
356550626 500 PREDICTED: signal recognition particle 5 0.970 0.668 0.940 0.0
356526231 495 PREDICTED: signal recognition particle 5 0.970 0.674 0.943 0.0
>gi|350535032|ref|NP_001234428.1| signal recognition particle 54 kDa protein 2 [Solanum lycopersicum] gi|1711512|sp|P49972.1|SR542_SOLLC RecName: Full=Signal recognition particle 54 kDa protein 2; Short=SRP54 gi|556902|emb|CAA84288.1| 54-kD signal recognition particle (SRP) specific protein [Solanum lycopersicum] Back     alignment and taxonomy information
 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/334 (95%), Positives = 332/334 (99%)

Query: 1   MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV 60
           MVLA+LGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQADVQFKLVR+M TNIKKIV
Sbjct: 1   MVLAELGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIV 60

Query: 61  NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTK 120
           NLDDLAAGHNKRRIIQQA+FNELCK+LDPGKPSFTPKKGKPS++MFVGLQGSGKTTTCTK
Sbjct: 61  NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKPSIVMFVGLQGSGKTTTCTK 120

Query: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFK 180
           YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPV+IAV+GVETFK
Sbjct: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVKIAVDGVETFK 180

Query: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSV 240
           KENCDLIIVDTSGRHKQEAALFEEMRQV+EAT PDLVIFVMDSSIGQAAFDQAQAFKQSV
Sbjct: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVAEATKPDLVIFVMDSSIGQAAFDQAQAFKQSV 240

Query: 241 SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300
           +VGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW
Sbjct: 241 AVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300

Query: 301 SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMF 334
           SGFMDKIHEVVPMDQQPELLQKLSEG+FTLRIM+
Sbjct: 301 SGFMDKIHEVVPMDQQPELLQKLSEGHFTLRIMY 334

Source: Solanum lycopersicum

Species: Solanum lycopersicum

Genus: Solanum

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255553241|ref|XP_002517663.1| signal recognition particle 54 kD protein, putative [Ricinus communis] gi|223543295|gb|EEF44827.1| signal recognition particle 54 kD protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449468938|ref|XP_004152178.1| PREDICTED: signal recognition particle 54 kDa protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224139052|ref|XP_002322968.1| predicted protein [Populus trichocarpa] gi|222867598|gb|EEF04729.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224059270|ref|XP_002299799.1| predicted protein [Populus trichocarpa] gi|222847057|gb|EEE84604.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449522379|ref|XP_004168204.1| PREDICTED: signal recognition particle 54 kDa protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297743482|emb|CBI36349.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442910|ref|XP_002264159.1| PREDICTED: signal recognition particle 54 kDa protein 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356550626|ref|XP_003543686.1| PREDICTED: signal recognition particle 54 kDa protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356526231|ref|XP_003531722.1| PREDICTED: signal recognition particle 54 kDa protein 2-like isoform 1 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
TAIR|locus:2028563 495 AT1G48900 [Arabidopsis thalian 0.994 0.690 0.848 1.2e-154
TAIR|locus:2037803 479 ATHSRP54A "signal recognition 0.991 0.711 0.812 1.5e-145
TAIR|locus:2157809 497 AT5G49500 "AT5G49500" [Arabido 0.994 0.688 0.757 2e-134
ZFIN|ZDB-GENE-040426-818 504 srp54 "signal recognition part 0.982 0.670 0.629 1.1e-112
UNIPROTKB|Q2T9U1 504 SRP54 "Signal recognition part 0.982 0.670 0.620 7.6e-112
UNIPROTKB|P61010 504 SRP54 "Signal recognition part 0.982 0.670 0.620 7.6e-112
UNIPROTKB|P61011 504 SRP54 "Signal recognition part 0.982 0.670 0.620 7.6e-112
UNIPROTKB|F2Z5M9 504 SRP54 "Uncharacterized protein 0.982 0.670 0.620 7.6e-112
UNIPROTKB|Q4R965 504 SRP54 "Signal recognition part 0.982 0.670 0.620 7.6e-112
UNIPROTKB|Q5R4R6 504 SRP54 "Signal recognition part 0.982 0.670 0.620 7.6e-112
TAIR|locus:2028563 AT1G48900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1508 (535.9 bits), Expect = 1.2e-154, P = 1.2e-154
 Identities = 292/344 (84%), Positives = 317/344 (92%)

Query:     1 MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV 60
             MVLA+LGG I+RAIQQMSN TIIDEK LNECLNEITRALLQ+DV F LV+EMQ+NIKKIV
Sbjct:     1 MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIV 60

Query:    61 NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTK 120
             NL+DLAAGHNKRRII+QAIF+ELCKMLDPGKP+F PKK K SV+MFVGLQG+GKTTTCTK
Sbjct:    61 NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKASVVMFVGLQGAGKTTTCTK 120

Query:   121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFK 180
             YAYYHQKKG+KPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPV+IAVEGV+TFK
Sbjct:   121 YAYYHQKKGYKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVKIAVEGVDTFK 180

Query:   181 KENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGXXXXXXXXXXXXSV 240
             KENCDLIIVDTSGRHKQEA+LFEEMRQV+EAT PDLVIFVMDSSIG            SV
Sbjct:   181 KENCDLIIVDTSGRHKQEASLFEEMRQVAEATKPDLVIFVMDSSIGQAAFDQAQAFKQSV 240

Query:   241 SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300
             +VGAVI+TKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW
Sbjct:   241 AVGAVIITKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300

Query:   301 SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMFSLCFQDSVLN 344
             SGF+DK+ EVVP DQQPELL+KLS+GNFTLRIM+   FQ+ +LN
Sbjct:   301 SGFVDKLQEVVPKDQQPELLEKLSQGNFTLRIMYDQ-FQN-ILN 342
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003729 "mRNA binding" evidence=ISS
GO:0005525 "GTP binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0005786 "signal recognition particle, endoplasmic reticulum targeting" evidence=ISS
GO:0006614 "SRP-dependent cotranslational protein targeting to membrane" evidence=IEA
GO:0006617 "SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition" evidence=ISS
GO:0008312 "7S RNA binding" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0048500 "signal recognition particle" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
GO:0051607 "defense response to virus" evidence=RCA
TAIR|locus:2037803 ATHSRP54A "signal recognition particle 54 kDa subunit" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157809 AT5G49500 "AT5G49500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-818 srp54 "signal recognition particle 54" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9U1 SRP54 "Signal recognition particle 54 kDa protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61010 SRP54 "Signal recognition particle 54 kDa protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61011 SRP54 "Signal recognition particle 54 kDa protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5M9 SRP54 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R965 SRP54 "Signal recognition particle 54 kDa protein" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R4R6 SRP54 "Signal recognition particle 54 kDa protein" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q75K18SRP54_DICDINo assigned EC number0.56490.95630.6070yesno
Q00179SRP54_ASPNGNo assigned EC number0.54050.96220.6198yesno
Q5R4R6SRP54_PONABNo assigned EC number0.64670.96800.6607yesno
P21565SRP54_SCHPONo assigned EC number0.54980.95630.6302yesno
P14576SRP54_MOUSENo assigned EC number0.64970.96800.6607yesno
P49971SR541_SOLLCNo assigned EC number0.91640.97090.6733N/Ano
P49970SR543_HORVUNo assigned EC number0.76640.96800.6754N/Ano
P49972SR542_SOLLCNo assigned EC number0.95500.97090.6693N/Ano
Q2T9U1SRP54_BOVINNo assigned EC number0.64670.96800.6607yesno
P61010SRP54_CANFANo assigned EC number0.64670.96800.6607yesno
P61011SRP54_HUMANNo assigned EC number0.64670.96800.6607yesno
Q99150SRP54_YARLINo assigned EC number0.54020.94470.6063yesno
Q6AYB5SRP54_RATNo assigned EC number0.64670.96800.6607yesno
P49968SR541_HORVUNo assigned EC number0.85620.97090.6720N/Ano
P49969SR542_HORVUNo assigned EC number0.85920.97090.6720N/Ano
P49967SR543_ARATHNo assigned EC number0.88370.99410.6909yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
TIGR01425429 TIGR01425, SRP54_euk, signal recognition particle 0.0
COG0541 451 COG0541, Ffh, Signal recognition particle GTPase [ 1e-138
PRK00771 437 PRK00771, PRK00771, signal recognition particle pr 1e-135
pfam00448196 pfam00448, SRP54, SRP54-type protein, GTPase domai 1e-107
smart00962197 smart00962, SRP54, SRP54-type protein, GTPase doma 2e-92
PRK10867433 PRK10867, PRK10867, signal recognition particle pr 7e-87
TIGR00959428 TIGR00959, ffh, signal recognition particle protei 2e-85
cd03115173 cd03115, SRP, The signal recognition particle (SRP 8e-74
PRK14974336 PRK14974, PRK14974, cell division protein FtsY; Pr 3e-67
COG0552340 COG0552, FtsY, Signal recognition particle GTPase 2e-66
PRK10416318 PRK10416, PRK10416, signal recognition particle-do 2e-64
TIGR00064272 TIGR00064, ftsY, signal recognition particle-docki 4e-64
PRK05703424 PRK05703, flhF, flagellar biosynthesis regulator F 3e-27
COG1419407 COG1419, FlhF, Flagellar GTP-binding protein [Cell 5e-25
TIGR03499283 TIGR03499, FlhF, flagellar biosynthetic protein Fl 1e-18
PRK12726407 PRK12726, PRK12726, flagellar biosynthesis regulat 1e-13
PRK12724432 PRK12724, PRK12724, flagellar biosynthesis regulat 3e-11
PRK12723388 PRK12723, PRK12723, flagellar biosynthesis regulat 3e-11
pfam0288177 pfam02881, SRP54_N, SRP54-type protein, helical bu 1e-10
smart0096377 smart00963, SRP54_N, SRP54-type protein, helical b 3e-10
PRK06731270 PRK06731, flhF, flagellar biosynthesis regulator F 1e-09
PRK11889436 PRK11889, flhF, flagellar biosynthesis regulator F 3e-09
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-08
PRK14722374 PRK14722, flhF, flagellar biosynthesis regulator F 3e-08
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator F 2e-06
PRK12727559 PRK12727, PRK12727, flagellar biosynthesis regulat 8e-06
PRK14721420 PRK14721, flhF, flagellar biosynthesis regulator F 2e-04
COG1341398 COG1341, COG1341, Predicted GTPase or GTP-binding 2e-04
pfam13671143 pfam13671, AAA_33, AAA domain 3e-04
cd0198399 cd01983, Fer4_NifH, The Fer4_NifH superfamily cont 4e-04
COG1703323 COG1703, ArgK, Putative periplasmic protein kinase 0.001
pfam03205126 pfam03205, MobB, Molybdopterin guanine dinucleotid 0.001
>gnl|CDD|130492 TIGR01425, SRP54_euk, signal recognition particle protein SRP54 Back     alignment and domain information 
 Score =  581 bits (1499), Expect = 0.0
 Identities = 233/333 (69%), Positives = 283/333 (84%)

Query: 2   VLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVN 61
           VLA LG SI+ A++ MSNAT+IDE+VLN  L EI  ALL++DV  KLVR+++ NIKK +N
Sbjct: 1   VLADLGSSITSALRSMSNATVIDEEVLNAMLKEICTALLESDVNIKLVRQLRENIKKAIN 60

Query: 62  LDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKY 121
           L+++A+G NKR++IQ A+F ELC ++DPG  +FTPKKGK +VIMFVGLQGSGKTTTCTK 
Sbjct: 61  LEEMASGLNKRKMIQHAVFKELCNLVDPGVEAFTPKKGKQNVIMFVGLQGSGKTTTCTKL 120

Query: 122 AYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKK 181
           AYY+Q+KG+KP LVCADTFRAGAFDQLKQNATKA+IPFYGSYTESDPV+IA EGVE FKK
Sbjct: 121 AYYYQRKGFKPCLVCADTFRAGAFDQLKQNATKARIPFYGSYTESDPVKIASEGVEKFKK 180

Query: 182 ENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVS 241
           EN D+IIVDTSGRHKQE +LFEEM QV+EA  PD +IFVMD SIGQAA  QA+AFK SV 
Sbjct: 181 ENFDIIIVDTSGRHKQEDSLFEEMLQVAEAIQPDNIIFVMDGSIGQAAEAQAKAFKDSVD 240

Query: 242 VGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWS 301
           VG+VI+TK+DGHAKGGGALSAVAATKSP+IFIGTGEH+D+FE+F  +PF+S+LLGMGD  
Sbjct: 241 VGSVIITKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEIFKTQPFISKLLGMGDIE 300

Query: 302 GFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMF 334
           G +DK+ ++   D +  L++KL EG FTLR M+
Sbjct: 301 GLIDKVQDLKLDDNEKALIEKLKEGTFTLRDMY 333

This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model. Length = 429
>gnl|CDD|223615 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|179118 PRK00771, PRK00771, signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>gnl|CDD|215925 pfam00448, SRP54, SRP54-type protein, GTPase domain Back     alignment and domain information
>gnl|CDD|214940 smart00962, SRP54, SRP54-type protein, GTPase domain Back     alignment and domain information
>gnl|CDD|236780 PRK10867, PRK10867, signal recognition particle protein; Provisional Back     alignment and domain information
>gnl|CDD|233210 TIGR00959, ffh, signal recognition particle protein Back     alignment and domain information
>gnl|CDD|239389 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>gnl|CDD|237875 PRK14974, PRK14974, cell division protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|223626 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236686 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|232804 TIGR00064, ftsY, signal recognition particle-docking protein FtsY Back     alignment and domain information
>gnl|CDD|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|224337 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|234232 TIGR03499, FlhF, flagellar biosynthetic protein FlhF Back     alignment and domain information
>gnl|CDD|183704 PRK12726, PRK12726, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|183703 PRK12724, PRK12724, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|183702 PRK12723, PRK12723, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|217266 pfam02881, SRP54_N, SRP54-type protein, helical bundle domain Back     alignment and domain information
>gnl|CDD|214941 smart00963, SRP54_N, SRP54-type protein, helical bundle domain Back     alignment and domain information
>gnl|CDD|75717 PRK06731, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|183360 PRK11889, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|173185 PRK14722, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|173184 PRK14721, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|224260 COG1341, COG1341, Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|222307 pfam13671, AAA_33, AAA domain Back     alignment and domain information
>gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>gnl|CDD|224617 COG1703, ArgK, Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|217424 pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 344
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 100.0
KOG0780 483 consensus Signal recognition particle, subunit Srp 100.0
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 100.0
PRK10867433 signal recognition particle protein; Provisional 100.0
TIGR00959428 ffh signal recognition particle protein. This mode 100.0
PRK00771 437 signal recognition particle protein Srp54; Provisi 100.0
COG0552340 FtsY Signal recognition particle GTPase [Intracell 100.0
PRK14974336 cell division protein FtsY; Provisional 100.0
PRK10416318 signal recognition particle-docking protein FtsY; 100.0
TIGR00064272 ftsY signal recognition particle-docking protein F 100.0
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 100.0
KOG0781587 consensus Signal recognition particle receptor, al 100.0
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 100.0
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 100.0
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 100.0
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 100.0
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 100.0
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 100.0
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 100.0
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 99.97
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 99.97
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 99.97
cd03115173 SRP The signal recognition particle (SRP) mediates 99.93
COG0486454 ThdF Predicted GTPase [General function prediction 99.89
COG1159298 Era GTPase [General function prediction only] 99.86
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 99.82
COG1160 444 Predicted GTPases [General function prediction onl 99.79
PRK09435332 membrane ATPase/protein kinase; Provisional 99.77
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 99.76
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 99.75
COG1160444 Predicted GTPases [General function prediction onl 99.72
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.71
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.71
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 99.71
PRK00089292 era GTPase Era; Reviewed 99.7
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 99.68
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.66
PRK15494339 era GTPase Era; Provisional 99.62
PRK13768253 GTPase; Provisional 99.62
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.61
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.6
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.58
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.58
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 99.58
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 99.56
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 99.55
cd03114148 ArgK-like The function of this protein family is u 99.55
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.52
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.52
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.49
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 99.49
PRK03003 472 GTP-binding protein Der; Reviewed 99.49
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 99.49
PRK03003472 GTP-binding protein Der; Reviewed 99.49
PRK11058426 GTPase HflX; Provisional 99.48
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.48
cd02117212 NifH_like This family contains the NifH (iron prot 99.48
PHA02518211 ParA-like protein; Provisional 99.47
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.47
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.46
PRK00093 435 GTP-binding protein Der; Reviewed 99.45
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.45
PRK00093435 GTP-binding protein Der; Reviewed 99.44
PRK13849231 putative crown gall tumor protein VirC1; Provision 99.44
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.43
PRK12298390 obgE GTPase CgtA; Reviewed 99.42
TIGR00101199 ureG urease accessory protein UreG. This model rep 99.42
PRK09866 741 hypothetical protein; Provisional 99.41
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.41
cd03110179 Fer4_NifH_child This protein family's function is 99.41
cd00881189 GTP_translation_factor GTP translation factor fami 99.4
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.4
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.39
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.39
cd02040270 NifH NifH gene encodes component II (iron protein) 99.38
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.37
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 99.37
PRK13235274 nifH nitrogenase reductase; Reviewed 99.37
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.36
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 99.36
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 99.36
CHL00072290 chlL photochlorophyllide reductase subunit L 99.35
cd02032267 Bchl_like This family of proteins contains bchL an 99.35
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.35
CHL00175281 minD septum-site determining protein; Validated 99.35
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.35
PRK13232273 nifH nitrogenase reductase; Reviewed 99.34
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.34
PRK11670369 antiporter inner membrane protein; Provisional 99.34
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.34
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 99.34
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 99.33
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.33
COG1084346 Predicted GTPase [General function prediction only 99.33
PRK13230279 nitrogenase reductase-like protein; Reviewed 99.33
COG0218200 Predicted GTPase [General function prediction only 99.32
cd02036179 MinD Bacterial cell division requires the formatio 99.32
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 99.32
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 99.31
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.31
PRK12299335 obgE GTPase CgtA; Reviewed 99.31
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.3
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 99.3
cd02033329 BchX Chlorophyllide reductase converts chlorophyll 99.29
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.29
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.29
COG2262411 HflX GTPases [General function prediction only] 99.29
TIGR01287275 nifH nitrogenase iron protein. This model describe 99.29
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.28
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.28
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 99.27
PRK04213201 GTP-binding protein; Provisional 99.27
TIGR03029274 EpsG chain length determinant protein tyrosine kin 99.27
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 99.26
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.26
PRK12296 500 obgE GTPase CgtA; Reviewed 99.26
PRK13233275 nifH nitrogenase reductase; Reviewed 99.26
PRK13234295 nifH nitrogenase reductase; Reviewed 99.25
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 99.25
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.25
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.24
PRK12297424 obgE GTPase CgtA; Reviewed 99.24
PRK10037250 cell division protein; Provisional 99.24
PRK13869405 plasmid-partitioning protein RepA; Provisional 99.23
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.23
TIGR01968261 minD_bact septum site-determining protein MinD. Th 99.23
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.22
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.22
PRK10818270 cell division inhibitor MinD; Provisional 99.22
COG2894272 MinD Septum formation inhibitor-activating ATPase 99.22
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.21
COG0489265 Mrp ATPases involved in chromosome partitioning [C 99.21
PRK13236296 nitrogenase reductase; Reviewed 99.2
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 99.2
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.2
cd03111106 CpaE_like This protein family consists of proteins 99.2
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.2
PRK11519719 tyrosine kinase; Provisional 99.2
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 99.19
TIGR03453387 partition_RepA plasmid partitioning protein RepA. 99.19
PHA02519387 plasmid partition protein SopA; Reviewed 99.19
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.19
PRK13231264 nitrogenase reductase-like protein; Reviewed 99.19
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.19
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.18
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.18
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 99.17
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 99.17
cd03112158 CobW_like The function of this protein family is u 99.17
PRK13705388 plasmid-partitioning protein SopA; Provisional 99.16
PF09140261 MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi 99.16
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.15
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 99.15
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.15
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 99.14
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.13
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.12
cd01896233 DRG The developmentally regulated GTP-binding prot 99.11
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.11
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 99.11
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.11
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.1
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.1
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.1
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.1
COG1192259 Soj ATPases involved in chromosome partitioning [C 99.1
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.09
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.08
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.08
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.08
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.08
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.08
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.08
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.07
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.07
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.06
COG1163365 DRG Predicted GTPase [General function prediction 99.06
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.06
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.05
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.05
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.05
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.05
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.05
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.04
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.03
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.02
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.02
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.02
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.02
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.02
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.02
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.01
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 99.01
PRK04004 586 translation initiation factor IF-2; Validated 99.01
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.01
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.01
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.0
PRK12736 394 elongation factor Tu; Reviewed 99.0
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.0
PTZ00133182 ADP-ribosylation factor; Provisional 99.0
PRK12735 396 elongation factor Tu; Reviewed 99.0
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.99
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.99
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 98.98
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.98
CHL00071 409 tufA elongation factor Tu 98.98
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.98
PRK05306 787 infB translation initiation factor IF-2; Validated 98.98
PRK00049 396 elongation factor Tu; Reviewed 98.98
PRK11537318 putative GTP-binding protein YjiA; Provisional 98.98
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 98.98
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.98
PLN03118211 Rab family protein; Provisional 98.98
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.97
CHL00189 742 infB translation initiation factor 2; Provisional 98.97
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.97
PRK12317 425 elongation factor 1-alpha; Reviewed 98.96
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 98.96
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.96
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.96
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.96
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.95
PLN00223181 ADP-ribosylation factor; Provisional 98.95
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.95
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.95
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.94
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.93
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 98.93
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.93
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.92
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.92
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.92
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.92
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.91
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.91
cd02034116 CooC The accessory protein CooC, which contains a 98.91
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.91
KOG1489366 consensus Predicted GTP-binding protein (ODN super 98.91
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.9
TIGR00485 394 EF-Tu translation elongation factor TU. This align 98.9
COG0003322 ArsA Predicted ATPase involved in chromosome parti 98.9
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.9
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 98.89
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.89
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 98.88
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.88
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.87
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 98.87
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 98.87
PLN03127 447 Elongation factor Tu; Provisional 98.87
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.87
COG0523323 Putative GTPases (G3E family) [General function pr 98.86
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.86
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.86
PRK05433 600 GTP-binding protein LepA; Provisional 98.86
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.85
COG1341398 Predicted GTPase or GTP-binding protein [General f 98.85
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.85
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.85
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.84
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.84
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 98.84
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 98.84
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 98.84
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 98.84
PTZ00369189 Ras-like protein; Provisional 98.83
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.82
KOG3022300 consensus Predicted ATPase, nucleotide-binding [Ce 98.82
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.82
COG0536369 Obg Predicted GTPase [General function prediction 98.81
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.81
KOG0410410 consensus Predicted GTP binding protein [General f 98.81
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 98.8
COG1149284 MinD superfamily P-loop ATPase containing an inser 98.79
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.79
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.78
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 98.78
PRK10218 607 GTP-binding protein; Provisional 98.77
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 98.77
PRK04000 411 translation initiation factor IF-2 subunit gamma; 98.77
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.76
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 98.76
PRK00741 526 prfC peptide chain release factor 3; Provisional 98.76
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 98.76
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 98.76
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.75
KOG1533290 consensus Predicted GTPase [General function predi 98.75
PF00142273 Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot 98.75
PRK00007 693 elongation factor G; Reviewed 98.74
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 98.74
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 98.74
PF00025175 Arf: ADP-ribosylation factor family The prints ent 98.74
PTZ00141 446 elongation factor 1- alpha; Provisional 98.74
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 98.73
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 98.73
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.72
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.72
COG1348278 NifH Nitrogenase subunit NifH (ATPase) [Inorganic 98.72
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.71
PLN03071219 GTP-binding nuclear protein Ran; Provisional 98.71
PRK12739 691 elongation factor G; Reviewed 98.71
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 98.71
PF13614157 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ 98.71
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.7
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 98.7
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.7
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 98.7
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.68
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 98.68
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 98.67
PLN03110216 Rab GTPase; Provisional 98.67
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 98.66
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.66
PLN03108210 Rab family protein; Provisional 98.66
PLN03126 478 Elongation factor Tu; Provisional 98.66
KOG1145 683 consensus Mitochondrial translation initiation fac 98.65
cd04105203 SR_beta Signal recognition particle receptor, beta 98.65
KOG2743391 consensus Cobalamin synthesis protein [Coenzyme tr 98.65
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 98.65
TIGR00503 527 prfC peptide chain release factor 3. This translat 98.65
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.64
COG3596296 Predicted GTPase [General function prediction only 98.64
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 98.64
PRK12740 668 elongation factor G; Reviewed 98.63
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 98.63
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.62
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.62
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 98.57
PF09439181 SRPRB: Signal recognition particle receptor beta s 98.57
KOG0462 650 consensus Elongation factor-type GTP-binding prote 98.56
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 98.55
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.54
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.54
TIGR00347166 bioD dethiobiotin synthase. Dethiobiotin synthase 98.54
PTZ00258 390 GTP-binding protein; Provisional 98.53
PLN00043 447 elongation factor 1-alpha; Provisional 98.51
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 98.5
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 98.5
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 98.48
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.47
KOG1534273 consensus Putative transcription factor FET5 [Tran 98.47
COG1217 603 TypA Predicted membrane GTPase involved in stress 98.45
PRK09601 364 GTP-binding protein YchF; Reviewed 98.45
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.44
smart00382148 AAA ATPases associated with a variety of cellular 98.43
PTZ00416 836 elongation factor 2; Provisional 98.42
PRK13351 687 elongation factor G; Reviewed 98.42
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 98.42
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 98.41
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.4
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 98.38
PRK06278476 cobyrinic acid a,c-diamide synthase; Validated 98.36
PRK07560 731 elongation factor EF-2; Reviewed 98.34
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 98.34
PRK13886241 conjugal transfer protein TraL; Provisional 98.34
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 98.34
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.34
PRK00090222 bioD dithiobiotin synthetase; Reviewed 98.33
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.32
PRK12337475 2-phosphoglycerate kinase; Provisional 98.31
COG1100219 GTPase SAR1 and related small G proteins [General 98.31
PLN00116 843 translation elongation factor EF-2 subunit; Provis 98.31
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.3
COG2229187 Predicted GTPase [General function prediction only 98.3
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.29
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.28
PRK04220301 2-phosphoglycerate kinase; Provisional 98.28
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 98.26
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 98.26
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.26
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 98.26
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 98.23
PRK09563287 rbgA GTPase YlqF; Reviewed 98.22
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.22
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 98.22
PRK04296190 thymidine kinase; Provisional 98.21
KOG2825323 consensus Putative arsenite-translocating ATPase [ 98.21
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 98.2
COG1161322 Predicted GTPases [General function prediction onl 98.18
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.18
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.18
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 98.18
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.17
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.16
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 98.16
PF13500199 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R 98.13
COG0050 394 TufB GTPases - translation elongation factors [Tra 98.12
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 98.12
PRK12289352 GTPase RsgA; Reviewed 98.12
TIGR02237209 recomb_radB DNA repair and recombination protein R 98.11
PRK06526254 transposase; Provisional 98.07
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.06
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penulti 98.06
PRK12288347 GTPase RsgA; Reviewed 98.05
PRK09361225 radB DNA repair and recombination protein RadB; Pr 98.04
PRK09602 396 translation-associated GTPase; Reviewed 98.04
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 98.03
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.0
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.0
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 98.0
PLN00023334 GTP-binding protein; Provisional 97.99
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 97.99
PRK00889175 adenylylsulfate kinase; Provisional 97.99
cd01394218 radB RadB. The archaeal protein radB shares simila 97.99
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 97.98
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 97.97
COG5019 373 CDC3 Septin family protein [Cell division and chro 97.97
PF1324576 AAA_19: Part of AAA domain 97.97
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.96
PRK07667193 uridine kinase; Provisional 97.96
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 97.95
PRK06067234 flagellar accessory protein FlaH; Validated 97.95
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.93
PRK06696223 uridine kinase; Validated 97.93
PRK05541176 adenylylsulfate kinase; Provisional 97.93
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.92
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 97.92
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.92
TIGR00379 449 cobB cobyrinic acid a,c-diamide synthase. This mod 97.92
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.91
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.91
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.91
PHA00729226 NTP-binding motif containing protein 97.91
COG1162301 Predicted GTPases [General function prediction onl 97.9
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.9
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 97.9
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 97.9
PRK14845 1049 translation initiation factor IF-2; Provisional 97.89
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.89
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.88
PRK15453290 phosphoribulokinase; Provisional 97.88
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.87
PRK05480209 uridine/cytidine kinase; Provisional 97.86
PRK05973237 replicative DNA helicase; Provisional 97.86
PRK08233182 hypothetical protein; Provisional 97.85
TIGR00313 475 cobQ cobyric acid synthase CobQ. 97.85
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 97.85
PF0288175 SRP54_N: SRP54-type protein, helical bundle domain 97.85
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.84
cd03116159 MobB Molybdenum is an essential trace element in t 97.84
PRK05439311 pantothenate kinase; Provisional 97.84
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 97.84
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 97.84
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.83
PRK06762166 hypothetical protein; Provisional 97.82
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.82
PRK07952244 DNA replication protein DnaC; Validated 97.81
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.81
PRK13796365 GTPase YqeH; Provisional 97.8
PRK05632 684 phosphate acetyltransferase; Reviewed 97.8
KOG0461 522 consensus Selenocysteine-specific elongation facto 97.8
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 97.8
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.79
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 97.79
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.79
PRK12374231 putative dithiobiotin synthetase; Provisional 97.78
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 97.77
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 97.77
PRK00098298 GTPase RsgA; Reviewed 97.77
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 97.77
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.76
PRK04040188 adenylate kinase; Provisional 97.76
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 97.75
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.75
PRK06893229 DNA replication initiation factor; Validated 97.75
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.74
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.74
PRK06835329 DNA replication protein DnaC; Validated 97.71
PF00004132 AAA: ATPase family associated with various cellula 97.71
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.71
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 97.71
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.71
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 97.7
PHA02542473 41 41 helicase; Provisional 97.7
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.7
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.69
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.69
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intr 97.69
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.69
PLN02796347 D-glycerate 3-kinase 97.69
COG0012 372 Predicted GTPase, probable translation factor [Tra 97.68
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 97.67
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 97.67
KOG0079198 consensus GTP-binding protein H-ray, small G prote 97.66
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.65
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.65
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 97.64
COG2403449 Predicted GTPase [General function prediction only 97.64
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.64
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.63
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 97.63
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.62
PRK00784 488 cobyric acid synthase; Provisional 97.62
KOG2655 366 consensus Septin family protein (P-loop GTPase) [C 97.61
PTZ00301210 uridine kinase; Provisional 97.6
PRK03846198 adenylylsulfate kinase; Provisional 97.6
PHA02530300 pseT polynucleotide kinase; Provisional 97.6
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 97.6
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information 
Probab=100.00  E-value=3e-59  Score=433.19  Aligned_cols=340  Identities=41%  Similarity=0.653  Sum_probs=327.1

Q ss_pred             chHhHHHHHHHHHHHhhcccccChhhhHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHhhcccccccCCChHHHHHHHHHH
Q 019214            2 VLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFN   81 (344)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~   81 (344)
                      .|+.|..+|++.++++++++.++|+.+++.+++++.+|+++||+..++.+|..++.+....+.++++.+|.+++...|.+
T Consensus         1 m~e~L~~~l~~~l~kl~g~~~i~E~~i~e~~reir~ALLeADVnl~vVk~fi~~ikera~g~ev~~~l~p~q~~iKiV~e   80 (451)
T COG0541           1 MFESLSDRLSNALKKLRGKGRITEKDVKEALREIRRALLEADVNLKVVKDFIKRIKERALGEEVPKGLTPGQQFIKIVYE   80 (451)
T ss_pred             ChHHHHHHHHHHHHHhhCCCcCCHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHhccccCCCCCCHHHHHHHHHHH
Confidence            37899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCCCCCCCCCCCCeEEEEEcCCCCCHHHHHHHHHHHHHHcCCccEEeecCcCcchhHHHHHhhcccCCcceec
Q 019214           82 ELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYG  161 (344)
Q Consensus        82 ~l~~~l~~~~~~~~~~~~~~~ii~ivG~~GvGKTTl~~~La~~l~~~g~~v~iv~~D~~~~~~~~~l~~~~~~~~v~~~~  161 (344)
                      +|..++.....+......+|.+|.++|--|+||||++.+||.+|.++|++|++|++|+||++|++||+..+...++|+|.
T Consensus        81 ELv~llG~~~~~~~l~~~~P~vImmvGLQGsGKTTt~~KLA~~lkk~~~kvllVaaD~~RpAA~eQL~~La~q~~v~~f~  160 (451)
T COG0541          81 ELVKLLGGENSELNLAKKPPTVILMVGLQGSGKTTTAGKLAKYLKKKGKKVLLVAADTYRPAAIEQLKQLAEQVGVPFFG  160 (451)
T ss_pred             HHHHHhCCCCcccccCCCCCeEEEEEeccCCChHhHHHHHHHHHHHcCCceEEEecccCChHHHHHHHHHHHHcCCceec
Confidence            99999997555555556678999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCHHHHHHHHHHHHHhCCCCEEEEcCCCCCcchHHHHHHHHHhhhhcCCcEEEEEEcCCcchhHHHHHHHHhccCC
Q 019214          162 SYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVS  241 (344)
Q Consensus       162 ~~~~~~~~~~~~~~l~~~~~~~~d~vlIDT~G~~~~~~~~~~~l~~~~~~~~~d~illvvda~~~~~~~~~~~~~~~~~~  241 (344)
                      .....+|++++..++++++...+|++||||+|+++.+..++.+++.+.....||.+++|+|+..|+++...+..|++.++
T Consensus       161 ~~~~~~Pv~Iak~al~~ak~~~~DvvIvDTAGRl~ide~Lm~El~~Ik~~~~P~E~llVvDam~GQdA~~~A~aF~e~l~  240 (451)
T COG0541         161 SGTEKDPVEIAKAALEKAKEEGYDVVIVDTAGRLHIDEELMDELKEIKEVINPDETLLVVDAMIGQDAVNTAKAFNEALG  240 (451)
T ss_pred             CCCCCCHHHHHHHHHHHHHHcCCCEEEEeCCCcccccHHHHHHHHHHHhhcCCCeEEEEEecccchHHHHHHHHHhhhcC
Confidence            87788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCEEEeecCCCCCChhhHHHHHHHhCCCeEEEecCCCCCcCcCCChHHHHHHHhCCCChhHHHHHHHhhCCCCchHHHHH
Q 019214          242 VGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQ  321 (344)
Q Consensus       242 ~~~lVinK~D~~~~~~~~~~~~~~~~~pv~~~~~g~~~~~l~~~~~~~~is~~~g~g~i~~l~~~i~~~~~~~~~~~~~~  321 (344)
                      +.++|+||+|...++|..++..+.++.||.|+++|+.++++.+|+|..++|+++|.||+.+|+|++++.++.+..++..+
T Consensus       241 itGvIlTKlDGdaRGGaALS~~~~tg~PIkFiGtGEki~dLE~F~P~R~asRILGMGDv~sLvEk~~~~~d~e~a~~~~~  320 (451)
T COG0541         241 ITGVILTKLDGDARGGAALSARAITGKPIKFIGTGEKIDDLEPFHPDRFASRILGMGDVLSLIEKAEEVVDEEEAEKLAE  320 (451)
T ss_pred             CceEEEEcccCCCcchHHHhhHHHHCCCeEEEecCCCcccCCCcChHHHHHHhcCcccHHHHHHHHHHhhhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988999999


Q ss_pred             HHhcCCcChHHHHHhHHhhcc
Q 019214          322 KLSEGNFTLRIMFSLCFQDSV  342 (344)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~~  342 (344)
                      ++.+|+|||+||++| ++++-
T Consensus       321 kl~~g~FtL~Df~~Q-l~~m~  340 (451)
T COG0541         321 KLKKGKFTLEDFLEQ-LEQMK  340 (451)
T ss_pred             HHHhCCCCHHHHHHH-HHHHH
Confidence            999999999999999 88763

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00347 bioD dethiobiotin synthase Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PF02881 SRP54_N: SRP54-type protein, helical bundle domain; InterPro: IPR013822 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG2403 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
2j37_W 504 Model Of Mammalian Srp Bound To 80s Rncs Length = 5 1e-125
2v3c_C432 Crystal Structure Of The Srp54-Srp19-7s.S Srp Rna C 3e-77
3ndb_B 454 Crystal Structure Of A Signal Sequence Bound To The 3e-77
3dm5_A443 Structures Of Srp54 And Srp19, The Two Proteins Ass 2e-75
1qzw_A440 Crystal Structure Of The Complete Core Of Archaeal 3e-63
3kl4_A433 Recognition Of A Signal Peptide By The Signal Recog 3e-63
1j8m_F297 Signal Recognition Particle Conserved Gtpase Domain 2e-54
1j8y_F297 Signal Recognition Particle Conserved Gtpase Domain 8e-54
3dmd_B328 Structures And Conformations In Solution Of The Sig 2e-42
3dm9_B328 Structures And Conformations In Solution Of The Sig 1e-40
2iy3_A432 Structure Of The E. Coli Signal Recognition Particl 5e-40
2ffh_A425 The Signal Sequence Binding Protein Ffh From Thermu 3e-39
2j28_9430 Model Of E. Coli Srp Bound To 70s Rncs Length = 430 2e-38
2xxa_A433 The Crystal Structure Of The Signal Recognition Par 2e-38
1jpj_A296 Gmppnp Complex Of Srp Gtpase Ng Domain Length = 296 7e-38
2c03_A297 Gdp Complex Of Srp Gtpase Ffh Ng Domain Length = 29 8e-38
1o87_A297 A New Mggdp Complex Of The Ffh Ng Domain Length = 2 8e-38
1rj9_B300 Structure Of The Heterodimer Of The Conserved Gtpas 9e-38
1ls1_A295 T. Aquaticus Ffh Ng Domain At 1.1a Resolution Lengt 4e-37
1ffh_A294 N And Gtpase Domains Of The Signal Sequence Recogni 4e-37
2ng1_A293 N And Gtpase Domains Of The Signal Sequence Recogni 2e-36
3ng1_A294 N And Gtpase Domains Of The Signal Sequence Recogni 2e-36
3b9q_A302 The Crystal Structure Of Cpftsy From Arabidopsis Th 3e-27
2og2_A359 Crystal Structure Of Chloroplast Ftsy From Arabidop 4e-27
4ak9_A318 Structure Of Chloroplast Ftsy From Physcomitrella P 5e-27
1zu4_A320 Crystal Structure Of Ftsy From Mycoplasma Mycoides- 6e-27
2q9a_A304 Structure Of Apo Ftsy Length = 304 3e-26
2j7p_D283 Gmppnp-Stabilized Ng Domain Complex Of The Srp Gtpa 3e-26
1okk_D303 Homo-Heterodimeric Complex Of The Srp Gtpases Lengt 3e-26
2cnw_D284 Gdpalf4 Complex Of The Srp Gtpases Ffh And Ftsy Len 4e-26
2qy9_A309 Structure Of The Ng+1 Construct Of The E. Coli Srp 4e-26
2xxa_B302 The Crystal Structure Of The Signal Recognition Par 4e-26
1fts_A295 Signal Recognition Particle Receptor From E. Coli L 5e-26
2yhs_A503 Structure Of The E. Coli Srp Receptor Ftsy Length = 2e-25
1rj9_A304 Structure Of The Heterodimer Of The Conserved Gtpas 3e-25
1vma_A306 Crystal Structure Of Cell Division Protein Ftsy (Tm 1e-21
1wgw_A99 Solution Structure Of The N-Terminal Domain Of Mous 5e-18
2px0_A296 Crystal Structure Of Flhf Complexed With GmppnpMG(2 8e-10
>pdb|2J37|W Chain W, Model Of Mammalian Srp Bound To 80s Rncs Length = 504 Back     alignment and structure 
Iteration: 1

 Score =  443 bits (1140), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 209/334 (62%), Positives = 265/334 (79%), Gaps = 1/334 (0%)
Query: 1   MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV 60
           MVLA LG  I+ A++ +SNATII+E+VLN  L E+  ALL+ADV  KLV++++ N+K  +
Sbjct: 1   MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI 60
Query: 61  NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTK 120
           +L+++A+G NKR++IQ A+F EL K++DPG  ++TP KGK +VIMFVGLQGSGKTTTC+K
Sbjct: 61  DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSK 120
Query: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFK 180
            AYY+Q+KGWK  L+CADTFRAGAFDQLKQNATKA+IPFYGSYTE DPV IA EGVE FK
Sbjct: 121 LAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFK 180
Query: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGXXXXXXXXXXXXSV 240
            EN ++IIVDTSGRHKQE +LFEEM QV+ A  PD +++VMD+SIG             V
Sbjct: 181 NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKV 240
Query: 241 SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300
            V +VIVTK+DGHAKGGGALSAVAATKSP+IFIGTGEH+D+FE F  +PF+S+LLGMGD 
Sbjct: 241 DVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDI 300
Query: 301 SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMF 334
            G +DK++E + +D    L++KL  G FTLR M+
Sbjct: 301 EGLIDKVNE-LKLDDNEALIEKLKHGQFTLRDMY 333
>pdb|2V3C|C Chain C, Crystal Structure Of The Srp54-Srp19-7s.S Srp Rna Complex Of M. Jannaschii Length = 432 Back     alignment and structure
>pdb|3NDB|B Chain B, Crystal Structure Of A Signal Sequence Bound To The Signal Recognition Particle Length = 454 Back     alignment and structure
>pdb|3DM5|A Chain A, Structures Of Srp54 And Srp19, The Two Proteins Assembling The Ribonucleic Core Of The Signal Recognition Particle From The Archaeon Pyrococcus Furiosus. Length = 443 Back     alignment and structure
>pdb|1QZW|A Chain A, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication Length = 440 Back     alignment and structure
>pdb|3KL4|A Chain A, Recognition Of A Signal Peptide By The Signal Recognition Particle Length = 433 Back     alignment and structure
>pdb|1J8M|F Chain F, Signal Recognition Particle Conserved Gtpase Domain From A. Ambivalens Length = 297 Back     alignment and structure
>pdb|1J8Y|F Chain F, Signal Recognition Particle Conserved Gtpase Domain From A. Ambivalens T112a Mutant Length = 297 Back     alignment and structure
>pdb|3DMD|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328 Back     alignment and structure
>pdb|3DM9|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328 Back     alignment and structure
>pdb|2IY3|A Chain A, Structure Of The E. Coli Signal Recognition Particle Bound To A Translating Ribosome Length = 432 Back     alignment and structure
>pdb|2FFH|A Chain A, The Signal Sequence Binding Protein Ffh From Thermus Aquaticus Length = 425 Back     alignment and structure
>pdb|2J28|9 Chain 9, Model Of E. Coli Srp Bound To 70s Rncs Length = 430 Back     alignment and structure
>pdb|2XXA|A Chain A, The Crystal Structure Of The Signal Recognition Particle (Srp) In Complex With Its Receptor(Sr) Length = 433 Back     alignment and structure
>pdb|1JPJ|A Chain A, Gmppnp Complex Of Srp Gtpase Ng Domain Length = 296 Back     alignment and structure
>pdb|2C03|A Chain A, Gdp Complex Of Srp Gtpase Ffh Ng Domain Length = 297 Back     alignment and structure
>pdb|1O87|A Chain A, A New Mggdp Complex Of The Ffh Ng Domain Length = 297 Back     alignment and structure
>pdb|1RJ9|B Chain B, Structure Of The Heterodimer Of The Conserved Gtpase Domains Signal Recognition Particle (Ffh) And Its Receptor (Ftsy) Length = 300 Back     alignment and structure
>pdb|1LS1|A Chain A, T. Aquaticus Ffh Ng Domain At 1.1a Resolution Length = 295 Back     alignment and structure
>pdb|1FFH|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 294 Back     alignment and structure
>pdb|2NG1|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 293 Back     alignment and structure
>pdb|3NG1|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 294 Back     alignment and structure
>pdb|3B9Q|A Chain A, The Crystal Structure Of Cpftsy From Arabidopsis Thaliana Length = 302 Back     alignment and structure
>pdb|2OG2|A Chain A, Crystal Structure Of Chloroplast Ftsy From Arabidopsis Thaliana Length = 359 Back     alignment and structure
>pdb|4AK9|A Chain A, Structure Of Chloroplast Ftsy From Physcomitrella Patens Length = 318 Back     alignment and structure
>pdb|1ZU4|A Chain A, Crystal Structure Of Ftsy From Mycoplasma Mycoides- Space Group P21212 Length = 320 Back     alignment and structure
>pdb|2Q9A|A Chain A, Structure Of Apo Ftsy Length = 304 Back     alignment and structure
>pdb|2J7P|D Chain D, Gmppnp-Stabilized Ng Domain Complex Of The Srp Gtpases Ffh And Ftsy Length = 283 Back     alignment and structure
>pdb|1OKK|D Chain D, Homo-Heterodimeric Complex Of The Srp Gtpases Length = 303 Back     alignment and structure
>pdb|2CNW|D Chain D, Gdpalf4 Complex Of The Srp Gtpases Ffh And Ftsy Length = 284 Back     alignment and structure
>pdb|2QY9|A Chain A, Structure Of The Ng+1 Construct Of The E. Coli Srp Receptor Ftsy Length = 309 Back     alignment and structure
>pdb|2XXA|B Chain B, The Crystal Structure Of The Signal Recognition Particle (Srp) In Complex With Its Receptor(Sr) Length = 302 Back     alignment and structure
>pdb|1FTS|A Chain A, Signal Recognition Particle Receptor From E. Coli Length = 295 Back     alignment and structure
>pdb|2YHS|A Chain A, Structure Of The E. Coli Srp Receptor Ftsy Length = 503 Back     alignment and structure
>pdb|1RJ9|A Chain A, Structure Of The Heterodimer Of The Conserved Gtpase Domains Signal Recognition Particle (Ffh) And Its Receptor (Ftsy) Length = 304 Back     alignment and structure
>pdb|1VMA|A Chain A, Crystal Structure Of Cell Division Protein Ftsy (Tm0570) From Thermotoga Maritima At 1.60 A Resolution Length = 306 Back     alignment and structure
>pdb|1WGW|A Chain A, Solution Structure Of The N-Terminal Domain Of Mouse Putative Signal Recoginition Particle 54 (Srp54) Length = 99 Back     alignment and structure
>pdb|2PX0|A Chain A, Crystal Structure Of Flhf Complexed With GmppnpMG(2+) Length = 296 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 1e-175
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 1e-131
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 1e-129
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 1e-125
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 1e-115
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 1e-77
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 4e-77
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 4e-77
2xxa_A433 Signal recognition particle protein; protein trans 6e-77
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 2e-73
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 4e-57
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 1e-56
2og2_A359 Putative signal recognition particle receptor; nuc 9e-56
1vma_A306 Cell division protein FTSY; TM0570, structural gen 3e-55
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 3e-55
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 3e-53
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 3e-06
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 7e-05
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 1e-04
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 1e-04
3ox4_A 383 Alcohol dehydrogenase 2; iron, NAD, oxidoreductase 8e-04
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 8e-04
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 Back     alignment and structure
 Score =  495 bits (1277), Expect = e-175
 Identities = 216/333 (64%), Positives = 272/333 (81%), Gaps = 1/333 (0%)

Query: 1   MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV 60
           MVLA LG  I+ A++ +SNATII+E+VLN  L E+  ALL+ADV  KLV++++ N+K  +
Sbjct: 1   MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI 60

Query: 61  NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTK 120
           +L+++A+G NKR++IQ A+F EL K++DPG  ++TP KGK +VIMFVGLQGSGKTTTC+K
Sbjct: 61  DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSK 120

Query: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFK 180
            AYY+Q+KGWK  L+CADTFRAGAFDQLKQNATKA+IPFYGSYTE DPV IA EGVE FK
Sbjct: 121 LAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFK 180

Query: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSV 240
            EN ++IIVDTSGRHKQE +LFEEM QV+ A  PD +++VMD+SIGQA   QA+AFK  V
Sbjct: 181 NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKV 240

Query: 241 SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300
            V +VIVTK+DGHAKGGGALSAVAATKSP+IFIGTGEH+D+FE F  +PF+S+LLGMGD 
Sbjct: 241 DVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDI 300

Query: 301 SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIM 333
            G +DK++E + +D    L++KL  G FTLR M
Sbjct: 301 EGLIDKVNE-LKLDDNEALIEKLKHGQFTLRDM 332
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Length = 432 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Length = 297 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Length = 443 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Length = 433 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Length = 295 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Length = 425 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Length = 296 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Length = 433 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Length = 328 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Length = 302 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Length = 320 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Length = 359 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Length = 306 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Length = 304 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206 Back     alignment and structure
>3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* Length = 383 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 100.0
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 100.0
2xxa_A433 Signal recognition particle protein; protein trans 100.0
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 100.0
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 100.0
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 100.0
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 100.0
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 100.0
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 100.0
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 100.0
1vma_A306 Cell division protein FTSY; TM0570, structural gen 100.0
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 100.0
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 100.0
2og2_A359 Putative signal recognition particle receptor; nuc 100.0
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 100.0
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 99.97
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.73
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.65
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.62
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.62
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.61
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.6
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.6
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.58
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.53
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.51
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.5
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.49
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.49
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.49
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 99.48
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.46
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.46
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.45
3end_A307 Light-independent protochlorophyllide reductase ir 99.45
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.44
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.44
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 99.44
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 99.43
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.43
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.43
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.43
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.41
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 99.41
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.41
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 99.41
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.4
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 99.4
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 99.39
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 99.39
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.39
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 99.38
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 99.38
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 99.37
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 99.37
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 99.37
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.36
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.35
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.35
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.34
3cwq_A209 Para family chromosome partitioning protein; alpha 99.34
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.34
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 99.32
3fwy_A314 Light-independent protochlorophyllide reductase I 99.32
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.32
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.3
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 99.3
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.28
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.28
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.28
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.28
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.27
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 99.24
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.23
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.23
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.22
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.22
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.21
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.21
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 99.21
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.21
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.2
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 99.19
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.19
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.18
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.18
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.18
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.17
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.17
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.17
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.16
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.16
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.16
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 99.16
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.16
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.16
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.16
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.16
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 99.15
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.15
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.15
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.15
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.14
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.14
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.14
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.13
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.13
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.13
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.13
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.13
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.13
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 99.13
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 99.13
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 99.13
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.13
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.13
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.13
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.12
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.12
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 99.12
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.12
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.11
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.11
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.11
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.11
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.11
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.11
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.11
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.1
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.1
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.1
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 99.1
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.1
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.09
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.09
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.09
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.09
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.09
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.09
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.09
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.08
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.08
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.08
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.08
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.08
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.07
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.07
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.06
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.06
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.06
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.06
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.05
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.05
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 99.05
2ged_A193 SR-beta, signal recognition particle receptor beta 99.05
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.05
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.05
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.04
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.04
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.04
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.04
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.04
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.03
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.03
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.03
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.03
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.03
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.03
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.02
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.59
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.02
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.02
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.02
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.01
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.01
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.01
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.01
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.01
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.01
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 99.01
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.0
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.0
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.0
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.0
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.0
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.0
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 99.0
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.99
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.99
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.98
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.98
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.97
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.97
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.97
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.96
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.96
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.96
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.96
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 98.95
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 98.95
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.95
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.95
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.94
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 98.94
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 98.93
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.92
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.92
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.91
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.91
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.9
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.88
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.88
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.87
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 98.85
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.85
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 98.84
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.84
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.83
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.82
3igf_A 374 ALL4481 protein; two-domained protein consisting o 98.82
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.81
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.8
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.79
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.78
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.77
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 98.77
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.77
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.76
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 98.76
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.76
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.74
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.74
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 98.72
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.66
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.65
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.64
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 98.63
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 98.62
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 98.61
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 98.6
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 98.58
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.56
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 98.46
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.45
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.42
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.41
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.4
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 98.37
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.35
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 98.35
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 98.33
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.32
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.28
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.26
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.25
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.25
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.23
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.22
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.22
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 98.21
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.16
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.16
1xjc_A169 MOBB protein homolog; structural genomics, midwest 98.12
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.08
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.07
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.06
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.01
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 97.97
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.95
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.94
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.93
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.93
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.92
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.92
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.9
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.87
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.87
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.86
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.85
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.84
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.82
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.82
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 97.81
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.81
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.78
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.77
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.76
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.71
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.7
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.68
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.67
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.67
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 97.64
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.64
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.62
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.61
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.61
3bos_A242 Putative DNA replication factor; P-loop containing 97.6
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 97.58
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 97.57
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 97.57
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.57
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.56
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.56
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.56
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.54
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.52
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.5
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.47
2qgz_A308 Helicase loader, putative primosome component; str 97.46
2ewv_A372 Twitching motility protein PILT; pilus retraction 97.46
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.45
2z43_A324 DNA repair and recombination protein RADA; archaea 97.45
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 97.44
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.44
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.43
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 97.43
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.43
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 97.43
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 97.42
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.42
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.41
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.41
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.4
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.38
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.38
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 97.37
2obn_A349 Hypothetical protein; structural genomics, joint c 97.36
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.35
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.35
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.35
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.34
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.34
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.32
3io5_A333 Recombination and repair protein; storage dimer, i 97.31
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.31
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.3
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 97.3
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 97.3
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.3
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.29
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.28
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.28
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 97.27
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.27
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.27
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.26
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.26
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.25
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.25
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.25
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.25
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.24
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.23
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.23
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 97.22
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.21
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.21
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.2
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.19
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.19
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.17
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.16
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.15
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.14
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.13
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.12
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.11
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.1
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.1
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.1
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.09
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 97.09
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.09
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.09
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.08
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.08
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 97.08
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.08
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.07
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.07
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.07
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.07
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.06
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.06
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 97.05
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.05
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.05
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.04
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.03
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.03
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.02
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 97.02
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.02
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 97.01
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.01
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.0
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.0
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.0
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.99
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.99
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.99
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.99
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.99
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.97
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.97
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.96
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.95
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.95
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 96.94
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.94
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 96.94
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.93
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.92
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.92
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.92
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.91
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.9
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.9
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 96.89
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.89
1p9r_A418 General secretion pathway protein E; bacterial typ 96.89
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.87
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.87
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 96.86
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.84
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.84
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.84
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.83
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.83
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.83
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.82
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.82
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.82
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.81
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.81
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.8
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.8
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.79
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.78
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.77
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.77
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.76
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.76
1via_A175 Shikimate kinase; structural genomics, transferase 96.76
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.75
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.74
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.74
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.73
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 96.73
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 96.71
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 96.7
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.7
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.69
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 96.66
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 96.66
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.65
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.64
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 96.64
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.64
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.63
1b0u_A262 Histidine permease; ABC transporter, transport pro 96.61
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.6
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.59
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.59
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 96.59
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.57
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 96.57
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.56
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 96.55
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 96.55
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 96.55
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.55
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.55
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.55
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 96.53
1g6h_A257 High-affinity branched-chain amino acid transport 96.53
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 96.51
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.51
1ji0_A240 ABC transporter; ATP binding protein, structural g 96.51
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.51
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.51
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 96.5
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 96.5
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 96.5
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 96.49
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.49
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 96.48
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.47
2ghi_A260 Transport protein; multidrug resistance protein, M 96.46
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 96.44
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.43
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.43
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.43
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.42
1tue_A212 Replication protein E1; helicase, replication, E1E 96.4
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 96.4
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 96.4
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 96.39
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
Probab=100.00  E-value=2.2e-52  Score=400.94  Aligned_cols=339  Identities=44%  Similarity=0.749  Sum_probs=313.7

Q ss_pred             CchHhHHHHHHHHHHHhhcccccChhhhHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHhhcccccccCCChHHHHHHHHH
Q 019214            1 MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIF   80 (344)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~   80 (344)
                      |.|+.|++++++.++++++++.++|+.+++.+++|+..|+++|++.+++.++.+++.+....+.+..+.++.+.+.+.+.
T Consensus         1 m~~~~l~~~l~~~~~~l~~~~~l~e~~~~~~l~ei~~~Ll~adv~~~~~~~~~~~v~~~~~~~~v~~~~~~~~~v~~~l~   80 (443)
T 3dm5_A            1 MVLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHIIKIVY   80 (443)
T ss_dssp             CCSTHHHHHHHHHHHHHHHCSCCCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHCCCCTTCCHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHcCCChHHHHHHHHHHHHHHhhccccccCCcHHHHHHHHH
Confidence            78999999999999999999999999999999999999999999999999999999998888888888899999999999


Q ss_pred             HHHHhhcCCCCCCCCCCCCCCeEEEEEcCCCCCHHHHHHHHHHHHHHcCCccEEeecCcCcchhHHHHHhhcccCCccee
Q 019214           81 NELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFY  160 (344)
Q Consensus        81 ~~l~~~l~~~~~~~~~~~~~~~ii~ivG~~GvGKTTl~~~La~~l~~~g~~v~iv~~D~~~~~~~~~l~~~~~~~~v~~~  160 (344)
                      +++.+++....... ...+++.+|+++|++||||||++++||.++.++|++|+++++|+||+++++++..|+...++|++
T Consensus        81 ~eL~~~L~~~~~~~-~~~~~p~vIlivG~~G~GKTTt~~kLA~~l~~~G~kVllv~~D~~R~aa~eqL~~~~~~~gvpv~  159 (443)
T 3dm5_A           81 EELTKFLGTEAKPI-EIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVF  159 (443)
T ss_dssp             HHHHHHTTSSCCCC-CCCSSSEEEEEECCTTSSHHHHHHHHHHHHHTTTCCEEEEECCCSSTHHHHHHHHHHGGGTCEEE
T ss_pred             HHHHHHhcCccccc-ccCCCCeEEEEECcCCCCHHHHHHHHHHHHHHCCCeEEEEeCCCcchhHHHHHHHHHHhcCCcEE
Confidence            99999998633222 22346789999999999999999999999999999999999999999999999999999999998


Q ss_pred             ccCCCCCHHHHHHHHHHHHHhCCCCEEEEcCCCCCcchHHHHHHHHHhhhhcCCcEEEEEEcCCcchhHHHHHHHHhccC
Q 019214          161 GSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSV  240 (344)
Q Consensus       161 ~~~~~~~~~~~~~~~l~~~~~~~~d~vlIDT~G~~~~~~~~~~~l~~~~~~~~~d~illvvda~~~~~~~~~~~~~~~~~  240 (344)
                      ......++..++.+++..+..++||++||||||+.+.+..++.+++.+.....+|.+++|+|++.+.+....+..|.+..
T Consensus       160 ~~~~~~dp~~i~~~al~~a~~~~~DvVIIDTaGrl~~d~~lm~el~~i~~~~~pd~vlLVvDA~~gq~a~~~a~~f~~~~  239 (443)
T 3dm5_A          160 GNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEAT  239 (443)
T ss_dssp             CCTTCCCHHHHHHHHHHHHHHTTCSEEEEECCCCSSCCHHHHHHHHHHHHHHCCSEEEEEEEGGGGGGHHHHHHHHHHSC
T ss_pred             ecCCCCCHHHHHHHHHHHHHhCCCCEEEEECCCcccchHHHHHHHHHHHHhhcCceEEEEEeCCCchhHHHHHHHHHhhC
Confidence            87788899999999999998889999999999999888888888988888888999999999999988888889998888


Q ss_pred             CcCEEEeecCCCCCChhhHHHHHHHhCCCeEEEecCCCCCcCcCCChHHHHHHHhCCCChhHHHHHHHhhCCCCc--hHH
Q 019214          241 SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQ--QPE  318 (344)
Q Consensus       241 ~~~~lVinK~D~~~~~~~~~~~~~~~~~pv~~~~~g~~~~~l~~~~~~~~is~~~g~g~i~~l~~~i~~~~~~~~--~~~  318 (344)
                      ++.++|+||+|.+.++|..++....++.|+.|+++|++++++.+|+|..++++++|+||+..|+|++++..+.+.  . +
T Consensus       240 ~i~gVIlTKlD~~~~gG~~ls~~~~~g~PI~fig~Ge~vddL~~f~~~~~~~~llg~gd~~~l~e~~~~~~~~~~~~~-~  318 (443)
T 3dm5_A          240 PIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSRLLGLGDIQGLLEKFKELEKEVEIKE-E  318 (443)
T ss_dssp             TTEEEEEECCSSCSSHHHHHHHHHTTCCCEEEEECSSSTTCEEECCHHHHHHHHTTTTCHHHHHHHHHHHHTTHHHHH-H
T ss_pred             CCeEEEEECCCCcccccHHHHHHHHHCCCEEEEEcCCChHHhhhCCHHHHHHHHcCCCcHHHHHHHHHHhhhhhHHHH-H
Confidence            888999999999999999999999999999999999999999999999999999999999999999999988765  4 4


Q ss_pred             HHHHHhcCCcChHHHHHhHHhhcc
Q 019214          319 LLQKLSEGNFTLRIMFSLCFQDSV  342 (344)
Q Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~~  342 (344)
                      +.+++.+|+|||+||++| ++++.
T Consensus       319 ~~~k~~~~~f~l~d~~~q-~~~~~  341 (443)
T 3dm5_A          319 DIERFLRGKFTLKDMYAQ-LEAMR  341 (443)
T ss_dssp             HHHHHHTTCCCHHHHHHH-HHHHH
T ss_pred             HHHHHhhCCcCHHHHHHH-HHHHH
Confidence            899999999999999999 98863
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 344
d1ls1a2207 c.37.1.10 (A:89-295) GTPase domain of the signal s 2e-61
d1okkd2207 c.37.1.10 (D:97-303) GTPase domain of the signal r 9e-61
d2qy9a2211 c.37.1.10 (A:285-495) GTPase domain of the signal 1e-58
d1j8yf2211 c.37.1.10 (F:87-297) GTPase domain of the signal s 1e-56
d1vmaa2213 c.37.1.10 (A:82-294) GTPase domain of the signal r 3e-55
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 7e-30
d1wgwa_99 a.24.13.1 (A:) Signal recognition particle 54 kDa 1e-26
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 2e-26
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 3e-16
d1j8yf184 a.24.13.1 (F:3-86) Signal sequence recognition pro 4e-16
d1ls1a188 a.24.13.1 (A:1-88) Signal sequence recognition pro 6e-15
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 1e-10
d1x6va3195 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kin 7e-05
d1m7ga_208 c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (A 1e-04
d1xjca_165 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 6e-04
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 9e-04
d1ihua2279 c.37.1.10 (A:308-586) Arsenite-translocating ATPas 0.001
d1m8pa3183 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d 0.001
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 0.001
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.001
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 0.001
d1ihua1296 c.37.1.10 (A:1-296) Arsenite-translocating ATPase 0.002
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 0.004
d2qm8a1323 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylo 0.004
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal sequence recognition protein Ffh
species: Thermus aquaticus [TaxId: 271]

 Score =  193 bits (492), Expect = 2e-61
 Identities = 80/206 (38%), Positives = 111/206 (53%)

Query: 93  SFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNA 152
           +  P     ++   VGLQGSGKTTT  K A Y++ KG +P LV ADT R  A +QL+   
Sbjct: 2   ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLG 61

Query: 153 TKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEAT 212
            K  +P         P  I     E  + E  DLI+VDT+GR + +  L  E+ ++ E  
Sbjct: 62  EKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL 121

Query: 213 NPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIF 272
            PD V+ V+D+  GQ A   A+AF + V V  +++TK+DG A+GG ALSA   T  P+ F
Sbjct: 122 GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYF 181

Query: 273 IGTGEHMDEFEVFDVKPFVSRLLGMG 298
            G  E  +  E F  +    R+LGMG
Sbjct: 182 AGVSEKPEGLEPFYPERLAGRILGMG 207
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 211 Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d1wgwa_ a.24.13.1 (A:) Signal recognition particle 54 kDa protein, SRP54 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1j8yf1 a.24.13.1 (F:3-86) Signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 84 Back     information, alignment and structure
>d1ls1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 88 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Length = 195 Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 208 Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279 Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Length = 323 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
d2qy9a2211 GTPase domain of the signal recognition particle r 100.0
d1vmaa2213 GTPase domain of the signal recognition particle r 100.0
d1j8yf2211 GTPase domain of the signal sequence recognition p 100.0
d1ls1a2207 GTPase domain of the signal sequence recognition p 100.0
d1okkd2207 GTPase domain of the signal recognition particle r 100.0
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.75
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.74
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.67
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.57
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.55
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.55
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.52
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.51
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.51
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.5
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.46
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.45
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.45
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.43
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.43
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 99.42
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 99.41
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 99.39
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 99.35
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.25
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.22
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.22
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.21
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.21
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.21
d1ls1a188 Signal sequence recognition protein Ffh {Thermus a 99.2
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 99.19
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.19
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.15
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.15
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.15
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 99.13
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.09
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.08
d1wgwa_99 Signal recognition particle 54 kDa protein, SRP54 99.06
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 99.06
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.06
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 99.04
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.01
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.0
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.99
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.99
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.95
d1j8yf184 Signal sequence recognition protein Ffh {Archaeon 98.94
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.94
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.92
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.89
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.88
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.88
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.87
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.87
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.87
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.83
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.8
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.8
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.78
d2fh5b1207 Signal recognition particle receptor beta-subunit 98.78
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.77
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.77
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.76
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.75
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.73
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.73
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.72
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.72
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.68
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.66
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.65
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.65
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.64
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.63
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.58
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.58
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.57
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.55
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.54
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 98.53
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.5
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 98.47
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.42
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.32
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.31
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.31
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.27
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.21
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.2
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.15
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.13
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 98.06
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.05
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.01
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 97.99
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 97.98
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.94
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.9
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.9
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.88
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.84
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.84
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.8
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.78
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.77
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.77
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 97.76
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.73
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.71
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.66
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.63
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.62
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.61
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.6
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.6
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.58
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.57
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.56
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.55
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 97.54
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.48
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.47
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.47
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.46
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.46
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 97.46
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.41
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.41
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.4
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.39
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.38
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.37
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.37
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.33
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.32
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.28
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.25
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.25
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.24
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.24
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.23
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.22
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.22
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.22
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.21
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.21
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.21
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 97.2
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.19
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.17
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.14
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.12
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.11
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.1
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.1
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.09
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.07
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.07
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.05
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.05
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.04
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.02
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 97.02
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.02
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.01
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.01
d2qy9a184 Signal recognition particle receptor, FtsY {Escher 96.94
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.94
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.93
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.9
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.88
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.82
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.79
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.74
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.73
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.73
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.72
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.7
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.7
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.64
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.63
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.63
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.61
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.6
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.59
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.59
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.58
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.56
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.55
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.55
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.54
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.51
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.48
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.48
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.47
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.47
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.46
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.44
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.43
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.41
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.4
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.37
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.32
d1vmaa181 Signal recognition particle receptor, FtsY {Thermo 96.28
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 96.23
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.23
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.22
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.2
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 96.18
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 96.18
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.17
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.17
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.16
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 96.16
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.13
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.11
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 96.09
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.06
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 96.01
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.94
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 95.85
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.78
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.78
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.72
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 95.7
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.67
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 95.6
d1xpua3289 Transcription termination factor Rho, ATPase domai 95.6
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.57
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.51
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.47
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 95.34
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.34
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.27
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.79
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.79
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.54
d1qzxa2138 Signal sequence binding protein Ffh {Archaeon Sulf 94.48
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 94.46
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.37
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 94.31
d1e8ca3234 UDP-N-acetylmuramyl tripeptide synthetase MurE {Es 94.24
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 94.08
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.08
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 93.95
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 93.84
d1tuea_205 Replication protein E1 helicase domain {Human papi 93.7
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.44
d1vcoa2272 CTP synthase PyrG, N-terminal domain {Thermus ther 93.0
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 92.98
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 92.77
d2g0ta1338 Hypothetical protein TM0796 {Thermotoga maritima [ 92.71
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 92.06
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.99
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 91.86
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 91.43
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 91.1
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 90.93
d1gg4a4214 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 90.47
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 90.18
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 89.95
d1okkd158 Signal recognition particle receptor, FtsY {Thermu 89.93
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 89.71
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 88.94
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 88.64
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 87.68
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 87.44
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 87.15
d1j6ua3207 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 86.59
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 86.22
d2gc6a2296 Folylpolyglutamate synthetase {Lactobacillus casei 86.06
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 86.05
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 85.98
d2jfga3204 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 85.96
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 84.94
d1s1ma2266 CTP synthase PyrG, N-terminal domain {Escherichia 84.93
d1eg7a_ 549 Formyltetrahydrofolate synthetase {Moorella thermo 84.92
d2vo1a1273 CTP synthase PyrG, N-terminal domain {Human (Homo 84.75
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 84.63
d1o5za2296 Folylpolyglutamate synthetase {Thermotoga maritima 84.25
d1p3da3215 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.97
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 83.88
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 83.32
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 82.91
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 82.83
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 82.44
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 82.07
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 82.05
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 81.67
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 80.88
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal recognition particle receptor FtsY
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=6.6e-39  Score=276.52  Aligned_cols=201  Identities=33%  Similarity=0.566  Sum_probs=185.1

Q ss_pred             CCCCCCeEEEEEcCCCCCHHHHHHHHHHHHHHcCCccEEeecCcCcchhHHHHHhhcccCCcceeccCCCCCHHHHHHHH
Q 019214           96 PKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEG  175 (344)
Q Consensus        96 ~~~~~~~ii~ivG~~GvGKTTl~~~La~~l~~~g~~v~iv~~D~~~~~~~~~l~~~~~~~~v~~~~~~~~~~~~~~~~~~  175 (344)
                      ....+|.+|+++||+||||||++++||.++.++|++|++|++|+||+++.+||+.|+.+.+++++....+.++..++++.
T Consensus         4 ~~~~~p~vi~lvGptGvGKTTTiAKLA~~~~~~g~kV~lit~Dt~R~gA~eQL~~~a~~l~v~~~~~~~~~d~~~~l~~~   83 (211)
T d2qy9a2           4 VEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDA   83 (211)
T ss_dssp             CCSCTTEEEEEECCTTSCHHHHHHHHHHHHHTTTCCEEEECCCTTCHHHHHHHHHHHHHTTCCEECCSTTCCHHHHHHHH
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCcEEEEecccccccchhhhhhhhhhcCCcccccccCCCHHHHHHHH
Confidence            34456799999999999999999999999999999999999999999999999999999999999989999999999998


Q ss_pred             HHHHHhCCCCEEEEcCCCCCcchHHHHHHHHHhhhhc------CCcEEEEEEcCCcchhHHHHHHHHhccCCcCEEEeec
Q 019214          176 VETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEAT------NPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTK  249 (344)
Q Consensus       176 l~~~~~~~~d~vlIDT~G~~~~~~~~~~~l~~~~~~~------~~d~illvvda~~~~~~~~~~~~~~~~~~~~~lVinK  249 (344)
                      ......+++|+|||||||+++.+...+++++.+....      .++.+++|+|++.+.+.......+....++.++|+||
T Consensus        84 ~~~a~~~~~d~ilIDTaGr~~~d~~~~~el~~l~~~~~~~~~~~p~~~~LVl~a~~~~~~~~~~~~~~~~~~~~~lIlTK  163 (211)
T d2qy9a2          84 IQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTK  163 (211)
T ss_dssp             HHHHHHTTCSEEEECCCCCGGGHHHHHHHHHHHHHHHTTTCTTCCSEEEEEEEGGGTHHHHHHHHHHHHHSCCCEEEEEC
T ss_pred             HHHHHHcCCCEEEeccCCCccccHHHHHHHHHHHHHHhhhcccCcceeeeehhcccCcchHHHHhhhhhccCCceEEEee
Confidence            8888788999999999999999989999988776654      3789999999999988777777777778899999999


Q ss_pred             CCCCCChhhHHHHHHHhCCCeEEEecCCCCCcCcCCChHHHHHHHhC
Q 019214          250 MDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLG  296 (344)
Q Consensus       250 ~D~~~~~~~~~~~~~~~~~pv~~~~~g~~~~~l~~~~~~~~is~~~g  296 (344)
                      .|++.++|.+++....+++|+.|+++||+++|+.++++..+++.++|
T Consensus       164 lDe~~~~G~~l~~~~~~~~Pi~~i~~Gq~v~Dl~~~~~~~~~~~llg  210 (211)
T d2qy9a2         164 LDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFA  210 (211)
T ss_dssp             CTTCTTTTHHHHHHHHHCCCEEEEECSSSGGGEEECCHHHHHHHHHC
T ss_pred             cCCCCCccHHHHHHHHHCCCEEEEeCCCCcccCccCCHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999887
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ls1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1wgwa_ a.24.13.1 (A:) Signal recognition particle 54 kDa protein, SRP54 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8yf1 a.24.13.1 (F:3-86) Signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a1 a.24.13.1 (A:201-284) Signal recognition particle receptor, FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa1 a.24.13.1 (A:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qzxa2 a.36.1.1 (A:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2g0ta1 c.37.1.10 (A:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1okkd1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure