Citrus Sinensis ID: 019408

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKELQGCQKN
ccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHccccccccEEEEEcHHHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccEEEEEEEEEcccHHHHHccccEEEEEEcccEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccHHHHHHHHHHcccEEEEEEEccccEEccccHHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHccccccccEEEccHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHcccEEEEEEccHHHHcccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEEccHHHHHHHHHHcEEEEcccccccccccccccccccccccccccccEEcccEcccccccHHHHHHHHHHHHHccccHcccHHHHHHHHHHHHHHccccccccEEcHHHHHHHcccccccHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHHccc
MCGCGIRSLRYLAEAKADFvmandgndahRRVILGNLksiergsgdekrWVVTHFDAnrvlsecylkreffdlididsfgsdssFLRTVFNAVkrdgllyltstdgyssgghrpnnslasygayilpmpysneIGLRMLIGGAVreasaqgyhvsplfsyysyhgpVFRVMLRVHRkalpdnrhygfisycnhcgnsqaysweelgqmscpcsntigssslvvsgplwtgplhdaTHITKMLNLAEkwgwvgdgtgTDLEKLLSRMidesdprlpfgyikldemasrakmnspslKTMMSAVQKEGYVASRSHIAsnaiktncpMVACIRIAKELQGCQKN
MCGCGIRSLRYLAEAKADFVmandgndahRRVILGNlksiergsgdekrwvVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTStdgyssgghrpNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRmidesdprLPFGYIKLDEMASRAKMNSPSLKTMMSAVQKEGYVASRSHIasnaiktncPMVACIRIAKELQGCQKN
MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRVLSECYLKREffdlididsfgsdssflRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKELQGCQKN
**GCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYS*******NSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMID****RLPFGYIKL*************************YVASRSHIASNAIKTNCPMVACIRIAKEL******
MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKELQG****
MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKELQGCQKN
**GCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKELQGC***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKELQGCQKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query341 2.2.26 [Sep-21-2011]
B6YUU9377 tRNA (guanine(26)-N(2))-d yes no 0.914 0.827 0.305 2e-30
O59493381 tRNA (guanine(26)-N(2))-d yes no 0.912 0.816 0.287 4e-30
Q9V1P3379 tRNA (guanine(26)-N(2))-d yes no 0.900 0.810 0.276 3e-28
Q97ZH0378 tRNA (guanine(26)-N(2))-d yes no 0.868 0.783 0.298 2e-27
C5A6N2378 tRNA (guanine(26)-N(2))-d yes no 0.900 0.812 0.300 5e-27
C3NDZ5378 tRNA (guanine(26)-N(2))-d yes no 0.914 0.825 0.276 9e-27
C3NHQ8378 tRNA (guanine(26)-N(2))-d yes no 0.914 0.825 0.276 9e-27
P81554381 tRNA (guanine(26)-N(2))-d yes no 0.920 0.824 0.279 1e-26
C3MYQ9378 tRNA (guanine(26)-N(2))-d yes no 0.914 0.825 0.276 1e-26
C4KH07378 tRNA (guanine(26)-N(2))-d yes no 0.914 0.825 0.276 1e-26
>sp|B6YUU9|TRM1_THEON tRNA (guanine(26)-N(2))-dimethyltransferase OS=Thermococcus onnurineus (strain NA1) GN=trm1 PE=3 SV=1 Back     alignment and function desciption
 Score =  133 bits (335), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 106/347 (30%), Positives = 163/347 (46%), Gaps = 35/347 (10%)

Query: 1   MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGD----------EKRW 50
           +   GIR +RY  E  A  +  ND N    R+I+ N+K    G  +          EK  
Sbjct: 55  LSATGIRGIRYALETPAGEIWLNDINPNAFRLIVDNVKLNFSGELEIEGKMAVLEGEKTL 114

Query: 51  VVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTD-GYSS 109
           VVT+ DANR+++E +    +FD +D+D FGS   FL +   AVKR G+L +T+TD G   
Sbjct: 115 VVTNADANRLMNEQF---RYFDFVDLDPFGSPMEFLDSALRAVKRRGVLAITATDTGVLC 171

Query: 110 GGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFR 169
           G +R N  L  Y A  +     +E GLR+LIG  VR A+     V  L +YY  H   FR
Sbjct: 172 GAYR-NACLRKYLAEPIRGELCHEAGLRILIGTLVRYAAKYDLGVEVLLAYYRDH--YFR 228

Query: 170 VMLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWT 229
             L++   A   ++    + Y  +   S  + +E          NT   S     GPLW 
Sbjct: 229 AFLQLRNGAKTADKSMKQLGYL-YQDESGKFEFE----------NTFLPSKATAHGPLWL 277

Query: 230 GPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAK 289
           GPL +   + ++  L+ +       T    +K L  + DE +  +PF Y     +A R  
Sbjct: 278 GPLKNQEFVEELHRLSAEHPLGSKKT----QKFLGLLKDELE--VPFFY-DTHAVARRHG 330

Query: 290 MNSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKELQ 336
           +    L  ++  + ++GY A+R+H +  A+KT+ P    +   +ELQ
Sbjct: 331 LEVRKLAGVIEILYEKGYKATRTHFSPTALKTDAPFEEVLEALRELQ 377
Dimethylates a single guanine residue at position 26 of a number of tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.
Thermococcus onnurineus (strain NA1) (taxid: 523850)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 1EC: 6
>sp|O59493|TRM1_PYRHO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=trm1 PE=1 SV=1 Back     alignment and function description
>sp|Q9V1P3|TRM1_PYRAB tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trm1 PE=3 SV=2 Back     alignment and function description
>sp|Q97ZH0|TRM1_SULSO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trm1 PE=3 SV=1 Back     alignment and function description
>sp|C5A6N2|TRM1_THEGJ tRNA (guanine(26)-N(2))-dimethyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=trm1 PE=3 SV=1 Back     alignment and function description
>sp|C3NDZ5|TRM1_SULIY tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=trm1 PE=3 SV=1 Back     alignment and function description
>sp|C3NHQ8|TRM1_SULIN tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=trm1 PE=3 SV=1 Back     alignment and function description
>sp|P81554|TRM1_PYRFU tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trm1 PE=1 SV=1 Back     alignment and function description
>sp|C3MYQ9|TRM1_SULIM tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=trm1 PE=3 SV=1 Back     alignment and function description
>sp|C4KH07|TRM1_SULIK tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=trm1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
225448659424 PREDICTED: N(2),N(2)-dimethylguanosine t 0.991 0.797 0.739 1e-153
297736506338 unnamed protein product [Vitis vinifera] 0.991 1.0 0.739 1e-152
255564102422 N(2),N(2)-dimethylguanosine tRNA methylt 0.997 0.805 0.744 1e-151
224126557428 predicted protein [Populus trichocarpa] 0.991 0.789 0.752 1e-150
297816958431 predicted protein [Arabidopsis lyrata su 0.979 0.774 0.727 1e-145
15228894433 N2,N2-dimethylguanosine tRNA methyltrans 0.979 0.771 0.721 1e-144
449457478 467 PREDICTED: tRNA (guanine(26)-N(2))-dimet 0.991 0.723 0.686 1e-142
449491708440 PREDICTED: tRNA (guanine(26)-N(2))-dimet 0.991 0.768 0.686 1e-142
356518704432 PREDICTED: N(2),N(2)-dimethylguanosine t 0.988 0.780 0.657 1e-135
357129459 444 PREDICTED: N(2),N(2)-dimethylguanosine t 0.985 0.756 0.582 1e-115
>gi|225448659|ref|XP_002274607.1| PREDICTED: N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 [Vitis vinifera] gi|147780177|emb|CAN75521.1| hypothetical protein VITISV_043594 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 250/338 (73%), Positives = 297/338 (87%)

Query: 1   MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRV 60
           MCGCGIRSLRYL EA+ADFV+AND N+ + R IL NL     GSG+E+RWVVTH DANRV
Sbjct: 87  MCGCGIRSLRYLVEAEADFVLANDANENYGRTILENLSQGLGGSGEERRWVVTHTDANRV 146

Query: 61  LSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLAS 120
           ++ECYL+R+F+DLID+DSFGS+SSFLR+ +NA+K DGL Y+TSTDGY+SGGHRP++SLAS
Sbjct: 147 MTECYLRRDFYDLIDVDSFGSESSFLRSAYNALKLDGLFYVTSTDGYTSGGHRPHHSLAS 206

Query: 121 YGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALP 180
           YGA++ PMPYSNE+GLRMLIGGA+REAS  GY ++PLFSYYSYHGPVFRVMLR++R  LP
Sbjct: 207 YGAFVRPMPYSNEVGLRMLIGGALREASVLGYRITPLFSYYSYHGPVFRVMLRMNRGKLP 266

Query: 181 DNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITK 240
           +NR+YGFISYC  CGNSQA+SW ELG++SCPCS+   SSSLVVSGPLW GPLH+A+++T+
Sbjct: 267 ENRNYGFISYCTKCGNSQAFSWNELGRISCPCSDAKVSSSLVVSGPLWIGPLHNASYLTE 326

Query: 241 MLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMS 300
           MLNLAE+WGW G+ T T L KLL +MIDESDP+LPFGYIKLDE+ASRAK+NSP L+TMMS
Sbjct: 327 MLNLAEQWGWTGNDTETHLGKLLKQMIDESDPKLPFGYIKLDEVASRAKINSPPLRTMMS 386

Query: 301 AVQKEGYVASRSHIASNAIKTNCPMVACIRIAKELQGC 338
           A+ KEGY  SRSHIASNAIKTNCPM  CIRIAKELQ C
Sbjct: 387 ALNKEGYAVSRSHIASNAIKTNCPMAVCIRIAKELQQC 424

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297736506|emb|CBI25377.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255564102|ref|XP_002523049.1| N(2),N(2)-dimethylguanosine tRNA methyltransferase, putative [Ricinus communis] gi|223537732|gb|EEF39353.1| N(2),N(2)-dimethylguanosine tRNA methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224126557|ref|XP_002319867.1| predicted protein [Populus trichocarpa] gi|222858243|gb|EEE95790.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297816958|ref|XP_002876362.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322200|gb|EFH52621.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228894|ref|NP_191192.1| N2,N2-dimethylguanosine tRNA methyltransferase [Arabidopsis thaliana] gi|7572931|emb|CAB87432.1| N2, N2-dimethylguanosine tRNA methyltransferases-like protein [Arabidopsis thaliana] gi|332645989|gb|AEE79510.1| N2,N2-dimethylguanosine tRNA methyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449457478|ref|XP_004146475.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449491708|ref|XP_004158980.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356518704|ref|XP_003528018.1| PREDICTED: N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1-like [Glycine max] Back     alignment and taxonomy information
>gi|357129459|ref|XP_003566379.1| PREDICTED: N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
TAIR|locus:2078431433 AT3G56330 [Arabidopsis thalian 0.979 0.771 0.673 9.2e-123
POMBASE|SPBC25D12.05548 trm1 "tRNA (guanine-N2-)-methy 0.885 0.551 0.289 2.3e-19
CGD|CAL0003366556 TRM1 [Candida albicans (taxid: 0.906 0.555 0.250 9.3e-12
ZFIN|ZDB-GENE-060810-40 672 trmt1 "tRNA methyltransferase 0.917 0.465 0.230 1.7e-11
WB|WBGene00006613526 trm-1 [Caenorhabditis elegans 0.914 0.593 0.263 5.5e-11
UNIPROTKB|F6R277 662 TRMT1 "Uncharacterized protein 0.914 0.471 0.235 1.4e-10
FB|FBgn0032430 578 CG6388 [Drosophila melanogaste 0.290 0.171 0.300 1.4e-10
UNIPROTKB|F1SD98542 TRMT1 "Uncharacterized protein 0.671 0.422 0.263 3.6e-10
UNIPROTKB|F1MAP8 625 Trmt1 "Protein Trmt1" [Rattus 0.914 0.499 0.235 4.6e-10
MGI|MGI:1289155 663 Trmt1 "tRNA methyltransferase 0.920 0.473 0.236 6.6e-10
TAIR|locus:2078431 AT3G56330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1207 (429.9 bits), Expect = 9.2e-123, P = 9.2e-123
 Identities = 225/334 (67%), Positives = 266/334 (79%)

Query:     1 MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRV 60
             MCGCGIRSLRYL EA+ADFVMAND ND +RRVI  NL  +ERG+GDE+RWVVTH  AN+ 
Sbjct:    96 MCGCGIRSLRYLVEAEADFVMANDANDDNRRVITDNLSKVERGTGDERRWVVTHMLANKA 155

Query:    61 LSECYLKREXXXXXXXXXXXXXXXXXRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLAS 120
             + E Y+  +                 R  FNA++  GLLYLTSTDGYSSGGHRP NSLA+
Sbjct:   156 MIERYMVADFFDMIDIDSFGSDSSFLRDAFNALRLGGLLYLTSTDGYSSGGHRPYNSLAA 215

Query:   121 YGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALP 180
             YGA+I PMP+ NEIGLRMLIGGAVREA+  GYHV+PLFSYYSYHGPVFRVMLRVHR  L 
Sbjct:   216 YGAFIRPMPFGNEIGLRMLIGGAVREAALLGYHVTPLFSYYSYHGPVFRVMLRVHRGKLH 275

Query:   181 DNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATHITK 240
             ++R+YGF+++CN CG+S    ++ELG M CPCS+T  SSSLVVSGP+W GPLHDA+++T+
Sbjct:   276 EDRNYGFVTHCNLCGHSHTLRFDELGLMGCPCSDTKASSSLVVSGPMWLGPLHDASYVTE 335

Query:   241 MLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMS 300
             ML LA++WGWV +GTG DL+KLLS MI+ESDPRLP GY K+DEMASRAKMNSP LK MMS
Sbjct:   336 MLELAKEWGWVSEGTGMDLDKLLSIMIEESDPRLPPGYTKMDEMASRAKMNSPPLKKMMS 395

Query:   301 AVQKEGYVASRSHIASNAIKTNCPMVACIRIAKE 334
             A+ KEGY ASRSHI  NA+KT+CPM   +RIAKE
Sbjct:   396 ALVKEGYAASRSHIIPNALKTDCPMSHFVRIAKE 429
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0004809 "tRNA (guanine-N2-)-methyltransferase activity" evidence=IEA;ISS
GO:0008033 "tRNA processing" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0009536 "plastid" evidence=IDA
GO:0016556 "mRNA modification" evidence=RCA
POMBASE|SPBC25D12.05 trm1 "tRNA (guanine-N2-)-methyltransferase" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0003366 TRM1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060810-40 trmt1 "tRNA methyltransferase 1 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00006613 trm-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F6R277 TRMT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0032430 CG6388 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1SD98 TRMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAP8 Trmt1 "Protein Trmt1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1289155 Trmt1 "tRNA methyltransferase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B6YUU9TRM1_THEON2, ., 1, ., 1, ., 2, 1, 60.30540.91490.8275yesno
A3CW75TRM1_METMJ2, ., 1, ., 1, ., 2, 1, 60.30360.88260.8113yesno
C5A6N2TRM1_THEGJ2, ., 1, ., 1, ., 2, 1, 60.30020.90020.8121yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!
3rd Layer2.1.1.32LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
PRK04338382 PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tR 3e-67
COG1867380 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyl 3e-66
pfam02005375 pfam02005, TRM, N2,N2-dimethylguanosine tRNA methy 4e-61
TIGR00308374 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltran 3e-49
>gnl|CDD|235286 PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information 
 Score =  215 bits (550), Expect = 3e-67
 Identities = 111/340 (32%), Positives = 165/340 (48%), Gaps = 25/340 (7%)

Query: 1   MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRV 60
           +   GIR +RY  E   + V  ND N     +I  NL+    G  +EK   V + DAN +
Sbjct: 65  LSASGIRGIRYALETGVEKVTLNDINPDAVELIKKNLE--LNGLENEK---VFNKDANAL 119

Query: 61  LSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLAS 120
           L E       FD++DID FGS + FL +   +VKR GLL +T+TD     G  P + L  
Sbjct: 120 LHE----ERKFDVVDIDPFGSPAPFLDSAIRSVKRGGLLCVTATDTAPLCGAYPKSCLRK 175

Query: 121 YGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRVMLRVHRKALP 180
           YGA  L   + +E+GLR+LIG   REA+     + PLFS+ + H   +RV L+V R A  
Sbjct: 176 YGAVPLKTEFYHEMGLRILIGYIAREAAKYDKGLEPLFSHSTDH--YYRVFLKVERGAKK 233

Query: 181 DNR---HYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTGPLHDATH 237
            ++   + G++ YC  C   +            P    +       +GPLW GPLHD   
Sbjct: 234 ADKALENLGYVYYCPKCLYREEVE------GLPPEECPVCGGKFGTAGPLWLGPLHDKEF 287

Query: 238 ITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKT 297
           + +ML  A K      GT     KLL  + +ES    P  +  L E+A + K+++P +  
Sbjct: 288 VEEMLEEAAKE----LGTSKKALKLLKTIEEESKLDTP-TFYDLHELAKKLKVSAPPMDE 342

Query: 298 MMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKELQG 337
           ++ A+++ G+ ASR+H +    KT+ P        K L  
Sbjct: 343 ILEALREAGFEASRTHFSPTGFKTDAPYDEIKEAIKSLSS 382

Length = 382
>gnl|CDD|224780 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216840 pfam02005, TRM, N2,N2-dimethylguanosine tRNA methyltransferase Back     alignment and domain information
>gnl|CDD|232913 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 341
COG1867380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 100.0
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 100.0
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 100.0
KOG1253525 consensus tRNA methyltransferase [Translation, rib 100.0
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 100.0
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.8
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 99.76
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.73
COG0742187 N6-adenine-specific methylase [DNA replication, re 99.72
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.68
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.64
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.52
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.44
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 99.35
COG2520341 Predicted methyltransferase [General function pred 99.3
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.19
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 99.03
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.0
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.95
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.95
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.94
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.92
PLN02476278 O-methyltransferase 98.87
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.85
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.81
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.8
PRK14967223 putative methyltransferase; Provisional 98.8
COG4123248 Predicted O-methyltransferase [General function pr 98.8
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.8
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.8
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.8
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.77
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.76
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.75
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.74
PRK00811283 spermidine synthase; Provisional 98.73
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.72
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.71
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.7
PRK10742250 putative methyltransferase; Provisional 98.68
PRK04457262 spermidine synthase; Provisional 98.68
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.67
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.66
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.65
PRK14902444 16S rRNA methyltransferase B; Provisional 98.65
PRK14901434 16S rRNA methyltransferase B; Provisional 98.64
PRK07402196 precorrin-6B methylase; Provisional 98.64
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.63
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.63
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.62
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.62
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.59
PRK14903431 16S rRNA methyltransferase B; Provisional 98.59
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.57
PRK10901427 16S rRNA methyltransferase B; Provisional 98.55
COG2890280 HemK Methylase of polypeptide chain release factor 98.54
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.54
PRK14904445 16S rRNA methyltransferase B; Provisional 98.53
PLN02589247 caffeoyl-CoA O-methyltransferase 98.52
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.52
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.51
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.5
COG4122219 Predicted O-methyltransferase [General function pr 98.5
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.5
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.48
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.48
PRK03612521 spermidine synthase; Provisional 98.47
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.45
PLN02823336 spermine synthase 98.44
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.44
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.44
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.43
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.41
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.41
PRK01581374 speE spermidine synthase; Validated 98.41
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.38
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.38
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.37
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.35
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.35
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.34
PLN02366308 spermidine synthase 98.34
PRK14968188 putative methyltransferase; Provisional 98.33
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.33
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.31
COG1041347 Predicted DNA modification methylase [DNA replicat 98.28
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.21
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.17
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.16
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.15
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.11
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.11
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.09
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.07
PHA03411279 putative methyltransferase; Provisional 98.05
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.02
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 97.96
PLN02672 1082 methionine S-methyltransferase 97.94
PHA03412241 putative methyltransferase; Provisional 97.94
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.9
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 97.88
PRK11207197 tellurite resistance protein TehB; Provisional 97.87
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 97.82
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.82
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.81
KOG2730263 consensus Methylase [General function prediction o 97.81
PRK12335287 tellurite resistance protein TehB; Provisional 97.79
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.79
COG4262508 Predicted spermidine synthase with an N-terminal m 97.79
PLN02244340 tocopherol O-methyltransferase 97.75
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.74
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 97.72
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.72
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.71
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.71
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 97.68
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.68
COG2521287 Predicted archaeal methyltransferase [General func 97.67
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 97.65
PLN03075296 nicotianamine synthase; Provisional 97.62
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.62
PLN02336475 phosphoethanolamine N-methyltransferase 97.61
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 97.61
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 97.61
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.6
PRK04266226 fibrillarin; Provisional 97.59
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.56
KOG2904328 consensus Predicted methyltransferase [General fun 97.54
KOG2078495 consensus tRNA modification enzyme [RNA processing 97.53
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 97.51
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.5
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 97.49
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.47
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.46
PLN02490340 MPBQ/MSBQ methyltransferase 97.45
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 97.44
COG4076252 Predicted RNA methylase [General function predicti 97.43
PLN02233261 ubiquinone biosynthesis methyltransferase 97.43
KOG1499346 consensus Protein arginine N-methyltransferase PRM 97.39
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.39
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.29
PRK08317241 hypothetical protein; Provisional 97.29
PRK06922677 hypothetical protein; Provisional 97.29
COG3286204 Uncharacterized protein conserved in archaea [Func 97.28
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.28
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 97.27
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.26
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 97.24
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.24
PRK00536262 speE spermidine synthase; Provisional 97.22
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 97.2
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 97.2
TIGR00740239 methyltransferase, putative. A simple BLAST search 97.19
TIGR00452314 methyltransferase, putative. Known examples to dat 97.16
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 97.1
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 97.1
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.08
COG3897218 Predicted methyltransferase [General function pred 97.08
PF09840190 DUF2067: Uncharacterized protein conserved in arch 97.01
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 97.0
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 96.98
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 96.98
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 96.96
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 96.96
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.88
KOG1500517 consensus Protein arginine N-methyltransferase CAR 96.81
TIGR00438188 rrmJ cell division protein FtsJ. 96.79
PTZ00338294 dimethyladenosine transferase-like protein; Provis 96.79
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 96.77
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 96.69
PTZ00146293 fibrillarin; Provisional 96.64
TIGR03438301 probable methyltransferase. This model represents 96.63
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 96.59
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 96.57
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 96.52
KOG1227351 consensus Putative methyltransferase [General func 96.51
COG1568354 Predicted methyltransferases [General function pre 96.43
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 96.41
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 96.36
PLN02336475 phosphoethanolamine N-methyltransferase 96.3
PLN02585315 magnesium protoporphyrin IX methyltransferase 96.3
PRK13255218 thiopurine S-methyltransferase; Reviewed 96.25
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.16
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 96.08
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 96.08
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.03
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.03
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 95.82
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 95.71
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 95.69
PRK11524284 putative methyltransferase; Provisional 95.59
KOG1271227 consensus Methyltransferases [General function pre 95.52
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 95.51
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 95.47
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 95.41
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 95.15
PF04378245 RsmJ: Ribosomal RNA small subunit methyltransferas 94.98
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 94.9
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 94.86
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 94.81
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 94.79
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 94.78
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.74
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 94.73
PHA01634156 hypothetical protein 94.66
PLN02232160 ubiquinone biosynthesis methyltransferase 94.48
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 94.35
KOG2899288 consensus Predicted methyltransferase [General fun 94.23
PRK13699227 putative methylase; Provisional 94.12
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 93.99
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 93.99
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 93.8
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 93.69
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 93.65
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 93.58
PRK06202232 hypothetical protein; Provisional 93.36
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 93.28
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 93.23
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 93.02
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 92.97
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 92.86
PRK13256226 thiopurine S-methyltransferase; Reviewed 92.06
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 92.01
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 91.87
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 91.84
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 91.84
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 91.75
KOG1562337 consensus Spermidine synthase [Amino acid transpor 91.67
PRK05785226 hypothetical protein; Provisional 91.58
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 91.56
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 91.42
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 91.17
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 91.13
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 90.75
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 90.53
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 89.94
COG0270328 Dcm Site-specific DNA methylase [DNA replication, 89.92
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 89.9
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 89.78
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 89.22
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 89.19
PLN02740381 Alcohol dehydrogenase-like 89.17
PLN02827378 Alcohol dehydrogenase-like 89.14
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 88.89
PF00145335 DNA_methylase: C-5 cytosine-specific DNA methylase 88.01
PF00072112 Response_reg: Response regulator receiver domain; 87.98
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 87.84
KOG2671421 consensus Putative RNA methylase [Replication, rec 87.66
COG2961279 ComJ Protein involved in catabolism of external DN 87.6
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 87.1
TIGR00675315 dcm DNA-methyltransferase (dcm). All proteins in t 86.85
COG2384226 Predicted SAM-dependent methyltransferase [General 86.76
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 86.7
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 86.57
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 86.53
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 86.27
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 85.79
KOG1501 636 consensus Arginine N-methyltransferase [General fu 85.54
COG0300265 DltE Short-chain dehydrogenases of various substra 85.34
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 85.12
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 85.06
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 84.52
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 83.95
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 83.82
KOG2352482 consensus Predicted spermine/spermidine synthase [ 83.76
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 83.68
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 83.63
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 83.58
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 83.2
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 82.93
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 82.81
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 82.78
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 82.76
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 82.68
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 82.63
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 82.32
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 80.93
PRK04148134 hypothetical protein; Provisional 80.55
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 80.49
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 80.44
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 80.31
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-95  Score=694.72  Aligned_cols=316  Identities=33%  Similarity=0.523  Sum_probs=287.5

Q ss_pred             CccccHhHHHHhhhCCCCEEEEeeCCHHHHHHHHHHHHHcCCCCCCCccEEEEeccHHHHHHHhhhcCCcccEEEeCCCC
Q 019408            1 MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSGDEKRWVVTHFDANRVLSECYLKREFFDLIDIDSFG   80 (341)
Q Consensus         1 fagsG~rgir~a~e~ga~~V~~~Dis~~A~~~i~~N~~~n~~~~~~~~~~~v~~~DA~~~l~~~~~~~~~fDvIdlDPyg   80 (341)
                      |||||+||||||.|.+..+|++||+||+|+++|++|+++|..     .+..+++.|||.+|++..   ..||+|||||||
T Consensus        60 lsatGiRgIRya~E~~~~~v~lNDisp~Avelik~Nv~~N~~-----~~~~v~n~DAN~lm~~~~---~~fd~IDiDPFG  131 (380)
T COG1867          60 LSATGIRGIRYAVETGVVKVVLNDISPKAVELIKENVRLNSG-----EDAEVINKDANALLHELH---RAFDVIDIDPFG  131 (380)
T ss_pred             ccccchhHhhhhhhcCccEEEEccCCHHHHHHHHHHHHhcCc-----ccceeecchHHHHHHhcC---CCccEEecCCCC
Confidence            799999999999998887999999999999999999999944     356677899999999753   589999999999


Q ss_pred             CCHHHHHHHHHhcccCCEEEEEecCCCCCCCCCchhHHhhhccccCCCCCchhhhHHHHHHHHHHHHHhcCCcEEEEEec
Q 019408           81 SDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSY  160 (341)
Q Consensus        81 sp~~fld~al~~v~~gGlL~vt~TD~~~l~g~~~~~~~r~Yg~~~~~~~~~~E~~lR~ll~~i~~~Aa~~~~~i~Pl~s~  160 (341)
                      ||+||+|+|++++++||+|+|||||+++|||.+|++|+||||+.|++++++||+|+|+|+++++|.||+|+++|+||+|+
T Consensus       132 SPaPFlDaA~~s~~~~G~l~vTATD~a~L~G~~p~~c~rkY~a~~~~~~~~hE~glR~Lig~vaR~AAkyd~~i~Plls~  211 (380)
T COG1867         132 SPAPFLDAALRSVRRGGLLCVTATDTAPLCGSYPRKCRRKYGAVPLKTEFCHEVGLRILIGYVARTAAKYDKAIEPLLSL  211 (380)
T ss_pred             CCchHHHHHHHHhhcCCEEEEEecccccccCCChHHHHHHhccccCCCcchhHHHHHHHHHHHHHHHHhhcccceeEEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCeEEEEEEEEeCccc---ccccceeEEEcCCCCCcccccccccCCCCCC-CCCCCCCCcceeeccccccCCCCHH
Q 019408          161 YSYHGPVFRVMLRVHRKALP---DNRHYGFISYCNHCGNSQAYSWEELGQMSCP-CSNTIGSSSLVVSGPLWTGPLHDAT  236 (341)
Q Consensus       161 ~~~~dhy~Rv~vrv~~~~~~---~~~~~g~v~~C~~C~~~~~~~~~~~~~~~C~-c~~~~~~~~~~~~GPlW~G~lhd~~  236 (341)
                      +  .||||||||+|.+|+.+   +.+++||++||..||  +..........+|+ |++     .++++||+|+|||||++
T Consensus       212 ~--~dhY~Rvfv~v~rga~~ad~~~e~~g~~~~c~~cg--~~~~~~~~~~~~c~~Cg~-----~~~~~GPlW~GpL~d~~  282 (380)
T COG1867         212 S--IDHYVRVFVEVRRGARRADKLLENLGYIYHCSRCG--EIVGSFREVDEKCPHCGG-----KVHLAGPLWLGPLHDEE  282 (380)
T ss_pred             e--eceEEEEEEEEccCchhHHHHHHhcCcEEEccccc--ceecccccccccCCcccc-----cceeccCcccCcccCHH
Confidence            9  99999999999999887   578999999999999  22221222336795 555     89999999999999999


Q ss_pred             HHHHHHHHHHhcCCCCCCChhhHHHHHHHhhcccCCCCCCcceehhHHHhhcCCCCCCHHHHHHHHHHCCCEEeeeecCC
Q 019408          237 HITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMSAVQKEGYVASRSHIAS  316 (341)
Q Consensus       237 fv~~~l~~~~~~~~~~~~~~~~~~~ll~~~~~e~~~~~pp~yy~~~~l~~~~k~~~p~~~~~~~~L~~~Gy~as~tH~~~  316 (341)
                      |+++|++.+++...   ++.+++.++|+.+.+|  .+.+|+||++|+|||++|.+.||+++++++|+++||+||||||+|
T Consensus       283 f~e~~l~~~~~~~l---~~~~~~~klL~~i~~E--~~~~p~fydl~~ias~l~~s~p~~~~vv~~L~~~G~~asrTHf~p  357 (380)
T COG1867         283 FIEEMLEIAEGLEL---GTKKRALKLLKLIKKE--LDISPLFYDLHRIASKLGLSAPPLEEVVEALRSAGYEASRTHFSP  357 (380)
T ss_pred             HHHHHHHHhhcccc---ccHHHHHHHHHHHHhh--cCCCceEEEHHHHHHHhCCCCCCHHHHHHHHHhcCceeeeeccCC
Confidence            99999998876522   3456799999999977  445579999999999999999999999999999999999999999


Q ss_pred             CceecCCCHHHHHHHHHhhhhh
Q 019408          317 NAIKTNCPMVACIRIAKELQGC  338 (341)
Q Consensus       317 ~~iKTdAp~~~i~~i~~~~~~~  338 (341)
                      +|||||||+++|+++|+++.+-
T Consensus       358 ~giKTda~~~ev~~vl~~~~~~  379 (380)
T COG1867         358 TGIKTDAPYEEVEKVLKSLKKD  379 (380)
T ss_pred             cccccCCCHHHHHHHHHHhhcC
Confidence            9999999999999999998753

>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>COG3286 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF09840 DUF2067: Uncharacterized protein conserved in archaea (DUF2067); InterPro: IPR019202 This family of archaeal proteins, have no known function Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
2dul_A378 Crystal Structure Of Trna G26 Methyltransferase Trm 7e-23
3axs_A392 Complex Structure Of Trna Methyltransferase Trm1 Fr 4e-17
>pdb|2DUL|A Chain A, Crystal Structure Of Trna G26 Methyltransferase Trm1 In Apo Form From Pyrococcus Horikoshii Length = 378 Back     alignment and structure 
Iteration: 1

 Score =  104 bits (259), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 91/348 (26%), Positives = 146/348 (41%), Gaps = 37/348 (10%)
Query: 1   MCGCGIRSLRYLAEAKADFVMAND-GNDAH----RRVILGNLKSIERGSGD-----EKRW 50
           +   GIR +R+  E  A+ V  ND   DA+    R V+L     +    G      EK  
Sbjct: 55  LSATGIRGIRFALETPAEEVWLNDISEDAYELMKRNVMLNFDGELRESKGRAILKGEKTI 114
Query: 51  VVTHFDANRVLSECYLKREXXXXXXXXXXXXXXXXXRTVFNAVKRDGLLYLTSTDGYSSG 110
           V+ H DANR+++E   +                    T   + KR G+L +T+TDG    
Sbjct: 115 VINHDDANRLMAE---RHRYFHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATDGAPLC 171
Query: 111 GHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRV 170
           G  P   L  Y A  L     +E+G R+L+G   R A+     +  + +YY  H   FR 
Sbjct: 172 GAHPRACLRKYLAVPLRGELCHEVGTRILVGVIARYAAKYDLGIDVILAYYKDH--YFRA 229
Query: 171 MLRVH---RKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPL 227
            +++    RK        G+I + +  G        EL Q   P             GP+
Sbjct: 230 FVKLKDGARKGDETLEKLGYIYFDDKTGKF------ELEQGFLPTRPN-------AYGPV 276
Query: 228 WTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASR 287
           W GPL D   ++KM+  AE            L K++ + +D     +P  Y     +  R
Sbjct: 277 WLGPLKDEKIVSKMVKEAESLSLARKKQALKLLKMIDQELD-----IPLFY-DTHAIGRR 330
Query: 288 AKMNSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKEL 335
            K+ +  ++ ++SA++++GY A+R+H +   IKT+ P    I   K +
Sbjct: 331 LKIETKKVEEIISALREQGYEATRTHFSPTGIKTSAPYEVFIETIKRI 378
>pdb|3AXS|A Chain A, Complex Structure Of Trna Methyltransferase Trm1 From Aquifex Aeolicus With Sinefungin Length = 392 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 6e-76
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 4e-68
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Length = 378 Back     alignment and structure
 Score =  237 bits (605), Expect = 6e-76
 Identities = 91/348 (26%), Positives = 147/348 (42%), Gaps = 37/348 (10%)

Query: 1   MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLK----------SIERGSGDEKRW 50
           +   GIR +R+  E  A+ V  ND ++    ++  N+                   EK  
Sbjct: 55  LSATGIRGIRFALETPAEEVWLNDISEDAYELMKRNVMLNFDGELRESKGRAILKGEKTI 114

Query: 51  VVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSG 110
           V+ H DANR       +  +F  ID+D FGS   FL T   + KR G+L +T+TDG    
Sbjct: 115 VINHDDANR---LMAERHRYFHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATDGAPLC 171

Query: 111 GHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRV 170
           G  P   L  Y A  L     +E+G R+L+G   R A+     +  + +YY  H   FR 
Sbjct: 172 GAHPRACLRKYLAVPLRGELCHEVGTRILVGVIARYAAKYDLGIDVILAYYKDH--YFRA 229

Query: 171 MLRVHRKALPDNR---HYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPL 227
            +++   A   +      G+I + +  G  +            P       +     GP+
Sbjct: 230 FVKLKDGARKGDETLEKLGYIYFDDKTGKFELEQGF------LP-------TRPNAYGPV 276

Query: 228 WTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASR 287
           W GPL D   ++KM+  AE              KLL  +  E D  L   +     +  R
Sbjct: 277 WLGPLKDEKIVSKMVKEAESLSLA---RKKQALKLLKMIDQELDIPL---FYDTHAIGRR 330

Query: 288 AKMNSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAKEL 335
            K+ +  ++ ++SA++++GY A+R+H +   IKT+ P    I   K +
Sbjct: 331 LKIETKKVEEIISALREQGYEATRTHFSPTGIKTSAPYEVFIETIKRI 378
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Length = 392 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 100.0
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 100.0
3k6r_A278 Putative transferase PH0793; structural genomics, 99.59
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.58
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.55
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.54
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.49
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.47
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.46
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.4
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.31
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.24
2oo3_A283 Protein involved in catabolism of external DNA; st 99.2
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.19
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.16
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.16
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.13
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.09
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.08
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.03
3lpm_A259 Putative methyltransferase; structural genomics, p 99.02
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.97
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.92
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.89
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.89
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.88
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.87
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.86
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.85
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.84
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.84
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.82
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.81
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.8
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.8
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.8
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.79
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.79
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.77
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.77
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.76
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.75
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.75
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.74
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.74
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.73
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.73
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.73
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.72
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.72
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.72
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.7
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.7
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.7
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.68
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.68
2pt6_A321 Spermidine synthase; transferase, structural genom 98.68
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.67
2o07_A304 Spermidine synthase; structural genomics, structur 98.66
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.64
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.64
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.64
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.63
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.63
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.61
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.6
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.6
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.59
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.58
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.58
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.58
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.57
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.56
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.56
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.54
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.54
2i7c_A283 Spermidine synthase; transferase, structural genom 98.54
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.54
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.53
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 98.53
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.52
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.52
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.52
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.51
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.51
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.5
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.5
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.49
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.49
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.49
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.49
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.46
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.44
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.44
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.44
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.43
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.42
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.42
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 98.41
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.4
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.4
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.38
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.37
2h00_A254 Methyltransferase 10 domain containing protein; st 98.36
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.35
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.33
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.32
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.31
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.31
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.3
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.28
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 98.28
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 98.27
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.27
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.25
3f4k_A257 Putative methyltransferase; structural genomics, P 98.25
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.24
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.24
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 98.23
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.23
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.23
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.22
2fyt_A340 Protein arginine N-methyltransferase 3; structural 98.22
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.21
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.21
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.2
2b25_A336 Hypothetical protein; structural genomics, methyl 98.19
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.18
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 98.18
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.17
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.17
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.17
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.14
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.14
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.13
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 98.1
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 98.08
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.07
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.07
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.07
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.06
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.05
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.04
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.04
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.04
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.04
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.03
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.01
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 97.99
1ne2_A200 Hypothetical protein TA1320; structural genomics, 97.99
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 97.98
1xxl_A239 YCGJ protein; structural genomics, protein structu 97.96
2kw5_A202 SLR1183 protein; structural genomics, northeast st 97.96
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 97.95
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 97.95
3gu3_A284 Methyltransferase; alpha-beta protein, structural 97.94
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.94
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.94
3ocj_A305 Putative exported protein; structural genomics, PS 97.94
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 97.93
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 97.92
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.92
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 97.91
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 97.9
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 97.9
1vl5_A260 Unknown conserved protein BH2331; putative methylt 97.9
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 97.89
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 97.89
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 97.88
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 97.87
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.86
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 97.86
3lcc_A235 Putative methyl chloride transferase; halide methy 97.86
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.86
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.85
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 97.85
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 97.83
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 97.81
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.79
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 97.77
3i9f_A170 Putative type 11 methyltransferase; structural gen 97.77
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 97.76
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 97.75
3lkd_A542 Type I restriction-modification system methyltrans 97.75
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 97.72
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.7
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 97.66
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 97.66
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 97.66
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.65
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 97.64
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.64
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 97.63
3khk_A544 Type I restriction-modification system methylation 97.62
3dtn_A234 Putative methyltransferase MM_2633; structural gen 97.61
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 97.61
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 97.61
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 97.61
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 97.6
2p7i_A250 Hypothetical protein; putative methyltransferase, 97.59
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 97.58
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.58
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 97.58
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 97.55
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.55
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.55
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.55
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 97.52
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 97.52
3hnr_A220 Probable methyltransferase BT9727_4108; structural 97.49
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.47
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 97.45
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 97.43
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 97.43
3m33_A226 Uncharacterized protein; structural genomics, PSI- 97.41
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 97.4
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.4
2i62_A265 Nicotinamide N-methyltransferase; structural genom 97.39
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 97.38
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 97.37
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 97.36
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 97.35
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 97.31
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 97.31
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 97.28
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.27
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.2
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 97.19
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.17
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.16
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 97.13
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 97.08
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.08
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 97.08
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.05
3g7u_A376 Cytosine-specific methyltransferase; DNA-binding, 97.03
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 96.98
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 96.96
3cc8_A230 Putative methyltransferase; structural genomics, j 96.94
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 96.94
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 96.93
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 96.92
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 96.9
1g55_A343 DNA cytosine methyltransferase DNMT2; human DNA me 96.88
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.87
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 96.84
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 96.77
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 96.77
3dp7_A363 SAM-dependent methyltransferase; structural genomi 96.76
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 96.76
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 96.75
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 96.72
4hg2_A257 Methyltransferase type 11; structural genomics, PS 96.71
3ege_A261 Putative methyltransferase from antibiotic biosyn 96.7
1vlm_A219 SAM-dependent methyltransferase; possible histamin 96.55
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 96.53
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 96.52
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 96.46
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 96.4
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 96.39
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 96.38
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 96.36
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 96.34
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 96.29
3ufb_A530 Type I restriction-modification system methyltran 96.25
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 96.23
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 96.18
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 96.14
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 96.05
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 95.79
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 95.71
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 95.71
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 95.58
3sso_A419 Methyltransferase; macrolide, natural product, ros 95.54
2zig_A297 TTHA0409, putative modification methylase; methylt 95.43
3fut_A271 Dimethyladenosine transferase; methyltransferase, 95.42
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 95.42
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 95.28
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.7
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 94.54
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 94.53
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 94.36
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 94.32
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 94.26
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 94.24
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 94.19
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 94.16
3fbg_A346 Putative arginate lyase; structural genomics, unkn 94.13
4h0n_A333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 94.1
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.01
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 93.96
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 93.94
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.83
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 93.8
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 93.8
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 93.76
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 93.72
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 93.67
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 93.49
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 93.07
3qv2_A327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 93.07
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 93.03
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 92.97
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 92.96
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 92.96
3me5_A482 Cytosine-specific methyltransferase; structural ge 92.93
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 92.9
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 92.88
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 92.87
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 92.84
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 92.79
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 92.54
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 92.49
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 92.44
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 92.1
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 91.88
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 91.7
4eye_A342 Probable oxidoreductase; structural genomics, niai 91.65
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 91.42
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 91.39
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 91.3
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 91.27
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 91.19
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 91.18
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 90.94
3giw_A277 Protein of unknown function DUF574; rossmann-fold 90.9
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 90.48
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 90.34
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 89.81
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 89.74
3gms_A340 Putative NADPH:quinone reductase; structural genom 89.66
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 89.61
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 89.08
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 89.07
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 88.85
3heb_A152 Response regulator receiver domain protein (CHEY); 88.83
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 88.81
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 88.61
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 88.29
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 88.08
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 88.0
3jte_A143 Response regulator receiver protein; structural ge 87.55
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 87.44
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 87.27
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 87.19
3h5i_A140 Response regulator/sensory box protein/ggdef domai 86.72
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 86.69
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 86.64
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 86.38
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 85.92
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 85.67
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 85.66
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 85.55
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 85.27
3cg4_A142 Response regulator receiver domain protein (CHEY-; 85.24
3ubt_Y331 Modification methylase HAEIII; protein-DNA complex 85.19
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 85.16
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 85.07
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 84.71
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 84.44
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 84.34
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 83.98
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 83.82
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 83.59
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 83.53
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 83.51
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 83.05
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 82.98
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 82.82
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 82.34
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 82.04
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 81.75
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 81.63
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 81.57
2qxy_A142 Response regulator; regulation of transcription, N 81.16
3rqi_A184 Response regulator protein; structural genomics, s 80.76
3cg0_A140 Response regulator receiver modulated diguanylate 80.74
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 80.63
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 80.56
3eul_A152 Possible nitrate/nitrite response transcriptional 80.51
1ys7_A233 Transcriptional regulatory protein PRRA; response 80.5
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 80.44
3i42_A127 Response regulator receiver domain protein (CHEY- 80.36
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
Probab=100.00  E-value=7.8e-78  Score=593.22  Aligned_cols=315  Identities=25%  Similarity=0.439  Sum_probs=286.3

Q ss_pred             CccccHhHHHHhhh-CCCCEEEEeeCCHHHHHHHHHHHHHcCCCCCCCcc-EEEEeccHHHHHH-HhhhcCCcccEEEeC
Q 019408            1 MCGCGIRSLRYLAE-AKADFVMANDGNDAHRRVILGNLKSIERGSGDEKR-WVVTHFDANRVLS-ECYLKREFFDLIDID   77 (341)
Q Consensus         1 fagsG~rgir~a~e-~ga~~V~~~Dis~~A~~~i~~N~~~n~~~~~~~~~-~~v~~~DA~~~l~-~~~~~~~~fDvIdlD   77 (341)
                      |||||++||++|++ +||.+|++||+|+.|++.+++|+++|+++    ++ ++++++||+++|. ..   +++||+|++|
T Consensus        60 faGtG~~sl~aa~~~~ga~~V~avDi~~~av~~~~~N~~~Ngl~----~~~v~v~~~Da~~~l~~~~---~~~fD~V~lD  132 (392)
T 3axs_A           60 LSASGIRAIRFLLETSCVEKAYANDISSKAIEIMKENFKLNNIP----EDRYEIHGMEANFFLRKEW---GFGFDYVDLD  132 (392)
T ss_dssp             SCTTSHHHHHHHHHCSCEEEEEEECSCHHHHHHHHHHHHHTTCC----GGGEEEECSCHHHHHHSCC---SSCEEEEEEC
T ss_pred             CCcccHHHHHHHHhCCCCCEEEEEECCHHHHHHHHHHHHHhCCC----CceEEEEeCCHHHHHHHhh---CCCCcEEEEC
Confidence            79999999999997 57899999999999999999999999985    45 8999999999987 54   3579999999


Q ss_pred             CCCCCHHHHHHHHHhcccCCEEEEEecCCCCCCCCCchhHHhhhccccCCCCCchhhhHHHHHHHHHHHHHhcCCcEEEE
Q 019408           78 SFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPL  157 (341)
Q Consensus        78 Pygsp~~fld~al~~v~~gGlL~vt~TD~~~l~g~~~~~~~r~Yg~~~~~~~~~~E~~lR~ll~~i~~~Aa~~~~~i~Pl  157 (341)
                      |||++.+|++.|+++|++||+|++|+||+++|||+.+..++|+||..|.+.+++||.++|++|..++++|+++++.|+|+
T Consensus       133 P~g~~~~~l~~a~~~Lk~gGll~~t~t~~~~l~g~~~~~~~rkYg~~p~r~~~~~e~~~r~~L~~~~~~a~~~~~~i~P~  212 (392)
T 3axs_A          133 PFGTPVPFIESVALSMKRGGILSLTATDTAPLSGTYPKTCMRRYMARPLRNEFKHEVGIRILIKKVIELAAQYDIAMIPI  212 (392)
T ss_dssp             CSSCCHHHHHHHHHHEEEEEEEEEEECCHHHHTTSSHHHHHHHHSSBCCCSTTHHHHHHHHHHHHHHHHHHTTTEEEEEE
T ss_pred             CCcCHHHHHHHHHHHhCCCCEEEEEecchhhhccccHHHHHHHhCCcccccccccchhHHHHHHHHHHhcccCCCeEEee
Confidence            99998899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecccCCCCeEEEEEEEEeCccc---ccccceeEEEcCCCCCcccccccccCCCCC-CCCCCCCCCcceeeccccccCCC
Q 019408          158 FSYYSYHGPVFRVMLRVHRKALP---DNRHYGFISYCNHCGNSQAYSWEELGQMSC-PCSNTIGSSSLVVSGPLWTGPLH  233 (341)
Q Consensus       158 ~s~~~~~dhy~Rv~vrv~~~~~~---~~~~~g~v~~C~~C~~~~~~~~~~~~~~~C-~c~~~~~~~~~~~~GPlW~G~lh  233 (341)
                      ++++  .|||+||||||.+|+.+   +.+++||++||++|++++.+.........| .|++     +++++||||+||||
T Consensus       213 l~~~--~~~y~Rv~vrv~~~~~~~~~~~~~~g~v~~C~~C~~~~~~~~~~~~~~~C~~cg~-----~~~~~GPlW~g~l~  285 (392)
T 3axs_A          213 FAYS--HLHYFKLFFVKERGVEKVDKLIEQFGYIQYCFNCMNREVVTDLYKFKEKCPHCGS-----KFHIGGPLWIGKLW  285 (392)
T ss_dssp             EEEE--ETTEEEEEEEEEECHHHHHHHHTTEEEEEECTTTCCEEEECCGGGCCSBCTTTCS-----BCEEEEEEECSCSC
T ss_pred             EEEE--eCcEEEEEEEEecCHHHHHHHHHhcceEEECCCCCCeEeecCCCCCCCcCCCCCC-----ccceecccccCcCC
Confidence            9999  99999999999999876   467899999999999998743111123567 4655     99999999999999


Q ss_pred             CHHHHHHHHHHHHhcCCCCCCChhhHHHHHHHhhcccCCCCCCc-ceehhHHHhhcCCCCC-CHHHHHHHHHHCCCEEee
Q 019408          234 DATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFG-YIKLDEMASRAKMNSP-SLKTMMSAVQKEGYVASR  311 (341)
Q Consensus       234 d~~fv~~~l~~~~~~~~~~~~~~~~~~~ll~~~~~e~~~~~pp~-yy~~~~l~~~~k~~~p-~~~~~~~~L~~~Gy~as~  311 (341)
                      |++||++|++.+++..|.+    .++.+||+.+.+|.  +.|++ ||++|+||+++|+++| |+++++     +||+|||
T Consensus       286 d~~fv~~~l~~~~~~~~~~----~~~~~lL~~~~~E~--~~p~~~~y~~~~l~~~~~~~~p~~~~~~~-----~Gy~~s~  354 (392)
T 3axs_A          286 DEEFTNFLYEEAQKREEIE----KETKRILKLIKEES--QLQTVGFYVLSKLAEKVKLPAQPPIRIAV-----KFFNGVR  354 (392)
T ss_dssp             CHHHHHHHHHHHHTCTTSC----HHHHHHHHHHHHHH--TSCCSSCEEHHHHHHHHTCSCCCCHHHHH-----HHTTCEE
T ss_pred             CHHHHHHHHHHhhhcccch----HHHHHHHHHHHHHh--cCCccceEcHHHHHHHcCCCCCCCHHHHh-----cCcEEEe
Confidence            9999999999998776643    57999999999885  45522 9999999999999999 999988     9999999


Q ss_pred             eecCCCceecCCCHHHHHHHHHhhhhhcc
Q 019408          312 SHIASNAIKTNCPMVACIRIAKELQGCQK  340 (341)
Q Consensus       312 tH~~~~~iKTdAp~~~i~~i~~~~~~~~~  340 (341)
                      ||++|+|||||||+++||+|+++|...|+
T Consensus       355 tH~~p~~iKTdAp~~~i~~i~~~~~~~~~  383 (392)
T 3axs_A          355 THFVGDGFRTNLSFEEVMKKMEELKEKQK  383 (392)
T ss_dssp             CTTSTTEEECSSCHHHHHHHHHHHHHHHH
T ss_pred             eccCCCcEeccCCHHHHHHHHHHHHHhch
Confidence            99999999999999999999999987665
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 341
d2dula1375 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tR 9e-86
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Length = 375 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: TRM1-like
domain: N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1
species: Pyrococcus horikoshii [TaxId: 53953]

 Score =  261 bits (668), Expect = 9e-86
 Identities = 92/343 (26%), Positives = 146/343 (42%), Gaps = 31/343 (9%)

Query: 1   MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLK----------SIERGSGDEKRW 50
           +   GIR +R+  E  A+ V  ND ++    ++  N+                   EK  
Sbjct: 53  LSATGIRGIRFALETPAEEVWLNDISEDAYELMKRNVMLNFDGELRESKGRAILKGEKTI 112

Query: 51  VVTHFDANRVLSECYLKREFFDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSG 110
           V+ H DANR+      +  +F  ID+D FGS   FL T   + KR G+L +T+TDG    
Sbjct: 113 VINHDDANRL---MAERHRYFHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATDGAPLC 169

Query: 111 GHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQGYHVSPLFSYYSYHGPVFRV 170
           G  P   L  Y A  L     +E+G R+L+G   R A+     +  + +YY  H   FR 
Sbjct: 170 GAHPRACLRKYLAVPLRGELCHEVGTRILVGVIARYAAKYDLGIDVILAYYKDH--YFRA 227

Query: 171 MLRVHRKALPDNRHYGFISYCNHCGNSQAYSWEELGQMSCPCSNTIGSSSLVVSGPLWTG 230
            +++   A   +     + Y      +  +   EL Q   P             GP+W G
Sbjct: 228 FVKLKDGARKGDETLEKLGYIYFDDKTGKF---ELEQGFLPT-------RPNAYGPVWLG 277

Query: 231 PLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKM 290
           PL D   ++KM+  AE              KLL  +  E D   P  +     +  R K+
Sbjct: 278 PLKDEKIVSKMVKEAESLSL---ARKKQALKLLKMIDQELDI--PL-FYDTHAIGRRLKI 331

Query: 291 NSPSLKTMMSAVQKEGYVASRSHIASNAIKTNCPMVACIRIAK 333
            +  ++ ++SA++++GY A+R+H +   IKT+ P    I   K
Sbjct: 332 ETKKVEEIISALREQGYEATRTHFSPTGIKTSAPYEVFIETIK 374

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 100.0
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.77
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.75
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.73
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.73
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.7
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.68
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.68
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.62
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.59
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.54
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.07
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.02
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.84
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.77
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.73
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.73
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.72
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.44
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.44
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.42
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.41
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.4
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.4
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.33
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.33
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.32
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.29
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.27
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.26
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.26
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.24
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.21
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.21
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.21
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.19
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.18
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.17
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.16
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.13
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.1
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.09
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.07
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.05
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.0
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 97.96
d2h00a1250 Methyltransferase 10 domain containing protein MET 97.95
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.94
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.92
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.91
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.91
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.89
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.89
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 97.79
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.74
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 97.68
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 97.63
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.62
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.58
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 97.5
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 97.48
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.48
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.47
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.47
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.4
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.39
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.38
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.38
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.3
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 97.28
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 97.28
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 97.26
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.16
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.14
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.03
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.0
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 96.73
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 96.66
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 96.65
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 96.65
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.62
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.6
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.39
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 96.29
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 96.15
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 96.14
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 96.11
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.03
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 95.95
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.55
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 95.52
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 95.49
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.38
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 95.2
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.13
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.05
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.85
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.83
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.72
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 94.59
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 94.58
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 94.52
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 94.47
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.29
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 94.28
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.21
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 94.0
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 93.8
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 93.77
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.74
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 93.43
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.43
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 93.02
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 92.91
d2oo3a1271 Uncharacterized protein LPG1296 {Legionella pneumo 92.24
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.18
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 92.16
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.94
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 91.62
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 91.02
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.64
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 90.28
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 90.24
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 90.1
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 88.99
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 88.92
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 88.75
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 88.54
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 88.45
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 88.22
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 87.84
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 87.2
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 87.04
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 86.44
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 86.26
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 86.13
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 86.01
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 85.99
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 85.89
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 85.88
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 85.82
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 85.65
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 85.55
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 85.47
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 85.46
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 85.22
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 85.17
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 85.13
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 84.48
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 84.11
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 83.83
d1k68a_140 Response regulator for cyanobacterial phytochrome 83.81
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 83.43
d1qkka_140 Transcriptional regulatory protein DctD, receiver 83.32
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 83.18
d1yioa2128 Response regulatory protein StyR, N-terminal domai 82.8
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 82.52
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 82.51
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 82.46
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 82.22
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 82.07
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 82.02
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 81.92
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 81.44
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 81.06
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: TRM1-like
domain: N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=100.00  E-value=4.2e-91  Score=681.62  Aligned_cols=309  Identities=29%  Similarity=0.452  Sum_probs=285.0

Q ss_pred             CccccHhHHHHhhhCCCCEEEEeeCCHHHHHHHHHHHHHcCCCCC----------CCccEEEEeccHHHHHHHhhhcCCc
Q 019408            1 MCGCGIRSLRYLAEAKADFVMANDGNDAHRRVILGNLKSIERGSG----------DEKRWVVTHFDANRVLSECYLKREF   70 (341)
Q Consensus         1 fagsG~rgir~a~e~ga~~V~~~Dis~~A~~~i~~N~~~n~~~~~----------~~~~~~v~~~DA~~~l~~~~~~~~~   70 (341)
                      |||||+||||||+|.|+++|++||+|+.|+++|++|+++|++...          ....+.+.+.||+.+|...   +++
T Consensus        53 ~sasG~rsiRya~E~~~~~V~~nDis~~A~~~i~~N~~lN~~~~~~~~~~~~~~~~~~~~~~~~~Da~~~~~~~---~~~  129 (375)
T d2dula1          53 LSATGIRGIRFALETPAEEVWLNDISEDAYELMKRNVMLNFDGELRESKGRAILKGEKTIVINHDDANRLMAER---HRY  129 (375)
T ss_dssp             SCTTSHHHHHHHHHSSCSEEEEEESCHHHHHHHHHHHHHHCCSCCEECSSEEEEESSSEEEEEESCHHHHHHHS---TTC
T ss_pred             CCCccHHHHHHHHhCCCCEEEEecCCHHHHHHHHHHHHhcCccccccccccccccccceeEeehhhhhhhhHhh---cCc
Confidence            799999999999999999999999999999999999999986310          0134678999999999763   568


Q ss_pred             ccEEEeCCCCCCHHHHHHHHHhcccCCEEEEEecCCCCCCCCCchhHHhhhccccCCCCCchhhhHHHHHHHHHHHHHhc
Q 019408           71 FDLIDIDSFGSDSSFLRTVFNAVKRDGLLYLTSTDGYSSGGHRPNNSLASYGAYILPMPYSNEIGLRMLIGGAVREASAQ  150 (341)
Q Consensus        71 fDvIdlDPygsp~~fld~al~~v~~gGlL~vt~TD~~~l~g~~~~~~~r~Yg~~~~~~~~~~E~~lR~ll~~i~~~Aa~~  150 (341)
                      ||+|||||||+|+||+|+|++++++||+|+||+||+++|||++|++|+||||+++.+++|+||+|+|+||+.|+|+|++|
T Consensus       130 fDvIDiDPfGs~~pfldsAi~a~~~~Gll~vTaTD~a~L~G~~~~~~~r~Yg~~~~~~~~~~E~glRill~~i~r~Aa~~  209 (375)
T d2dula1         130 FHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATDGAPLCGAHPRACLRKYLAVPLRGELCHEVGTRILVGVIARYAAKY  209 (375)
T ss_dssp             EEEEEECCSSCCHHHHHHHHHHEEEEEEEEEEECCHHHHTTSSHHHHHHHHSSBCCCSTTHHHHHHHHHHHHHHHHHHTT
T ss_pred             CCcccCCCCCCcHHHHHHHHHHhccCCEEEEEecCchhhcCCCcHHHHHHhCCeecCCcccchHHHHHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcEEEEEecccCCCCeEEEEEEEEeCccc---ccccceeEEEcCCCCCcccccccccCCCCC-CCCCCCCCCcceeecc
Q 019408          151 GYHVSPLFSYYSYHGPVFRVMLRVHRKALP---DNRHYGFISYCNHCGNSQAYSWEELGQMSC-PCSNTIGSSSLVVSGP  226 (341)
Q Consensus       151 ~~~i~Pl~s~~~~~dhy~Rv~vrv~~~~~~---~~~~~g~v~~C~~C~~~~~~~~~~~~~~~C-~c~~~~~~~~~~~~GP  226 (341)
                      +++|+||+|++  .|||+||||||.+|+..   ..+++||++||.+|++++++         | .|+.     +++++||
T Consensus       210 ~~~i~PllS~~--~~~y~Rv~vrv~~~~~~~~~~~~~~g~~~~C~~c~~~~~~---------~~~~~~-----~~~~~GP  273 (375)
T d2dula1         210 DLGIDVILAYY--KDHYFRAFVKLKDGARKGDETLEKLGYIYFDDKTGKFELE---------QGFLPT-----RPNAYGP  273 (375)
T ss_dssp             TEEEEEEEEEE--ETTEEEEEEEEEESHHHHHHHHTTEEEEEECTTTCCEEEE---------ESSSCC-----SSSCEEE
T ss_pred             CCeeEEEEEEE--ecceEEEEEEEecChHHHHHHHHhcCcEEEcCCCCCEEEe---------cCCCCC-----CCCCcCC
Confidence            99999999999  99999999999999865   56789999999999999862         4 5665     7889999


Q ss_pred             ccccCCCCHHHHHHHHHHHHhcCCCCCCChhhHHHHHHHhhcccCCCCCCcceehhHHHhhcCCCCCCHHHHHHHHHHCC
Q 019408          227 LWTGPLHDATHITKMLNLAEKWGWVGDGTGTDLEKLLSRMIDESDPRLPFGYIKLDEMASRAKMNSPSLKTMMSAVQKEG  306 (341)
Q Consensus       227 lW~G~lhd~~fv~~~l~~~~~~~~~~~~~~~~~~~ll~~~~~e~~~~~pp~yy~~~~l~~~~k~~~p~~~~~~~~L~~~G  306 (341)
                      ||+|||||++|+++|++++++..|.   +..++.++|+.+.+|  .+ +|+||++++||+++|+++||++.++++|+++|
T Consensus       274 lW~G~L~d~efl~~~~~~~~~~~~~---~~~~~~~ll~~i~eE--~~-~P~~y~l~~la~~lk~~~P~~~~~~~aL~~~G  347 (375)
T d2dula1         274 VWLGPLKDEKIVSKMVKEAESLSLA---RKKQALKLLKMIDQE--LD-IPLFYDTHAIGRRLKIETKKVEEIISALREQG  347 (375)
T ss_dssp             EECSCSBCHHHHHHHHHHHHTSCCT---THHHHHHHHHHHHHS--CC-SSCCEEHHHHHHHHTCCBCCHHHHHHHHHHTT
T ss_pred             CccCcccCHHHHHHHHHHhhccCcc---hhhHHHHHHHHHHhc--cC-CCeEEcHHHHHHHcCCCCCCHHHHHHHHHHCC
Confidence            9999999999999999999988774   445789999999987  43 46899999999999999999999999999999


Q ss_pred             CEEeeeecCCCceecCCCHHHHHHHHHh
Q 019408          307 YVASRSHIASNAIKTNCPMVACIRIAKE  334 (341)
Q Consensus       307 y~as~tH~~~~~iKTdAp~~~i~~i~~~  334 (341)
                      |+||||||+|+|||||||+++||+|||.
T Consensus       348 y~asrtH~~p~~iKTdAp~~~i~~i~r~  375 (375)
T d2dula1         348 YEATRTHFSPTGIKTSAPYEVFIETIKR  375 (375)
T ss_dssp             CCEEEETTEEEEEEESSCHHHHHHHHBC
T ss_pred             CEEEecCCCCCCEecCCCHHHHHHHHhC
Confidence            9999999999999999999999999983
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure