Citrus Sinensis ID: 020005

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MFDRSLTVSVNTLNYPSCTLGFVNSYRTLSRTRLNSNPLLAMPPSSVLLQTDESGKFQESKKSFGSKAAPFCSDALLNQANTVGIVGGASVDSTLNLLGKLVQLSGEENDFPFLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQDLLPPDDPLLKKCIDPMDALARSTIKWVKSAEKGT
cccccHHHHHHHccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHcccccccccHHHHHHHHHHHHcccccccccccEEEEEEcHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHccccc
ccccccEEEEEccccccccccccccccEEHHHHHccccEEEccccEEEEEEccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEcccccccEEEEEEcHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccEEEEEccHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEcccHHHHEcccccccccccccHHHHHHHHHHHHHHcccccc
mfdrsltvsvntlnypsctlgfvnSYRTLSrtrlnsnpllamppssvllqtdesgkfqeskksfgskaapfcsdALLNQANTVGIVGGASVDSTLNLLGKLVQlsgeendfpfllcsdpllnkellshdrssfsslnckgggvqlddsliVENLRRKRVFLEKAGarcivmpchlshiwhdevckgcsvpflhVSECVAKELKeanmkpleagsplriGVLAKNAILTAGFYQEKlqhegfevvlpdkatmehtLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILasddmqdllppddpllkkcidpMDALARSTIKWVKSAEKGT
mfdrsltvsvntlnypsctlGFVNSYRTLSRTRLNSNPLLAMPPSSVLLQTDESGKFQESKKSFGSKAAPFCSDALLNQANTVGIVGGASVDSTLNLLGKLVQLSGEENDFPFLLCSDPLLNKELLSHDRSSfsslnckgggvqlddsliveNLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVIlasddmqdllPPDDPLLKKCIDPMDALARSTIkwvksaekgt
MFDRSLTVSVNTLNYPSCTLGFVNSYRTLSRTRLNSNPLLAMPPSSVLLQTDESGKFQESKKSFGSKAAPFCSDALLNQANTVGIVGGASVDSTLNLLGKLVQLSGEENDFPFLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQdllppddpllKKCIDPMDALARSTIKWVKSAEKGT
******TVSVNTLNYPSCTLGFVNSYRTLSR**************************************PFCSDALLNQANTVGIVGGASVDSTLNLLGKLVQLSGEENDFPFLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQDLLPPDDPLLKKCIDPMDALARSTIKWV*******
********SVNTLNYPSCTLGFVNSYRTLS**********AMPPSSVLL*******************************NTVGIVGGASVDSTLNLLGKLVQLSGEENDFPFLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQDLLPPDDPLLKKCIDPMDALARSTIKW*KSA****
********SVNTLNYPSCTLGFVNSYRTLSRTRLNSNPLLAMPPSSVLLQTD**************KAAPFCSDALLNQANTVGIVGGASVDSTLNLLGKLVQLSGEENDFPFLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQDLLPPDDPLLKKCIDPMDALARSTIKWVKSAEKGT
*FDRSLTVSVNTLNYPSCTLGFVNSYRTLSRTRLNSNPLLAMPPSSVLLQTDES*K*****************DALLNQANTVGIVGGASVDSTLNLLGKLVQLSGEENDFPFLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQDLLPPDDPLLKKCIDPMDALARSTIKWVKSA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDRSLTVSVNTLNYPSCTLGFVNSYRTLSRTRLNSNPLLAMPPSSVLLQTDESGKFQESKKSFGSKAAPFCSDALLNQANTVGIVGGASVDSTLNLLGKLVQLSGEENDFPFLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQDLLPPDDPLLKKCIDPMDALARSTIKWVKSAEKGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query332 2.2.26 [Sep-21-2011]
P32960227 Probable amino-acid racem yes no 0.412 0.603 0.252 9e-08
P29079243 Aspartate racemase OS=Ent yes no 0.231 0.316 0.285 2e-05
H8L901243 Aspartate racemase OS=Ent N/A no 0.231 0.316 0.285 3e-05
P32968150 Uncharacterized protein i N/A no 0.406 0.9 0.234 4e-05
>sp|P32960|RACX_BACSU Probable amino-acid racemase OS=Bacillus subtilis (strain 168) GN=racX PE=2 SV=2 Back     alignment and function desciption
 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 75/174 (43%), Gaps = 37/174 (21%)

Query: 83  VGIVGGASVDSTLNLLGKLV----QLSGEEND--FPFLL---CSDPLLNKELLSHDRSSF 133
           +GI+ G    ST   + K++    +L G  ND  +P ++   C  P      + HD    
Sbjct: 2   IGILAGMGPKSTSPFIDKVIDYCQKLYGASNDIDYPHMMIYSCPTPFYADRPIDHDEMKK 61

Query: 134 SSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLH 193
           + ++   G V+L                EK G   I +PC+ +H++++E+ +  SVP LH
Sbjct: 62  AIID---GAVKL----------------EKTGVDFIALPCNTAHVYYEEIQQALSVPMLH 102

Query: 194 VSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPD 247
           + E   KE+     K +         VL     + +  YQ+ L+  G EV+  D
Sbjct: 103 IVEETIKEIPHPAKKAV---------VLGTEPTIQSAIYQKVLKGNGQEVIHKD 147
Probable aspartate or glutamate racemase involved in peptidoglycan modification during cortex synthesis.
Bacillus subtilis (strain 168) (taxid: 224308)
EC: 5EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|P29079|RACD_ENTFC Aspartate racemase OS=Enterococcus faecium PE=1 SV=1 Back     alignment and function description
>sp|H8L901|RACD_ENTFU Aspartate racemase OS=Enterococcus faecium (strain Aus0004) GN=EFAU004_01689 PE=1 SV=1 Back     alignment and function description
>sp|P32968|YPNL_PECCC Uncharacterized protein in pnlA 3'region (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
147819141330 hypothetical protein VITISV_015733 [Viti 0.978 0.984 0.683 1e-126
255553111330 racemase and epimerase, acting on amino 0.987 0.993 0.700 1e-124
224070839330 predicted protein [Populus trichocarpa] 0.987 0.993 0.679 1e-123
225442873305 PREDICTED: uncharacterized protein LOC10 0.888 0.967 0.716 1e-120
449469004327 PREDICTED: uncharacterized protein LOC10 0.945 0.960 0.636 1e-112
357455147318 Aspartate racemase [Medicago truncatula] 0.915 0.955 0.640 1e-106
87162592321 Asp/Glu racemase [Medicago truncatula] 0.915 0.947 0.640 1e-106
297743412 443 unnamed protein product [Vitis vinifera] 0.768 0.575 0.727 1e-106
356557255363 PREDICTED: probable amino-acid racemase- 0.960 0.878 0.641 1e-102
15218160330 aspartate-glutamate racemase-like protei 0.951 0.957 0.587 1e-102
>gi|147819141|emb|CAN68957.1| hypothetical protein VITISV_015733 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 227/332 (68%), Positives = 266/332 (80%), Gaps = 7/332 (2%)

Query: 6   LTVSVNTLNYPSCTLGFVNSYRTLSRTRLNSNPLLAMPPSSVLLQTDESGKFQESKKSFG 65
           + +S ++L YPS  +G V+ +  L RT    NP+LA+PPSS LLQTDESG   ESK S G
Sbjct: 1   MAMSFHSLKYPSHMMGNVHKHXILXRTM--KNPILAVPPSSTLLQTDESGNLPESKNSSG 58

Query: 66  SKAAPFCSDA---LLNQANTVGIVGGASVDSTLNLLGKLVQLSGEE--NDFPFLLCSDPL 120
           S AA   SD+    +NQA TVGI+GG SVDSTLN L KLVQ S ++  +  PF+LCSDP+
Sbjct: 59  SDAASTNSDSASLFINQATTVGIIGGVSVDSTLNFLKKLVQWSSKDGGDSLPFVLCSDPV 118

Query: 121 LNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWH 180
           LNK+LLSH+RS F  L+ K    ++D + IV NL+ KR FLE++G +CIVMPCH+SH WH
Sbjct: 119 LNKQLLSHERSHFPLLSTKRESSRMDHTPIVGNLQSKRAFLERSGVQCIVMPCHISHSWH 178

Query: 181 DEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEG 240
           DE+ +G SVPFLH+ ECVA+ELK A +KPLEAGSPLRIGVLA NA LTAGFYQEKLQ EG
Sbjct: 179 DEISRGXSVPFLHMGECVARELKNAKLKPLEAGSPLRIGVLATNATLTAGFYQEKLQREG 238

Query: 241 FEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQDLL 300
           FEVVLPDKATMEHT+IPA++ALNRKD+EGARNLLRIALQVLLVRAVNTVILASDDM DLL
Sbjct: 239 FEVVLPDKATMEHTVIPAIEALNRKDMEGARNLLRIALQVLLVRAVNTVILASDDMHDLL 298

Query: 301 PPDDPLLKKCIDPMDALARSTIKWVKSAEKGT 332
           P DDPLLKKC+DPMDALARSTI W +S EKGT
Sbjct: 299 PRDDPLLKKCVDPMDALARSTIHWAQSVEKGT 330

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255553111|ref|XP_002517598.1| racemase and epimerase, acting on amino acids and derivatives, putative [Ricinus communis] gi|223543230|gb|EEF44762.1| racemase and epimerase, acting on amino acids and derivatives, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224070839|ref|XP_002303258.1| predicted protein [Populus trichocarpa] gi|222840690|gb|EEE78237.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225442873|ref|XP_002281753.1| PREDICTED: uncharacterized protein LOC100249822 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469004|ref|XP_004152211.1| PREDICTED: uncharacterized protein LOC101217164 [Cucumis sativus] gi|449532820|ref|XP_004173376.1| PREDICTED: uncharacterized protein LOC101225587 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357455147|ref|XP_003597854.1| Aspartate racemase [Medicago truncatula] gi|355486902|gb|AES68105.1| Aspartate racemase [Medicago truncatula] Back     alignment and taxonomy information
>gi|87162592|gb|ABD28387.1| Asp/Glu racemase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297743412|emb|CBI36279.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356557255|ref|XP_003546933.1| PREDICTED: probable amino-acid racemase-like [Glycine max] Back     alignment and taxonomy information
>gi|15218160|ref|NP_172993.1| aspartate-glutamate racemase-like protein [Arabidopsis thaliana] gi|5103839|gb|AAD39669.1|AC007591_34 Is a member of the PF|01177 Aspartate-glutamate racemase family. EST gb|T43554 comes from this gene [Arabidopsis thaliana] gi|26983862|gb|AAN86183.1| unknown protein [Arabidopsis thaliana] gi|332191198|gb|AEE29319.1| aspartate-glutamate racemase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
TAIR|locus:2037743330 AT1G15410 [Arabidopsis thalian 0.939 0.945 0.569 2.8e-89
TIGR_CMR|SPO_2662485 SPO_2662 "aspartate racemase, 0.674 0.461 0.265 3.1e-09
UNIPROTKB|Q81Q00226 BAS2459 "Aspartate racemase fa 0.274 0.402 0.303 3.7e-07
TIGR_CMR|BA_2639226 BA_2639 "aspartate racemase fa 0.274 0.402 0.303 3.7e-07
TIGR_CMR|CJE_0080231 CJE_0080 "aspartate racemase, 0.439 0.632 0.278 2.9e-06
UNIPROTKB|Q5LLG5232 Q5LLG5 "Aspartate racemase" [R 0.644 0.922 0.252 2.7e-05
TIGR_CMR|SPO_A0062232 SPO_A0062 "aspartate racemase" 0.644 0.922 0.252 2.7e-05
UNIPROTKB|Q81KJ2224 BAS4650 "Aspartate racemase fa 0.418 0.620 0.238 5.4e-05
TIGR_CMR|BA_5005224 BA_5005 "aspartate racemase fa 0.418 0.620 0.238 5.4e-05
TAIR|locus:2037743 AT1G15410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 891 (318.7 bits), Expect = 2.8e-89, P = 2.8e-89
 Identities = 184/323 (56%), Positives = 233/323 (72%)

Query:    14 NYPSCTLGFV-NSYRTLSRTRLNSNPLLAMPPSSVLLQTDESGKFQESKKSF----GSKA 68
             N PS  L  +  S R   R RL+   +LAMPPSSVLL  DES    + KK F     S+ 
Sbjct:     7 NNPSHGLAHLCYSSRVSCRVRLSR--VLAMPPSSVLLHMDESNDLPKPKKGFCLSEDSRN 64

Query:    69 A--PFCSDALLNQANTVGIVGGASVDSTLNLLGKLVQLSGEE--NDFPFLLCSDPLLNKE 124
             +     +D+LL QANTVGI+GG S DSTL  + KLV  S  +  +  PF+LCSDP LNKE
Sbjct:    65 SLNSLPADSLLRQANTVGIIGGVSTDSTLKFVKKLVDWSSNDGKSSLPFVLCSDPALNKE 124

Query:   125 LLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVC 184
             LL ++ +S+ SL  +     +D  LIVENLR KR +LE+ GA+ I+MPCH++HIW++EVC
Sbjct:   125 LLLYEENSYPSLYHREESTPVDPKLIVENLRNKRRYLERCGAKLILMPCHIAHIWYEEVC 184

Query:   185 KGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVV 244
             +G  VP LH+ EC+AKEL+EA MKPLEAG+PLR+GV+A +A L+AGFYQEKLQ  GFE V
Sbjct:   185 EGSLVPLLHMGECIAKELQEAKMKPLEAGNPLRVGVMATSATLSAGFYQEKLQSNGFEAV 244

Query:   245 LPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQXXXXXXX 304
             LPDKATMEHT+IP+++A+ RKD+EGARNLLRIALQVLLV+AVN V+L SD+M+       
Sbjct:   245 LPDKATMEHTVIPSIEAMKRKDMEGARNLLRIALQVLLVQAVNVVMLGSDEMRDLLPGDD 304

Query:   305 XXXKKCIDPMDALARSTIKWVKS 327
                KKC+DPMDALARS IKW ++
Sbjct:   305 PLLKKCVDPMDALARSAIKWAEN 327
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016855 "racemase and epimerase activity, acting on amino acids and derivatives" evidence=IEA;ISS
TIGR_CMR|SPO_2662 SPO_2662 "aspartate racemase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q81Q00 BAS2459 "Aspartate racemase family protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2639 BA_2639 "aspartate racemase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0080 CJE_0080 "aspartate racemase, putative" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LLG5 Q5LLG5 "Aspartate racemase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_A0062 SPO_A0062 "aspartate racemase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q81KJ2 BAS4650 "Aspartate racemase family protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5005 BA_5005 "aspartate racemase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034585001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (335 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
COG1794230 COG1794, RacX, Aspartate racemase [Cell envelope b 7e-26
TIGR00035229 TIGR00035, asp_race, aspartate racemase 8e-22
pfam01177209 pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemas 5e-21
PRK10200230 PRK10200, PRK10200, putative racemase; Provisional 2e-05
>gnl|CDD|224707 COG1794, RacX, Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
 Score =  102 bits (257), Expect = 7e-26
 Identities = 63/246 (25%), Positives = 109/246 (44%), Gaps = 25/246 (10%)

Query: 81  NTVGIVGGASVDSTLNLLGKLVQLSGEENDFPFLLCSDPLLNKELLSHDRSSFSSLNCKG 140
            T+GI+GG   +ST     K+ +    +      L S  LL   +   +  +      + 
Sbjct: 2   KTIGILGGMGPESTAPYYRKINEAVRAKLG---GLHSAELLLYSVDFPEIETL----QRA 54

Query: 141 GGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAK 200
           G    +   I+ +  +K   LE+AGA  IV+P +  H   D++ K   +P LH+ +  AK
Sbjct: 55  GEWD-EAGEILIDAAKK---LERAGADFIVLPTNTMHKVADDIQKAVGIPLLHIIDATAK 110

Query: 201 ELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATME--HTLIPA 258
            +K A  K        ++G+L     +  GFY+++L+ +G EVV+PD       + +I  
Sbjct: 111 AIKAAGAK--------KVGLLGTRFTMEQGFYRKRLEEKGIEVVVPDDDEQAEVNRII-- 160

Query: 259 LDALNRKDVEGA-RNLLRIALQVLLVRAVNTVILASDDMQDLLPPDDPLLKKCIDPMDAL 317
            + L +  V+ A R L    ++ L  R    VIL   ++  LL  DD  +    D     
Sbjct: 161 YEELCQGIVKDASRELYLAVIERLAERGAEGVILGCTEIPLLLSQDDSSV-PVFDTTAIH 219

Query: 318 ARSTIK 323
           A + ++
Sbjct: 220 AEAAVE 225

Length = 230
>gnl|CDD|213495 TIGR00035, asp_race, aspartate racemase Back     alignment and domain information
>gnl|CDD|216346 pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemase Back     alignment and domain information
>gnl|CDD|182300 PRK10200, PRK10200, putative racemase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 332
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, 100.0
PRK10200230 putative racemase; Provisional 100.0
TIGR00035229 asp_race aspartate racemase. 100.0
TIGR00067251 glut_race glutamate racemase. The most closely rel 100.0
PRK00865261 glutamate racemase; Provisional 100.0
COG0796269 MurI Glutamate racemase [Cell envelope biogenesis, 99.96
PF01177216 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro 99.93
PRK07475245 hypothetical protein; Provisional 99.9
COG4126230 Hydantoin racemase [Amino acid transport and metab 99.38
PRK10481224 hypothetical protein; Provisional 98.93
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 98.48
COG3473238 Maleate cis-trans isomerase [Secondary metabolites 98.26
PF07302221 AroM: AroM protein; InterPro: IPR010843 This famil 97.4
PF00532279 Peripla_BP_1: Periplasmic binding proteins and sug 96.65
PRK00865261 glutamate racemase; Provisional 95.94
COG1609333 PurR Transcriptional regulators [Transcription] 95.55
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 94.91
TIGR00035 229 asp_race aspartate racemase. 94.81
PRK10727343 DNA-binding transcriptional regulator GalR; Provis 94.67
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 94.64
PRK07475245 hypothetical protein; Provisional 94.26
PF01177216 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro 94.23
PRK10481224 hypothetical protein; Provisional 94.01
TIGR00067251 glut_race glutamate racemase. The most closely rel 93.85
PRK10423327 transcriptional repressor RbsR; Provisional 93.75
COG1794 230 RacX Aspartate racemase [Cell envelope biogenesis, 93.65
cd06326336 PBP1_STKc_like Type I periplasmic binding domain o 93.61
TIGR03407 359 urea_ABC_UrtA urea ABC transporter, urea binding p 93.59
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 93.52
COG4126230 Hydantoin racemase [Amino acid transport and metab 93.39
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 93.33
TIGR03288290 CoB_CoM_SS_B CoB--CoM heterodisulfide reductase, s 93.2
cd06346312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 93.16
cd06273268 PBP1_GntR_like_1 This group includes the ligand-bi 93.08
cd06345344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 93.08
cd06280263 PBP1_LacI_like_4 Ligand-binding domain of uncharac 92.97
cd06333312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 92.88
PLN02424332 ketopantoate hydroxymethyltransferase 92.87
COG0683 366 LivK ABC-type branched-chain amino acid transport 92.87
PRK09492315 treR trehalose repressor; Provisional 92.78
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 92.68
PRK10200 230 putative racemase; Provisional 92.65
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 92.55
PRK06259486 succinate dehydrogenase/fumarate reductase iron-su 92.32
PRK10703341 DNA-binding transcriptional repressor PurR; Provis 92.31
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 92.14
cd06337 357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 92.14
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharac 92.1
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 92.07
cd06356334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 91.95
PRK09526342 lacI lac repressor; Reviewed 91.91
TIGR03669 374 urea_ABC_arch urea ABC transporter, substrate-bind 91.74
cd06288269 PBP1_sucrose_transcription_regulator Ligand-bindin 91.23
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabo 91.19
PRK15404369 leucine ABC transporter subunit substrate-binding 90.92
PRK14987331 gluconate operon transcriptional regulator; Provis 90.6
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel tr 90.6
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 90.56
cd06331333 PBP1_AmiC_like Type I periplasmic components of am 90.41
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 90.28
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 90.27
PF06506176 PrpR_N: Propionate catabolism activator; InterPro: 89.61
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 89.59
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b 89.52
cd06336347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 89.44
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 89.31
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 89.26
cd06341341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 89.25
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 89.22
cd06360336 PBP1_alkylbenzenes_like Type I periplasmic binding 89.09
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 88.98
PF07302221 AroM: AroM protein; InterPro: IPR010843 This famil 88.56
cd06339336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 88.54
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA t 88.37
cd06329342 PBP1_SBP_like_3 Periplasmic solute-binding domain 88.35
TIGR02405311 trehalos_R_Ecol trehalose operon repressor, proteo 88.31
cd06295275 PBP1_CelR Ligand binding domain of a transcription 88.17
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 87.62
cd06357 360 PBP1_AmiC Periplasmic binding domain of amidase (A 87.59
cd06305273 PBP1_methylthioribose_binding_like Methylthioribos 87.38
cd06343362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 87.32
cd06275269 PBP1_PurR Ligand-binding domain of purine represso 87.24
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharac 87.09
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-bind 86.72
KOG2949306 consensus Ketopantoate hydroxymethyltransferase [C 86.36
cd06338 345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 86.27
cd06355348 PBP1_FmdD_like Periplasmic component (FmdD) of an 86.16
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding doma 86.04
cd06342334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 85.88
PRK10339327 DNA-binding transcriptional repressor EbgR; Provis 85.84
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 85.6
COG2048293 HdrB Heterodisulfide reductase, subunit B [Energy 85.58
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcripti 85.44
PF13458343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 85.37
cd06348344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 85.24
cd06279283 PBP1_LacI_like_3 Ligand-binding domain of uncharac 84.95
COG0796269 MurI Glutamate racemase [Cell envelope biogenesis, 84.79
PRK11274407 glcF glycolate oxidase iron-sulfur subunit; Provis 84.24
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.03
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-bin 84.01
cd06327334 PBP1_SBP_like_1 Periplasmic solute-binding domain 83.58
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 83.5
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 83.34
PRK10653295 D-ribose transporter subunit RbsB; Provisional 83.31
cd06325281 PBP1_ABC_uncharacterized_transporter Type I peripl 82.9
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 82.61
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 82.6
cd06335347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 82.59
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 82.56
cd06379 377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 82.31
cd01543265 PBP1_XylR Ligand-binding domain of DNA transcripti 82.23
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 82.19
cd06297269 PBP1_LacI_like_12 Ligand-binding domain of unchara 82.06
PRK15424 538 propionate catabolism operon regulatory protein Pr 81.97
cd06368324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 81.54
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 81.18
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.08
cd06347334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 80.89
cd06380 382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 80.88
TIGR03288290 CoB_CoM_SS_B CoB--CoM heterodisulfide reductase, s 80.69
PRK10936343 TMAO reductase system periplasmic protein TorT; Pr 80.61
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.47
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 80.24
PRK10355330 xylF D-xylose transporter subunit XylF; Provisiona 80.22
COG0413268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 80.05
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
Probab=100.00  E-value=2.6e-57  Score=408.56  Aligned_cols=224  Identities=26%  Similarity=0.348  Sum_probs=203.2

Q ss_pred             cCeEEEEeCCChHHHHHHHHHHHHHhccC---CCCCEEEecCCcchhhhhhcCCCchhhccccCCCCCCCHHHHHHHHHH
Q 020005           80 ANTVGIVGGASVDSTLNLLGKLVQLSGEE---NDFPFLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRR  156 (332)
Q Consensus        80 ~k~IGIiGGmGp~AT~~~y~kI~~~t~~d---~~~~~vi~s~p~ip~~ll~~~~~~~~~~~~~~~~~~~d~~~i~~~l~~  156 (332)
                      ||+|||||||||+||+.|||+|++.+++.   .|.+.++.+.+++|++.-.              +.+.+|+...++|.+
T Consensus         1 mk~iGilGGMgpeST~~yyr~ine~~~~~~g~~h~~~i~~~s~~f~~~~~~--------------q~~~~w~~~~~~L~~   66 (230)
T COG1794           1 MKTIGILGGMGPESTAPYYRKINEAVRAKLGGLHSAELLLYSVDFPEIETL--------------QRAGEWDEAGEILID   66 (230)
T ss_pred             CceeEeccCCChHHHHHHHHHHHHHHHHHhCCcCcchhheecCCcccHHHH--------------HccCccccHHHHHHH
Confidence            79999999999999999999999999964   8888888888888874110              236788888999999


Q ss_pred             HHHHHHHcCCcEEEEeCCCchhhHHHHhhhCCCCeeechHHHHHHHHHhcCCCCcCCCCceEEEEechhhhchhhHHHHH
Q 020005          157 KRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKL  236 (332)
Q Consensus       157 ~~~~Le~~Gad~IvI~CNTaH~~~d~l~~~~~iPii~Ive~t~~~l~~~g~k~~~~~~~~rVGlLaT~~T~~s~lY~~~l  236 (332)
                      .++.|+++|||+|++||||+|.|+|++++.+++|+|||+|+|+++++..|.+        |||||||.+||+++||++.|
T Consensus        67 ~a~~Le~~GAd~i~l~~NT~H~~~d~iq~~~~iPllhIidaTa~~ik~~g~k--------kvgLLgT~~Tm~~~fY~~~l  138 (230)
T COG1794          67 AAKKLERAGADFIVLPTNTMHKVADDIQKAVGIPLLHIIDATAKAIKAAGAK--------KVGLLGTRFTMEQGFYRKRL  138 (230)
T ss_pred             HHHHHHhcCCCEEEEeCCcHHHHHHHHHHhcCCCeehHHHHHHHHHHhcCCc--------eeEEeeccchHHhHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999887        99999999999999999999


Q ss_pred             HhcCCeEEecCccchhhchHHH-HHHHhcCChH-HHHHHHHHHHHHHHhCCCCEEEECCCCcccCCCCCCCCCCceechH
Q 020005          237 QHEGFEVVLPDKATMEHTLIPA-LDALNRKDVE-GARNLLRIALQVLLVRAVNTVILASDDMQDLLPPDDPLLKKCIDPM  314 (332)
Q Consensus       237 ~~~Gi~vv~P~~~~q~~~l~~~-i~~ik~g~~~-~a~~~l~~~~~~L~~~gad~VILGCTElpli~~~~~~~~ipvID~~  314 (332)
                      .++|+++++|++++|+. ++.+ +++++.|+.. .+++.+.+++++|.++|||+|||||||+|+++++.+. .+|+||++
T Consensus       139 ~~~gievvvPdd~~q~~-v~~iIy~El~~G~~~~~sr~~~~~ii~~l~~~Gae~vIlGCTEi~lll~~~d~-~vP~~Dtt  216 (230)
T COG1794         139 EEKGIEVVVPDDDEQAE-VNRIIYEELCQGIVKDASRELYLAVIERLAERGAEGVILGCTEIPLLLSQDDS-SVPVFDTT  216 (230)
T ss_pred             HHCCceEecCCHHHHHH-HHHHHHHHHhcccchHHHHHHHHHHHHHHHHcCCCEEEEeccchheeecCCcc-cCcccccH
Confidence            99999999999998874 4443 5679999985 6899999999999999999999999999999988664 57999999


Q ss_pred             HHHHHHHHHHHHh
Q 020005          315 DALARSTIKWVKS  327 (332)
Q Consensus       315 ~~lA~a~v~~a~~  327 (332)
                      ++||+++++++++
T Consensus       217 ~iha~aav~~aL~  229 (230)
T COG1794         217 AIHAEAAVELALE  229 (230)
T ss_pred             HHHHHHHHHHHhc
Confidence            9999999999875

>PRK10200 putative racemase; Provisional Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase Back     alignment and domain information
>TIGR00067 glut_race glutamate racemase Back     alignment and domain information
>PRK00865 glutamate racemase; Provisional Back     alignment and domain information
>COG0796 MurI Glutamate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01177 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro: IPR015942 This entry represents a group of related proteins that includes aspartate racemase, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>COG4126 Hydantoin racemase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10481 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>PRK00865 glutamate racemase; Provisional Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>PF01177 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro: IPR015942 This entry represents a group of related proteins that includes aspartate racemase, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase Back     alignment and domain information
>PRK10481 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00067 glut_race glutamate racemase Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>COG4126 Hydantoin racemase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>TIGR03288 CoB_CoM_SS_B CoB--CoM heterodisulfide reductase, subunit B Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK10200 putative racemase; Provisional Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>KOG2949 consensus Ketopantoate hydroxymethyltransferase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>COG2048 HdrB Heterodisulfide reductase, subunit B [Energy production and conversion] Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>COG0796 MurI Glutamate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR) Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>TIGR03288 CoB_CoM_SS_B CoB--CoM heterodisulfide reductase, subunit B Back     alignment and domain information
>PRK10936 TMAO reductase system periplasmic protein TorT; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>PRK10355 xylF D-xylose transporter subunit XylF; Provisional Back     alignment and domain information
>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
3s81_A268 Crystal Structure Of Putative Aspartate Racemase Fr 7e-16
3s7z_A268 Crystal Structure Of Putative Aspartate Racemase Fr 2e-14
1jfl_A228 Crystal Structure Determination Of Aspartate Racema 9e-11
2dx7_A228 Crystal Structure Of Pyrococcus Horikoshii Ot3 Aspa 9e-10
2zsk_A226 Crystal Structure Of Ph1733, An Aspartate Racemase 5e-08
3ojc_A231 Crystal Structure Of A Putative AspGLU RACEMASE FRO 3e-07
>pdb|3S81|A Chain A, Crystal Structure Of Putative Aspartate Racemase From Salmonella Typhimurium Length = 268 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 117/275 (42%), Gaps = 38/275 (13%)
Query: 60  SKKSFGSKAAPFCSDALLNQANTVGIVGGASVDSTLNLLGKLVQL---SGEENDFPFLLC 116
           S    G++   F S+A+    +T+GI+GG    +T ++L K V+L   S ++   P ++ 
Sbjct: 9   SGVDLGTENLYFQSNAM---KHTIGILGGMGPAATADMLEKFVELRHASCDQQHIPLIVS 65
Query: 117 SDPLLNKE---LLSHDRSSFSSLNCKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPC 173
           S P +      LLS   S +                    L R    LE AGA CIV+PC
Sbjct: 66  SIPDIPDRTACLLSGGPSPY------------------RYLERYLHMLEDAGAECIVIPC 107
Query: 174 HLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQ 233
           + +H W D++        + + +    ++           S   +G+LA NA L  G YQ
Sbjct: 108 NTAHYWFDDLQNVAKARMISILDATLGDIPP---------SARHVGLLATNATLATGLYQ 158
Query: 234 EKLQHEGFEVVLPDKATMEHTLIPALDALNRKDVEGARNLLRIALQVLLVRAVNTVILAS 293
           +K    G  ++ P+ A  +  ++ A+  L R D   A+ LL   +  L+ R    +I+  
Sbjct: 159 KKALARGLTLIQPEDAG-QALVMQAIYTLKRGDKTAAQALLLPQIDSLIARGAQAIIMGC 217
Query: 294 DDMQXXXXXXXXXXK-KCIDPMDALARSTIKWVKS 327
            ++               ID   +L R+ I+W +S
Sbjct: 218 TEIPLIVAGHERAIACPMIDSTASLVRAAIRWYES 252
>pdb|3S7Z|A Chain A, Crystal Structure Of Putative Aspartate Racemase From Salmonella Typhimurium Complexed With Succinate Length = 268 Back     alignment and structure
>pdb|1JFL|A Chain A, Crystal Structure Determination Of Aspartate Racemase From An Archaea Length = 228 Back     alignment and structure
>pdb|2DX7|A Chain A, Crystal Structure Of Pyrococcus Horikoshii Ot3 Aspartate Racemase Complex With Citric Acid Length = 228 Back     alignment and structure
>pdb|2ZSK|A Chain A, Crystal Structure Of Ph1733, An Aspartate Racemase Homologue, From Pyrococcus Horikoshii Ot3 Length = 226 Back     alignment and structure
>pdb|3OJC|A Chain A, Crystal Structure Of A Putative AspGLU RACEMASE FROM YERSINIA PESTIS Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
3s81_A268 Putative aspartate racemase; structural genomics, 2e-37
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dim 2e-36
3ojc_A231 Putative aspartate/glutamate racemase; structural 2e-34
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase 7e-34
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-12
>3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A Length = 268 Back     alignment and structure
 Score =  133 bits (336), Expect = 2e-37
 Identities = 57/253 (22%), Positives = 104/253 (41%), Gaps = 29/253 (11%)

Query: 81  NTVGIVGGASVDSTLNLLGKLVQLSGEEND---FPFLLCSDPLLNKELLSHDRSSFSSLN 137
           +T+GI+GG    +T ++L K V+L     D    P ++ S P +       DR++     
Sbjct: 27  HTIGILGGMGPAATADMLEKFVELRHASCDQQHIPLIVSSIPDI------PDRTAC---- 76

Query: 138 CKGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSEC 197
                +          L R    LE AGA CIV+PC+ +H W D++        + + + 
Sbjct: 77  -----LLSGGPSPYRYLERYLHMLEDAGAECIVIPCNTAHYWFDDLQNVAKARMISILDA 131

Query: 198 VAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEKLQHEGFEVVLPDKATMEHTLIP 257
              ++  +        +          A L  G YQ+K    G  ++ P+ A     ++ 
Sbjct: 132 TLGDIPPSARHVGLLATN---------ATLATGLYQKKALARGLTLIQPEDAGQAL-VMQ 181

Query: 258 ALDALNRKDVEGARNLLRIALQVLLVRAVNTVILASDDMQDLLPPDD-PLLKKCIDPMDA 316
           A+  L R D   A+ LL   +  L+ R    +I+   ++  ++   +  +    ID   +
Sbjct: 182 AIYTLKRGDKTAAQALLLPQIDSLIARGAQAIIMGCTEIPLIVAGHERAIACPMIDSTAS 241

Query: 317 LARSTIKWVKSAE 329
           L R+ I+W +S  
Sbjct: 242 LVRAAIRWYESWP 254
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Length = 228 Back     alignment and structure
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Length = 231 Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Length = 226 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
3ojc_A231 Putative aspartate/glutamate racemase; structural 100.0
3s81_A268 Putative aspartate racemase; structural genomics, 100.0
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dim 100.0
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase 100.0
2vvt_A290 Glutamate racemase; isomerase, peptidoglycan synth 100.0
3out_A268 Glutamate racemase; structural genomics, center fo 100.0
2oho_A273 Glutamate racemase; isomerase; 2.25A {Streptococcu 100.0
3ist_A269 Glutamate racemase; structural genomics, cell WALL 100.0
3uhf_A274 Glutamate racemase; structural genomics, center fo 100.0
2jfq_A286 Glutamate racemase; cell WALL, isomerase, cell sha 100.0
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 100.0
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan 100.0
2dwu_A276 Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba 99.97
2jfn_A285 Glutamate racemase; cell WALL, isomerase, cell sha 99.97
1b73_A254 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 99.97
2jfz_A255 Glutamate racemase; cell WALL, isomerase, cell sha 99.97
2dgd_A223 223AA long hypothetical arylmalonate decarboxylas; 99.91
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 99.9
2xed_A273 Putative maleate isomerase; nicotinic acid catabol 99.9
2eq5_A228 228AA long hypothetical hydantoin racemase; struct 99.9
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 99.88
3c3k_A285 Alanine racemase; structural genomics, protein str 96.58
2fep_A289 Catabolite control protein A; CCPA, transcriptiona 96.56
3hcw_A295 Maltose operon transcriptional repressor; RNA-bind 96.54
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 96.47
3o74_A272 Fructose transport system repressor FRUR; dual tra 96.44
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 96.4
2dwu_A276 Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba 96.4
3egc_A291 Putative ribose operon repressor; structural genom 96.39
1qpz_A340 PURA, protein (purine nucleotide synthesis repress 96.37
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 96.34
3out_A268 Glutamate racemase; structural genomics, center fo 96.31
3k9c_A289 Transcriptional regulator, LACI family protein; PS 96.27
3e61_A277 Putative transcriptional repressor of ribose OPER; 96.26
3g1w_A305 Sugar ABC transporter; sugar-binding protein, baci 96.24
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan 96.19
3h5o_A339 Transcriptional regulator GNTR; transcription regu 96.17
3kke_A303 LACI family transcriptional regulator; structural 96.15
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 96.15
3bbl_A287 Regulatory protein of LACI family; protein structu 96.08
2vvt_A290 Glutamate racemase; isomerase, peptidoglycan synth 96.05
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 96.04
2qh8_A302 Uncharacterized protein; conserved domain protein, 96.0
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 95.99
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 95.98
2jfq_A286 Glutamate racemase; cell WALL, isomerase, cell sha 95.88
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 95.84
3jvd_A333 Transcriptional regulators; structural genomics, P 95.81
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 95.56
4fe7_A 412 Xylose operon regulatory protein; HTH_ARAC, helix- 95.54
3ojc_A 231 Putative aspartate/glutamate racemase; structural 95.5
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 95.47
2dgd_A223 223AA long hypothetical arylmalonate decarboxylas; 95.46
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 95.37
3bil_A348 Probable LACI-family transcriptional regulator; st 95.32
3k4h_A292 Putative transcriptional regulator; structural gen 95.3
2qu7_A288 Putative transcriptional regulator; structural gen 95.19
3eaf_A 391 ABC transporter, substrate binding protein; PSI2, 95.12
3e3m_A355 Transcriptional regulator, LACI family; structural 95.08
3qk7_A294 Transcriptional regulators; structural genomics, N 95.01
2xed_A273 Putative maleate isomerase; nicotinic acid catabol 95.0
1byk_A255 Protein (trehalose operon repressor); LACI family, 94.95
3ist_A269 Glutamate racemase; structural genomics, cell WALL 94.95
3ipc_A356 ABC transporter, substrate binding protein (amino; 94.81
3td9_A366 Branched chain amino acid ABC transporter, peripl 94.76
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 94.73
2jfz_A255 Glutamate racemase; cell WALL, isomerase, cell sha 94.71
3lft_A295 Uncharacterized protein; ABC, ATPase, cassette, L- 94.66
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 94.58
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 94.54
2iks_A293 DNA-binding transcriptional dual regulator; escher 94.53
1jye_A349 Lactose operon repressor; gene regulation, protein 94.53
2fvy_A309 D-galactose-binding periplasmic protein; periplasm 94.52
3l6u_A293 ABC-type sugar transport system periplasmic compo; 94.51
3gv0_A288 Transcriptional regulator, LACI family; transcript 94.39
3hut_A358 Putative branched-chain amino acid ABC transporter 94.38
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 94.38
3h5t_A366 Transcriptional regulator, LACI family; DNA-depend 94.28
2oho_A273 Glutamate racemase; isomerase; 2.25A {Streptococcu 94.07
3clk_A290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 94.03
3m9w_A313 D-xylose-binding periplasmic protein; xylose bindi 93.98
2zsk_A 226 PH1733, 226AA long hypothetical aspartate racemase 93.98
3lkb_A 392 Probable branched-chain amino acid ABC transporter 93.83
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 93.8
3o1i_D304 Periplasmic protein TORT; ligand free, two compone 93.78
1b73_A254 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 93.78
2eq5_A228 228AA long hypothetical hydantoin racemase; struct 93.73
2ioy_A283 Periplasmic sugar-binding protein; ribose binding 93.71
3hs3_A277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 93.64
2jfn_A285 Glutamate racemase; cell WALL, isomerase, cell sha 93.62
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 93.36
4evq_A 375 Putative ABC transporter subunit, substrate-bindi 93.29
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 93.17
2rjo_A332 Twin-arginine translocation pathway signal protei; 93.08
3gyb_A280 Transcriptional regulators (LACI-family transcript 93.06
3i09_A 375 Periplasmic branched-chain amino acid-binding Pro; 93.02
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 93.01
3uhf_A274 Glutamate racemase; structural genomics, center fo 92.89
1jfl_A 228 Aspartate racemase; alpha-beta structure, HOMO-dim 92.88
3lop_A364 Substrate binding periplasmic protein; protein str 92.86
4eyg_A 368 Twin-arginine translocation pathway signal; PSI-bi 92.83
2h3h_A313 Sugar ABC transporter, periplasmic sugar-binding p 92.8
2fn9_A290 Ribose ABC transporter, periplasmic ribose-bindin; 92.79
3snr_A 362 Extracellular ligand-binding receptor; structural 92.65
3n0w_A 379 ABC branched chain amino acid family transporter, 92.59
2dri_A271 D-ribose-binding protein; sugar transport; HET: RI 92.54
3brs_A289 Periplasmic binding protein/LACI transcriptional; 92.47
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 92.08
3sg0_A 386 Extracellular ligand-binding receptor; structural 91.78
2q5c_A196 NTRC family transcriptional regulator; structural 91.57
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 91.57
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 91.43
3gbv_A304 Putative LACI-family transcriptional regulator; NY 91.39
3i45_A 387 Twin-arginine translocation pathway signal protei; 91.35
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 91.33
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 91.31
3hsy_A 376 Glutamate receptor 2; ligand-gated ION channel, sy 91.3
3g85_A289 Transcriptional regulator (LACI family); transcrip 91.2
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 91.18
3miz_A301 Putative transcriptional regulator protein, LACI f 91.07
2vk2_A306 YTFQ, ABC transporter periplasmic-binding protein 90.73
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 90.65
3cs3_A277 Sugar-binding transcriptional regulator, LACI FAM; 90.6
3s81_A268 Putative aspartate racemase; structural genomics, 90.25
1pea_A 385 Amidase operon; gene regulator, receptor, binding 90.1
3ctp_A330 Periplasmic binding protein/LACI transcriptional; 89.79
1jx6_A342 LUXP protein; protein-ligand complex, signaling pr 88.96
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 88.91
2x7x_A325 Sensor protein; transferase, sensor histidine kina 88.25
3h75_A350 Periplasmic sugar-binding domain protein; protein 87.68
3h5l_A 419 Putative branched-chain amino acid ABC transporter 87.66
1usg_A346 Leucine-specific binding protein; leucine-binding 87.59
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 87.37
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 87.08
2pju_A225 Propionate catabolism operon regulatory protein; s 86.22
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 85.61
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 84.92
3uug_A330 Multiple sugar-binding periplasmic receptor CHVE; 83.75
3qek_A 384 NMDA glutamate receptor subunit; amino terminal do 83.66
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 82.87
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 82.56
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 82.55
4gpa_A 389 Glutamate receptor 4; PBP fold, ligand-gated ION c 81.93
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 81.88
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 81.77
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 81.18
4f06_A 371 Extracellular ligand-binding receptor; PSI-biology 80.46
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Back     alignment and structure
Probab=100.00  E-value=2.6e-51  Score=376.98  Aligned_cols=223  Identities=22%  Similarity=0.347  Sum_probs=191.7

Q ss_pred             cCeEEEEeCCChHHHHHHHHHHHHHhcc--C-CCCC-EEEecCCcchhhhhhcCCCchhhccccCCCCCCCHHHHHHHHH
Q 020005           80 ANTVGIVGGASVDSTLNLLGKLVQLSGE--E-NDFP-FLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLR  155 (332)
Q Consensus        80 ~k~IGIiGGmGp~AT~~~y~kI~~~t~~--d-~~~~-~vi~s~p~ip~~ll~~~~~~~~~~~~~~~~~~~d~~~i~~~l~  155 (332)
                      ||+|||||||||+||++||++|++.+++  + +|.| ++++| +.+++..-        +      ...++|+++.+++.
T Consensus         2 mk~iGilGGmg~~at~~~~~~i~~~~~~~~~~~h~~~~~~~s-~~~~~~~~--------~------~~~~~~~~~~~~l~   66 (231)
T 3ojc_A            2 MKILGLIGGMSWESTIPYYRMINQHVKAQLGGLHSAKIILYS-VDFHEIEQ--------L------QAKGDWQTAAQLLS   66 (231)
T ss_dssp             CCCEEEEECTTHHHHHHHHHHHHHHHHHHHCTTCCCCEEEEE-CCHHHHHH--------H------HHTTCHHHHHHHHH
T ss_pred             CCeEEEEccCCHHHHHHHHHHHHHHhHHhcCCCCCccceeeC-CChhhHHH--------H------HHCCChhHHHHHHH
Confidence            8999999999999999999999999996  3 6755 55555 44554210        0      02468999999999


Q ss_pred             HHHHHHHHcCCcEEEEeCCCchhhHHHHhhhCCCCeeechHHHHHHHHHhcCCCCcCCCCceEEEEechhhhchhhHHHH
Q 020005          156 RKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEANMKPLEAGSPLRIGVLAKNAILTAGFYQEK  235 (332)
Q Consensus       156 ~~~~~Le~~Gad~IvI~CNTaH~~~d~l~~~~~iPii~Ive~t~~~l~~~g~k~~~~~~~~rVGlLaT~~T~~s~lY~~~  235 (332)
                      +.+++|+++|||+|+|||||+|++++++++.+++||+||++++++++++.+.+        |||||||++|+++++|++.
T Consensus        67 ~~~~~L~~~g~~~iviaCNTa~~~~~~l~~~~~iPvi~i~~~~~~~a~~~~~~--------rVgvLaT~~T~~s~~y~~~  138 (231)
T 3ojc_A           67 NAAISLKHAGAEVIVVCTNTMHKVADDIEAACGLPLLHIADATAVQIKQQGID--------KIGLLGTRYTMEQGFYRGR  138 (231)
T ss_dssp             HHHHHHHHHTCCEEEECSSGGGGGHHHHHHHHCSCBCCHHHHHHHHHHHTTCC--------EEEEESCHHHHHSTTTHHH
T ss_pred             HHHHHHHhcCCCEEEEeCCchHHHHHHHHHhCCCCEeccHHHHHHHHHHcCCC--------EEEEEcCHHHhhchHHHHH
Confidence            99999999999999999999999999999999999999999999999876543        9999999999999999999


Q ss_pred             HHhc-CCeEEecCccchhhchHHHH-HHHhcCCh-HHHHHHHHHHHHHHHhCCCCEEEECCCCcccCCCCCCCCCCceec
Q 020005          236 LQHE-GFEVVLPDKATMEHTLIPAL-DALNRKDV-EGARNLLRIALQVLLVRAVNTVILASDDMQDLLPPDDPLLKKCID  312 (332)
Q Consensus       236 l~~~-Gi~vv~P~~~~q~~~l~~~i-~~ik~g~~-~~a~~~l~~~~~~L~~~gad~VILGCTElpli~~~~~~~~ipvID  312 (332)
                      ++++ |++++.|+++.|+. +...| ++++.|.. +.+++.+.++++.|.++|+|+|||||||||++.+..+ .++|+||
T Consensus       139 l~~~~g~~v~~p~~~~~~~-v~~~I~~~~~~g~~~~~~~~~~~~~~~~l~~~g~d~vILGCTe~pll~~~~~-~~v~viD  216 (231)
T 3ojc_A          139 LTEKHGIEVITPDDTDREA-VNRIIYEELCLGIISETSRDAYRRVIKKLEAQGVQGIIFGCTEITLLVNAQD-ASVPVFD  216 (231)
T ss_dssp             HHHTTCCEEECCCHHHHHH-HHHHHHHTGGGTCCCHHHHHHHHHHHHHHHHTTCSCEEECSGGGGGTCCGGG-CSSCEEE
T ss_pred             HHhcCCCEEEecCHHHHHH-HHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHhccccc-CCCcEEc
Confidence            9999 99999998876753 34334 46888887 5578899999999999999999999999999997765 3579999


Q ss_pred             hHHHHHHHHHHHHHh
Q 020005          313 PMDALARSTIKWVKS  327 (332)
Q Consensus       313 ~~~~lA~a~v~~a~~  327 (332)
                      |++++|+++++||+.
T Consensus       217 s~~~~A~~~v~~a~~  231 (231)
T 3ojc_A          217 TTAIHASAAADYALQ  231 (231)
T ss_dssp             HHHHHHHHHHHHHHC
T ss_pred             hHHHHHHHHHHHHhC
Confidence            999999999999863
>3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Back     alignment and structure
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Back     alignment and structure
>3uhf_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich fold, isomerase; HET: DGL; 1.83A {Campylobacter jejuni} PDB: 3uho_A* 3uhp_A Back     alignment and structure
>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Back     alignment and structure
>2jfn_A Glutamate racemase; cell WALL, isomerase, cell shape, UDP- murnac-Ala, peptidoglycan biosynthesis, peptidoglycan synthesis; HET: GLU UMA; 1.9A {Escherichia coli} Back     alignment and structure
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A* Back     alignment and structure
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A* Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>2jfn_A Glutamate racemase; cell WALL, isomerase, cell shape, UDP- murnac-Ala, peptidoglycan biosynthesis, peptidoglycan synthesis; HET: GLU UMA; 1.9A {Escherichia coli} Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>3uhf_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich fold, isomerase; HET: DGL; 1.83A {Campylobacter jejuni} PDB: 3uho_A* 3uhp_A Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} Back     alignment and structure
>3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 332
d1jfla1115 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Py 1e-20
d1jfla2113 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon 8e-17
d1b74a2147 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex p 0.001
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 115 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/glutamate racemase
family: Aspartate/glutamate racemase
domain: Aspartate racemase
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 83.4 bits (206), Expect = 1e-20
 Identities = 29/127 (22%), Positives = 58/127 (45%), Gaps = 18/127 (14%)

Query: 82  TVGIVGGASVDSTLNLLGKLVQLSGEEND---FPFLLCSDPLLNKELLSHDRSSFSSLNC 138
           T+GI+GG    +T  L  ++V  +  + D      ++ ++P +       DR+++     
Sbjct: 3   TIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQI------PDRTAYILGKG 56

Query: 139 KGGGVQLDDSLIVENLRRKRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECV 198
           +              L      LE+ GA  I+MPC+ +H + +++ K   +P + + E  
Sbjct: 57  ED---------PRPQLIWTAKRLEECGADFIIMPCNTAHAFVEDIRKAIKIPIISMIEET 107

Query: 199 AKELKEA 205
           AK++KE 
Sbjct: 108 AKKVKEL 114
>d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 113 Back     information, alignment and structure
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
d1jfla1115 Aspartate racemase {Archaeon Pyrococcus horikoshii 99.98
d1jfla2113 Aspartate racemase {Archaeon Pyrococcus horikoshii 99.91
d1b74a2147 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 99.62
d1b74a1105 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 99.35
d2nzug1275 Glucose-resistance amylase regulator CcpA, C-termi 97.3
d1dbqa_282 Purine repressor (PurR), C-terminal domain {Escher 95.66
d1jfla1115 Aspartate racemase {Archaeon Pyrococcus horikoshii 95.03
d1jfla2113 Aspartate racemase {Archaeon Pyrococcus horikoshii 95.03
d1byka_255 Trehalose repressor, C-terminal domain {Escherichi 94.95
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 94.12
d1b74a2147 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 90.33
d2pjua1186 Propionate catabolism operon regulatory protein Pr 89.39
d1usga_346 Leucine-binding protein {Escherichia coli [TaxId: 88.59
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 86.14
d1qo0a_ 373 Amide receptor/negative regulator of the amidase o 85.4
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 81.78
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 80.8
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/glutamate racemase
family: Aspartate/glutamate racemase
domain: Aspartate racemase
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

Probab=99.98  E-value=8.5e-33  Score=226.16  Aligned_cols=112  Identities=23%  Similarity=0.363  Sum_probs=95.7

Q ss_pred             cCeEEEEeCCChHHHHHHHHHHHHHhccC---CCCCEEEecCCcchhhhhhcCCCchhhccccCCCCCCCHHHHHHHHHH
Q 020005           80 ANTVGIVGGASVDSTLNLLGKLVQLSGEE---NDFPFLLCSDPLLNKELLSHDRSSFSSLNCKGGGVQLDDSLIVENLRR  156 (332)
Q Consensus        80 ~k~IGIiGGmGp~AT~~~y~kI~~~t~~d---~~~~~vi~s~p~ip~~ll~~~~~~~~~~~~~~~~~~~d~~~i~~~l~~  156 (332)
                      ||+|||||||||+||++||++|++.+++.   +|++++++|+|.+|++....               .++|+.....+.+
T Consensus         1 Mk~IGIIGGmgp~at~~yy~~i~~~~~~~~d~~~~~~il~s~~~~~~r~~~~---------------~~~~~~~~~~l~~   65 (115)
T d1jfla1           1 MKTIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDRTAYI---------------LGKGEDPRPQLIW   65 (115)
T ss_dssp             CCCEEEEECSSHHHHHHHHHHHHHTCCCSSGGGSCCEEEEECTTSCCHHHHH---------------TTSSCCCHHHHHH
T ss_pred             CCEEEEccCcCHHHHHHHHHHHHHHHHHhcCCCCChhheeecCCHHHHHHHH---------------hccccchHHHHHH
Confidence            79999999999999999999999999753   89999999999998763210               0112222344677


Q ss_pred             HHHHHHHcCCcEEEEeCCCchhhHHHHhhhCCCCeeechHHHHHHHHHhc
Q 020005          157 KRVFLEKAGARCIVMPCHLSHIWHDEVCKGCSVPFLHVSECVAKELKEAN  206 (332)
Q Consensus       157 ~~~~Le~~Gad~IvI~CNTaH~~~d~l~~~~~iPii~Ive~t~~~l~~~g  206 (332)
                      .+++|+++|||+|+|||||+|.|+|+|++.+++|||||+++|++++++.|
T Consensus        66 ~~~~Le~~Ga~~i~i~cNT~H~~~d~i~~~~~iP~l~i~~~t~~~i~~~G  115 (115)
T d1jfla1          66 TAKRLEECGADFIIMPCNTAHAFVEDIRKAIKIPIISMIEETAKKVKELG  115 (115)
T ss_dssp             HHHHHHHHTCSEEECSCTGGGGGHHHHHHHCSSCBCCHHHHHHHHHHHTT
T ss_pred             HHHHHHhcCCCEEEEcCcHHHHHHHHHHHHCCCCEecHHHHHHHHHHhcC
Confidence            88999999999999999999999999999999999999999999998864
>d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure