Citrus Sinensis ID: 020032

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MQFCLFQVTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAIESERLSKSRPIASAAPVTFPEDFDNGPDGTYFDYDDMEARIMQHLAAARYFRRREMQRYPALDASQVVDSSSAATASLMLPTNANSPNFCHGSSDTDIPTSVIRSTDNAQPPSSDPGTNRDGPFKSRVFFRQSPPDSPRRPNPSEVFSFSESVKSKWSAASARYKESISKGTRSLKERLLSRNTSVKELSKEVQREMSAGIAGVAKMIERLDLASKRSGTPAPSSANAGGPSSALFKGKGVQESAMNRRSAEVAPDIMSAAPSNVTGTNSAQLEVAHQRGL
ccccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccHHHHHHHHHHccccHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccc
cEEEEEEEcccccHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHHHHHcccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccHEHHHHHccc
mqfclfqvtsckheyHLQCILEWsqrskecpicwqqfvlkepACQELLAAIESErlsksrpiasaapvtfpedfdngpdgtyfdydDMEARIMQHLAAARYFRRREmqrypaldasqvvdsssaataslmlptnanspnfchgssdtdiptsvirstdnaqppssdpgtnrdgpfksrvffrqsppdsprrpnpsevfsfsesVKSKWSAASARYKESISKGTRSLKERLLSRNTSVKELSKEVQREMSAGIAGVAKMIERLDlaskrsgtpapssanaggpssalfkgkgvqesamnrrsaevapdimsaapsnvtgtnsAQLEVAHQRGL
mqfclfqvtsckheYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAIESERLSKSRPIASaapvtfpedfdngpDGTYFDYDDMEARIMQHLAAARYFRRREMQRYPALDASQVVDSSSAATASLMLPTNANSPNFCHGSSDTDIPTSVIRStdnaqppssdpgtnrdgpfkSRVFFRqsppdsprrpnpsevfsfsesvkskwsaasarykesiskgtrslkerllsrntsvkelskeVQREMSAGIAGVAKMIERLDLASKRSgtpapssanaggpssalFKGKGVQESAMNRRSAEVAPDIMsaapsnvtgtnsAQLEVAHQRGL
MQFCLFQVTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAIESERLSKSRPIASAAPVTFPEDFDNGPDGTYFDYDDMEARIMQHLAAARYFRRREMQRYPaldasqvvdsssaataslMLPTNANSPNFCHGSSDTDIPTSVIRSTDNAQPPSSDPGTNRDGPFKSRVFFrqsppdsprrpnpsevfsfsesvkskWSAASARYKESISKGTRSLKERLLSRNTSVKELSKEVQREMSAGIAGVAKMIERLDLASKRsgtpapssanaggpssaLFKGKGVQESAMNRRSAEVAPDIMSAAPSNVTGTNSAQLEVAHQRGL
**FCLFQVTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAI*************************GPDGTYFDYDDMEARIMQHLAAARYFRRRE**********************************************************************************************************************************************************************************************************************************
*QFCLFQVTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPA****************************************************************************************************************************************************************************************************************IAGVAKMIE***************************************************************LEVA*Q***
MQFCLFQVTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAIESERLSKSRPIASAAPVTFPEDFDNGPDGTYFDYDDMEARIMQHLAAARYFRRREMQRYPALDASQVVDSSSAATASLMLPTNANSPNFCHGSSDTDIPTSVIRS**************RDGPFKSRVFFR***************************************GTRSLKERLLSRNTSVKELSKEVQREMSAGIAGVAKMIERLDLA*****************SSALFK**************EVAPDIMSAAPSNVTGTNSAQLEVAHQRGL
MQFCLFQVTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAIESERLSKSRPIASAAPVTFPEDFDNGPDGTYFDYDDMEARIMQHLAAARYFRRR*************************************************************************************************************YKE*IS*GTRSLKER****************REM*AGIA*******************************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQFCLFQVTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAIESERLSKSRPIASAAPVTFPEDFDNGPDGTYFDYDDMEARIMQHLAAARYFRRREMQRYPALDASQVVDSSSAATASLMLPTNANSPNFCHGSSDTDIPTSVIRSTDNAQPPSSDPGTNRDGPFKSRVFFRQSPPDSPRRPNPSEVFSFSESVKSKWSAASARYKESISKGTRSLKERLLSRNTSVKELSKEVQREMSAGIAGVAKMIERLDLASKRSGTPAPSSANAGGPSSALFKGKGVQESAMNRRSAEVAPDIMSAAPSNVTGTNSAQLEVAHQRGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query332 2.2.26 [Sep-21-2011]
Q4TU14371 E3 ubiquitin-protein liga yes no 0.837 0.749 0.439 5e-47
Q9ZT42375 E3 ubiquitin-protein liga no no 0.765 0.677 0.442 4e-43
Q9VE61147 E3 ubiquitin-protein liga yes no 0.126 0.285 0.357 0.0004
Q8LE94231 E3 ubiquitin-protein liga no no 0.102 0.147 0.470 0.0004
>sp|Q4TU14|RHF1A_ARATH E3 ubiquitin-protein ligase RHF1A OS=Arabidopsis thaliana GN=RHF1A PE=1 SV=1 Back     alignment and function desciption
 Score =  188 bits (477), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 130/296 (43%), Positives = 175/296 (59%), Gaps = 18/296 (6%)

Query: 8   VTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAIESERLSKSR---PIAS 64
           VTSCKHEYHLQCI+EWSQRSKECPICWQ FVL++PA QELLAA+E ERL K+R     + 
Sbjct: 61  VTSCKHEYHLQCIIEWSQRSKECPICWQLFVLRDPASQELLAAVEKERLLKTRNISSSSP 120

Query: 65  AAPVTFPEDFDNGPDGTYFDYDDMEARIMQHLAAARY----FRRREMQRYPALDASQVVD 120
            +     +DF +  + + F   D   + ++HL  A +     RRR+ Q   +       D
Sbjct: 121 ISIHHSHDDFHSEEEESQFSSFD--EQFLRHLTEAAHRRCLLRRRDGQ--ISSSLVSSSD 176

Query: 121 SSSAATASLMLPTNANSPNFCHGSSDTDIPTSVIRSTDNAQPPSSDPGTNRDGPFKSRVF 180
            ++     L+     ++ +     +    P+    +       SS P  + +G   SR+ 
Sbjct: 177 PTTIHPTDLVNLYRLSAISHVEHQNSNPCPSPGSMTPSPVSGHSSIPADSNNG---SRIS 233

Query: 181 FRQSPPDSPRRPNPSEVFSFSESVKSKWSAASARYKESISKGTRSLKERLLSRNTSVKEL 240
              SP  S + P   E  S  E++KSK +AASA+YKESISK  + LKE+LL+RN SVKEL
Sbjct: 234 PGPSPSRSSQSPKSPEASSLPEAIKSKLAAASAKYKESISKSKQGLKEKLLARNNSVKEL 293

Query: 241 SKEVQREMSAGIAGVAKMIERLDLASKRSGTPA---PSSANAGGPSSALFKGKGVQ 293
           SK VQREM+AGIAGVA+MIER+D +SKR G  A    S+A A G + + FKGK V+
Sbjct: 294 SKGVQREMNAGIAGVARMIERMDFSSKRFGGSAHVSTSTATASGFNFS-FKGKRVE 348
E3 ubiquitin-protein ligase involved in the positive regulation of the gametogenesis progression. Mediates the proteasomal degradation of KRP6, a cyclin-dependent kinase inhibitor which accumulates during meiosis and blocks the progression of subsequent mitoses during gametophyte development. Functions in association with RHF2A. Possesses E3 ubiquitin ligase activity in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9ZT42|RHF2A_ARATH E3 ubiquitin-protein ligase RHF2A OS=Arabidopsis thaliana GN=RHF2A PE=2 SV=1 Back     alignment and function description
>sp|Q9VE61|RN181_DROME E3 ubiquitin-protein ligase RNF181 homolog OS=Drosophila melanogaster GN=CG7694 PE=2 SV=1 Back     alignment and function description
>sp|Q8LE94|RING3_ARATH E3 ubiquitin-protein ligase At3g02290 OS=Arabidopsis thaliana GN=At3g02290 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
224108097418 predicted protein [Populus trichocarpa] 0.963 0.765 0.485 1e-69
388511239365 unknown [Lotus japonicus] 0.912 0.830 0.483 3e-69
255552299414 protein binding protein, putative [Ricin 0.912 0.731 0.487 2e-68
225432562391 PREDICTED: E3 ubiquitin-protein ligase R 0.873 0.741 0.512 2e-64
449463084365 PREDICTED: E3 ubiquitin-protein ligase R 0.924 0.841 0.479 9e-63
356520043371 PREDICTED: E3 ubiquitin-protein ligase R 0.855 0.765 0.477 1e-60
356564526376 PREDICTED: E3 ubiquitin-protein ligase R 0.789 0.696 0.483 3e-58
356546418359 PREDICTED: E3 ubiquitin-protein ligase R 0.852 0.788 0.460 1e-55
224102029301 predicted protein [Populus trichocarpa] 0.825 0.910 0.505 2e-53
148910804423 unknown [Picea sitchensis] 0.843 0.661 0.441 4e-51
>gi|224108097|ref|XP_002314719.1| predicted protein [Populus trichocarpa] gi|222863759|gb|EEF00890.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 166/342 (48%), Positives = 212/342 (61%), Gaps = 22/342 (6%)

Query: 8   VTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAIESERLSKSRPIASAAP 67
           VT C HEYHLQCILEWSQRSKECPICWQ  VLK+ A QELLAA+E+ERL +SR    A+ 
Sbjct: 60  VTCCNHEYHLQCILEWSQRSKECPICWQLLVLKDHASQELLAAVETERLLRSRNSTPASM 119

Query: 68  VT--FPEDFDNGPDGTYFDYDDMEARIMQHLAAARY-----FRRREMQRYPALDASQVVD 120
           +     +D+D   D    D D  E  IMQHLAAA          RE QR   L  SQV+ 
Sbjct: 120 IVPHLDDDYDIEQDSYSDDSDFDE-HIMQHLAAAASSRAHHVHERERQRSNGLGPSQVIA 178

Query: 121 SSS---AATASLMLPTNANSPNFCHGSSDTDIPT----SV-IRSTDNAQPPSSD--PGTN 170
            +S    AT      +        HGSS  + PT    SV +++  +  PP  +    T 
Sbjct: 179 FTSPEHVATVQQTCTSPEEGQTLIHGSSVINSPTPDTLSVNVQNLSSVTPPDVNQVSTTA 238

Query: 171 RDGPFKSRVFFRQSPPDSPRRPNPSEVFSFSESVKSKWSAASARYKESISKGTRSLKERL 230
            + PFK R+ FRQ P D+P+    SEV S S+S+KSKW AASARYK+S+SK TR +KE+L
Sbjct: 239 VNSPFKPRILFRQPPTDTPQEQGSSEVLSLSDSIKSKWFAASARYKDSLSKSTRGIKEKL 298

Query: 231 LSRNTSVKELSKEVQREMSAGIAGVAKMIERLDLASKRSGTPAPSSANAGGPSSALFKGK 290
           ++RN SVKELSKEVQREMSAGIAGVA+MIERLDL +KR+G     S   G  S+  +KGK
Sbjct: 299 VARNNSVKELSKEVQREMSAGIAGVARMIERLDLTTKRTGPSMSDSGFTGATSNFSWKGK 358

Query: 291 GVQES----AMNRRSAEVAPDIMSAAPSNVTGTNSAQLEVAH 328
           GV+++    A+ + S E+  D    A S+ +GT  A++E++H
Sbjct: 359 GVEQNIIAQALAKTSEEIDRDTSLGASSHASGTVQARVEISH 400

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388511239|gb|AFK43681.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255552299|ref|XP_002517194.1| protein binding protein, putative [Ricinus communis] gi|223543829|gb|EEF45357.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225432562|ref|XP_002281045.1| PREDICTED: E3 ubiquitin-protein ligase RHF1A [Vitis vinifera] gi|297737001|emb|CBI26202.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449463084|ref|XP_004149264.1| PREDICTED: E3 ubiquitin-protein ligase RHF1A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356520043|ref|XP_003528675.1| PREDICTED: E3 ubiquitin-protein ligase RHF1A-like [Glycine max] Back     alignment and taxonomy information
>gi|356564526|ref|XP_003550504.1| PREDICTED: E3 ubiquitin-protein ligase RHF1A-like [Glycine max] Back     alignment and taxonomy information
>gi|356546418|ref|XP_003541623.1| PREDICTED: E3 ubiquitin-protein ligase RHF1A-like [Glycine max] Back     alignment and taxonomy information
>gi|224102029|ref|XP_002312516.1| predicted protein [Populus trichocarpa] gi|222852336|gb|EEE89883.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|148910804|gb|ABR18468.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
TAIR|locus:2129525371 RHF1A "RING-H2 group F1A" [Ara 0.304 0.272 0.547 7.7e-48
FB|FBgn0038627147 CG7694 [Drosophila melanogaste 0.165 0.374 0.309 7.7e-06
TAIR|locus:505006415190 RHB1A "RING-H2 finger B1A" [Ar 0.099 0.173 0.515 7.5e-05
TAIR|locus:2177881212 AT5G41350 [Arabidopsis thalian 0.093 0.146 0.516 0.00064
TAIR|locus:2076542231 AT3G02290 [Arabidopsis thalian 0.078 0.112 0.576 0.00083
TAIR|locus:2143251232 AT5G15790 [Arabidopsis thalian 0.078 0.112 0.576 0.00084
TAIR|locus:2129525 RHF1A "RING-H2 group F1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 288 (106.4 bits), Expect = 7.7e-48, Sum P(2) = 7.7e-48
 Identities = 58/106 (54%), Positives = 76/106 (71%)

Query:     8 VTSCKHEYHLQCILEWSQRSKECPICWQQFVLKEPACQELLAAIESERLSKSRPIASAAP 67
             VTSCKHEYHLQCI+EWSQRSKECPICWQ FVL++PA QELLAA+E ERL K+R I+S++P
Sbjct:    61 VTSCKHEYHLQCIIEWSQRSKECPICWQLFVLRDPASQELLAAVEKERLLKTRNISSSSP 120

Query:    68 VTFP---EDFDNGPDGTYFD-YDDMEARIMQHLAAAR-YFRRREMQ 108
             ++     +DF +  + + F  +D+   R +   A  R   RRR+ Q
Sbjct:   121 ISIHHSHDDFHSEEEESQFSSFDEQFLRHLTEAAHRRCLLRRRDGQ 166
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009561 "megagametogenesis" evidence=IGI
GO:0010498 "proteasomal protein catabolic process" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0051726 "regulation of cell cycle" evidence=IGI
GO:0055046 "microgametogenesis" evidence=IGI
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
FB|FBgn0038627 CG7694 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:505006415 RHB1A "RING-H2 finger B1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177881 AT5G41350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076542 AT3G02290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143251 AT5G15790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00100846
hypothetical protein (418 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-07
cd0016245 cd00162, RING, RING-finger (Really Interesting New 4e-06
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 5e-06
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 1e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-05
smart0018440 smart00184, RING, Ring finger 3e-05
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-04
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 45.5 bits (108), Expect = 5e-07
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 8  VTSCKHEYHLQCILEWSQRSKECPIC 33
          V  C H +H +C+ +W + S  CP+C
Sbjct: 18 VLPCGHVFHKECLDKWLRSSNTCPLC 43

Length = 46
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 332
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.94
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.91
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.91
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.85
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.7
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 98.7
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.66
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.61
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.57
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.56
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.54
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.5
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.49
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.48
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.47
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.37
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.34
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.31
KOG0287442 consensus Postreplication repair protein RAD18 [Re 98.28
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.27
PF1463444 zf-RING_5: zinc-RING finger domain 98.25
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.09
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.03
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.97
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.92
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.85
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.83
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.46
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.24
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.05
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.05
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.0
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.82
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.73
KOG2660331 consensus Locus-specific chromosome binding protei 96.6
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.58
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.56
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.42
KOG0297391 consensus TNF receptor-associated factor [Signal t 96.37
KOG1941518 consensus Acetylcholine receptor-associated protei 96.24
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.14
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.11
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.02
KOG4739233 consensus Uncharacterized protein involved in syna 95.2
KOG1002791 consensus Nucleotide excision repair protein RAD16 95.09
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 94.98
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 94.78
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 94.77
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 94.7
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.27
COG5222427 Uncharacterized conserved protein, contains RING Z 93.18
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 93.09
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 92.38
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 91.39
PHA03096284 p28-like protein; Provisional 91.16
KOG1001674 consensus Helicase-like transcription factor HLTF/ 91.14
PHA02862156 5L protein; Provisional 90.37
PF04641260 Rtf2: Rtf2 RING-finger 90.24
KOG4445368 consensus Uncharacterized conserved protein, conta 89.84
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 88.81
KOG3039303 consensus Uncharacterized conserved protein [Funct 86.52
PHA02825162 LAP/PHD finger-like protein; Provisional 85.23
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 85.21
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 84.31
KOG02981394 consensus DEAD box-containing helicase-like transc 83.6
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 80.8
KOG1940276 consensus Zn-finger protein [General function pred 80.62
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information 
Probab=98.94  E-value=4.6e-10  Score=90.94  Aligned_cols=39  Identities=33%  Similarity=0.945  Sum_probs=34.2

Q ss_pred             CCCCCeecCCCCcccHhhHHHHHhC---CCCCCCcccccccC
Q 020032            2 QFCLFQVTSCKHEYHLQCILEWSQR---SKECPICWQQFVLK   40 (332)
Q Consensus         2 ~fcpPVvlpCGH~FC~~CI~eWlk~---s~sCPmCRq~~s~~   40 (332)
                      +-||++...|+|.||.+||.+|+..   +..|||||+++.++
T Consensus        43 d~Cplv~g~C~H~FH~hCI~kWl~~~~~~~~CPmCR~~w~~k   84 (85)
T PF12861_consen   43 DDCPLVWGKCSHNFHMHCILKWLSTQSSKGQCPMCRQPWKFK   84 (85)
T ss_pred             CCCceeeccCccHHHHHHHHHHHccccCCCCCCCcCCeeeeC
Confidence            4589999999999999999999986   36899999998754

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 5e-10
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 8e-09
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-08
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 2e-08
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 4e-08
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 4e-08
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-07
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 9e-07
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-06
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-06
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 9e-06
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 2e-05
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 4e-05
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 6e-05
2ect_A78 Ring finger protein 126; metal binding protein, st 7e-05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 8e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 9e-05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-04
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 5e-04
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 6e-04
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
 Score = 53.9 bits (130), Expect = 5e-10
 Identities = 8/30 (26%), Positives = 13/30 (43%)

Query: 8  VTSCKHEYHLQCILEWSQRSKECPICWQQF 37
             C H +   CI  W +++  CP+C    
Sbjct: 21 ALPCLHAFCYVCITRWIRQNPTCPLCKVPV 50
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.16
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.13
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.12
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.11
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.1
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.09
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.09
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.08
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.08
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.05
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.05
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.03
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.03
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.01
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.01
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.01
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.0
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.99
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.99
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.98
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.98
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.98
2ect_A78 Ring finger protein 126; metal binding protein, st 98.98
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.98
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.97
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.97
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.96
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.96
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.95
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.95
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.95
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.93
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.92
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.92
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.91
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.91
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.91
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.9
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.9
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.88
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.87
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.85
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.85
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.82
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.82
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.8
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.79
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.79
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.77
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.75
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.72
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.63
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.55
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.53
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.5
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.49
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.48
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.46
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.45
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.42
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.39
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.31
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.23
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.08
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.06
2ea5_A68 Cell growth regulator with ring finger domain prot 97.96
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.78
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.71
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 91.93
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 90.93
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 86.57
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
Probab=99.16  E-value=1.1e-11  Score=93.62  Aligned_cols=53  Identities=17%  Similarity=0.168  Sum_probs=43.4

Q ss_pred             CCCCeecCCCCcccHhhHHHHHhC-CCCCCCcccccccCCch-hHHHHHHHHHhh
Q 020032            3 FCLFQVTSCKHEYHLQCILEWSQR-SKECPICWQQFVLKEPA-CQELLAAIESER   55 (332)
Q Consensus         3 fcpPVvlpCGH~FC~~CI~eWlk~-s~sCPmCRq~~s~~d~~-s~eL~~~VE~er   55 (332)
                      |..|++++|||.||..||.+|++. ...||+||+.+...++. +..|.+.++...
T Consensus        18 ~~~Pv~~~CgH~fc~~Ci~~~~~~~~~~CP~C~~~~~~~~l~~n~~l~~~i~~~~   72 (78)
T 1t1h_A           18 MKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLKSLIALWC   72 (78)
T ss_dssp             CSSEEEETTTEEEEHHHHHHHHTTTCCBCTTTCCBCSSCCCEECTTTHHHHHHHH
T ss_pred             ccCCEEcCCCCeecHHHHHHHHHHCcCCCCCCcCCCChhhCccCHHHHHHHHHHH
Confidence            567899999999999999999987 67999999998766654 556666666554
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 332
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-10
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 9e-09
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-07
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 7e-06
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 8e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 6e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 7e-04
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.002
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 0.002
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 54.0 bits (129), Expect = 3e-10
 Identities = 9/41 (21%), Positives = 19/41 (46%)

Query: 1  MQFCLFQVTSCKHEYHLQCILEWSQRSKECPICWQQFVLKE 41
           + C      C H +H  CI  W +  + CP+  +++  ++
Sbjct: 47 SEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK 87
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.19
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.1
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.06
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.04
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.03
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.02
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.99
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.98
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.95
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.93
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.93
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.93
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.88
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.73
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.36
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.32
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.19  E-value=2.6e-12  Score=99.55  Aligned_cols=37  Identities=24%  Similarity=0.793  Sum_probs=33.4

Q ss_pred             CCCeecCCCCcccHhhHHHHHhCCCCCCCcccccccC
Q 020032            4 CLFQVTSCKHEYHLQCILEWSQRSKECPICWQQFVLK   40 (332)
Q Consensus         4 cpPVvlpCGH~FC~~CI~eWlk~s~sCPmCRq~~s~~   40 (332)
                      ++++.++|||.||..||.+||+.+.+||+||++|..+
T Consensus        50 ~~~~~~~C~H~FH~~Ci~~Wl~~~~~CP~CR~~~~~~   86 (88)
T d3dplr1          50 CTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQ   86 (88)
T ss_dssp             CCEEEETTSCEEEHHHHHHHHTTCSBCSSSCSBCCEE
T ss_pred             CCeEEccccCcccHHHHHHHHHHCCcCCCCCCccccc
Confidence            4567899999999999999999999999999998754
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure