Citrus Sinensis ID: 020205

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MEMSLTASSFSKPLFFSNQSLSKTHFLTAANNTNTSTTIKTRRPTCIKAANSSPSIAQTLSTNWDVSNFAVNNNTSSPYLPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVIDDGKPGLVAPTSEAIPPPKPRVWHMWNIEGSRKAKKKLPSEHNLLQNGNIGGQGGGEDRGTEEEKKESAPV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHccccHHHHcccccccccccccccccccccccccccccccHHHHccccccHHHccccccccccccccccccccccccccc
cccEEHHcccccccccccccccccccccccccccccccccccccEEEEEccccccccHccccccccccccccccccccccccccHHcHHHHHHcccEEEEEccEcHHHHHHHHHHHHHHHHHcccccEEEEEEEccEcHHHHHHHHHHHHHccccEEEEEEEEEEcHHHHHHHccccccEEEccccEEEEcccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccEEEEHHHHHHHccccEEcHccccccccccccccccccccEEEEEEccccHHHHcccccHHHHHHccccccccccccccccccccccccc
memsltassfskplffsnqslskthfltaanntntsttiktrrptcikaansspsiaqtlstnwdvsnfavnnntsspylpkfeelDTTNMLLRQRIIFLgsqvddltADFIISQLlfldaedskkDIRLFinspggsvtagmGIYDAMKLCKADVSTICLGLAASMGAFLLAAgskgkrycmpnarvmihqplgtaggkatdMSIRIREMSYHKVKLNKILsratgkpvqqieldtdrdNFMDAWEAKEYGLVDaviddgkpglvaptseaipppkprvwhmwniegsrkakkklpsehnllqngniggqgggedrgteeekkesapv
memsltassfskplffSNQSLSKTHFLtaanntntsttiktrrptCIKAANSSPSIAQTLSTNWDVSNFAVNNNTSSPYLPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFldaedskkDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMihqplgtaggkATDMSIRIREMSYHKVKLNkilsratgkpvqqieldtdRDNFMDAWEAKEYGLVDAVIDDGKPGLVAPtseaipppkprvwHMWNIEGSRKAKKKLPSEhnllqngniggqgggedrgteeekkesapv
MEMSLTASSFSKPLFFSNQSLSKTHFLtaanntntsttIKTRRPTCIKAANSSPSIAQTLSTNWDVSNFAVNNNTSSPYLPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVIDDGKPGLVAPTSEAIPPPKPRVWHMWNIEGSRKAKKKLPSEHNLLQNgniggqgggedrgteeeKKESAPV
*********************************************************QTLSTNWDVSNFAVNNNTSSPYLPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVIDDGKPGLV************RVWHMWNI*******************************************
**************************************************************************TSSPYLPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVID********************VWHMW*********************************************
*********FSKPLFFSNQSLSKTHFLTAANNTNTSTTIKTRRPTCIKAANSSPSIAQTLSTNWDVSNFAVNNNTSSPYLPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVIDDGKPGLVAPTSEAIPPPKPRVWHMWNIEGSRKAKKKLPSEHNLLQNGNIGG*******************
*********FSKPLFFSNQSLSKTHFLTAA************RPTC**AANS*P*I****S****VSNFAVNNNTSSPYLPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVIDDGK*GLVAP*SEAIPPPKPRVWHMWNIEGSRKA*KKLPS*******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMSLTASSFSKPLFFSNQSLSKTHFLTAANNTNTSTTIKTRRPTCIKAANSSPSIAQTLSTNWDVSNFAVNNNTSSPYLPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVIDDGKPGLVAPTSEAIPPPKPRVWHMWNIEGSRKAKKKLPSEHNLLQNGNIGGQGGGEDRGTEEEKKESAPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query329 2.2.26 [Sep-21-2011]
Q9SXJ6309 ATP-dependent Clp proteas yes no 0.811 0.864 0.724 1e-117
Q5N1P6240 ATP-dependent Clp proteas yes no 0.525 0.720 0.612 3e-60
O34125240 ATP-dependent Clp proteas yes no 0.525 0.720 0.612 3e-60
Q8YXH5204 ATP-dependent Clp proteas yes no 0.544 0.877 0.614 5e-60
Q3MFR5204 ATP-dependent Clp proteas yes no 0.544 0.877 0.614 5e-60
A7GIH2194 ATP-dependent Clp proteas yes no 0.534 0.907 0.625 6e-60
B1IND7194 ATP-dependent Clp proteas yes no 0.534 0.907 0.625 6e-60
C1FLA6194 ATP-dependent Clp proteas yes no 0.534 0.907 0.625 6e-60
A5I6W1194 ATP-dependent Clp proteas yes no 0.534 0.907 0.625 6e-60
A7FYI2194 ATP-dependent Clp proteas yes no 0.534 0.907 0.625 6e-60
>sp|Q9SXJ6|CLPP3_ARATH ATP-dependent Clp protease proteolytic subunit 3, chloroplastic OS=Arabidopsis thaliana GN=CLPP3 PE=1 SV=1 Back     alignment and function desciption
 Score =  421 bits (1082), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 195/269 (72%), Positives = 231/269 (85%), Gaps = 2/269 (0%)

Query: 40  KTRRPTCIKAANS-SPSIAQTLSTNWDVSNFAVNNNTSSP-YLPKFEELDTTNMLLRQRI 97
           KT +P C++++ S S    QTLS+NWDVS+F++++   SP  LP FEELDTTNMLLRQRI
Sbjct: 36  KTSKPFCVRSSMSLSKPPRQTLSSNWDVSSFSIDSVAQSPSRLPSFEELDTTNMLLRQRI 95

Query: 98  IFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVS 157
           +FLGSQVDD+TAD +ISQLL LDAEDS++DI LFINSPGGS+TAGMGIYDAMK CKADVS
Sbjct: 96  VFLGSQVDDMTADLVISQLLLLDAEDSERDITLFINSPGGSITAGMGIYDAMKQCKADVS 155

Query: 158 TICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVK 217
           T+CLGLAASMGAFLLA+GSKGKRYCMPN++VMIHQPLGTAGGKAT+MSIRIREM YHK+K
Sbjct: 156 TVCLGLAASMGAFLLASGSKGKRYCMPNSKVMIHQPLGTAGGKATEMSIRIREMMYHKIK 215

Query: 218 LNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVIDDGKPGLVAPTSEAIPPPK 277
           LNKI SR TGKP  +IE DTDRDNF++ WEAKEYGL+DAVIDDGKPGL+AP  +  PPPK
Sbjct: 216 LNKIFSRITGKPESEIESDTDRDNFLNPWEAKEYGLIDAVIDDGKPGLIAPIGDGTPPPK 275

Query: 278 PRVWHMWNIEGSRKAKKKLPSEHNLLQNG 306
            +VW +W +EG++K    LPSE ++ QNG
Sbjct: 276 TKVWDLWKVEGTKKDNTNLPSERSMTQNG 304
Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 9EC: 2
>sp|Q5N1P6|CLPP3_SYNP6 ATP-dependent Clp protease proteolytic subunit 3 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=clpP3 PE=3 SV=1 Back     alignment and function description
>sp|O34125|CLPP2_SYNE7 ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus elongatus (strain PCC 7942) GN=clpP2 PE=3 SV=1 Back     alignment and function description
>sp|Q8YXH5|CLPP1_NOSS1 ATP-dependent Clp protease proteolytic subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpP1 PE=3 SV=1 Back     alignment and function description
>sp|Q3MFR5|CLPP1_ANAVT ATP-dependent Clp protease proteolytic subunit 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=clpP1 PE=3 SV=1 Back     alignment and function description
>sp|A7GIH2|CLPP_CLOBL ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|B1IND7|CLPP_CLOBK ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Okra / Type B1) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|C1FLA6|CLPP_CLOBJ ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Kyoto / Type A2) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|A5I6W1|CLPP_CLOBH ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|A7FYI2|CLPP_CLOB1 ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=clpP PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
255583777334 ATP-dependent Clp protease proteolytic s 0.966 0.952 0.722 1e-136
224079413338 predicted protein [Populus trichocarpa] 0.911 0.887 0.753 1e-130
356569022322 PREDICTED: ATP-dependent Clp protease pr 0.957 0.978 0.714 1e-129
255638490322 unknown [Glycine max] 0.957 0.978 0.711 1e-128
225453100320 PREDICTED: ATP-dependent Clp protease pr 0.960 0.987 0.693 1e-128
356499630319 PREDICTED: ATP-dependent Clp protease pr 0.948 0.978 0.708 1e-127
388495948324 unknown [Lotus japonicus] 0.838 0.851 0.758 1e-124
449521259339 PREDICTED: ATP-dependent Clp protease pr 0.990 0.961 0.666 1e-123
449463450339 PREDICTED: LOW QUALITY PROTEIN: ATP-depe 0.990 0.961 0.663 1e-122
297841293308 hypothetical protein ARALYDRAFT_894344 [ 0.911 0.974 0.673 1e-117
>gi|255583777|ref|XP_002532641.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] gi|223527632|gb|EEF29744.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 239/331 (72%), Positives = 272/331 (82%), Gaps = 13/331 (3%)

Query: 6   TASSFSKPLFFSNQSLSKTHFLTAANNTNT-------STTIKTRRPTCIKAANSSPSIAQ 58
            + S S PL FSN    K   L   N T++       ST  K R+P  +KA N+     +
Sbjct: 10  VSQSTSSPLCFSNH---KQFLLPTINTTDSNKAKVSISTNGKRRKPISVKAVNTR---KE 63

Query: 59  TLSTNWDVSNFAVNNNTSSPYLPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLF 118
           TLS+NWDV+NF+ +  TSSP LP+FEELDTTNMLLRQRIIFLGSQVDD+TADF+ISQLLF
Sbjct: 64  TLSSNWDVANFSSSFATSSPALPRFEELDTTNMLLRQRIIFLGSQVDDMTADFVISQLLF 123

Query: 119 LDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGSKG 178
           LDAED  KDI+LFINSPGGSVTAG+GIYDAMKLCKADVSTICLGLAASMGAFLLAAG+KG
Sbjct: 124 LDAEDPTKDIKLFINSPGGSVTAGLGIYDAMKLCKADVSTICLGLAASMGAFLLAAGTKG 183

Query: 179 KRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTD 238
           KR+CMPN RVMIHQPLGTAGGKAT+MSIRIREM+YHK+KLNKILSRATGKPV+QIE+DTD
Sbjct: 184 KRFCMPNGRVMIHQPLGTAGGKATEMSIRIREMNYHKIKLNKILSRATGKPVEQIEVDTD 243

Query: 239 RDNFMDAWEAKEYGLVDAVIDDGKPGLVAPTSEAIPPPKPRVWHMWNIEGSRKAKKKLPS 298
           RDNFM AWEAKEYGL+D VIDDGKPGLVAP ++A PPPK RVW +W IEG +KAKK LPS
Sbjct: 244 RDNFMSAWEAKEYGLIDVVIDDGKPGLVAPLTDASPPPKTRVWDLWKIEGGKKAKKNLPS 303

Query: 299 EHNLLQNGNIGGQGGGEDRGTEEEKKESAPV 329
           EH +L+NG  G QG  EDRGT++EK + A V
Sbjct: 304 EHKILRNGYAGRQGDDEDRGTDQEKDDPASV 334

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224079413|ref|XP_002305856.1| predicted protein [Populus trichocarpa] gi|222848820|gb|EEE86367.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356569022|ref|XP_003552706.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255638490|gb|ACU19554.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225453100|ref|XP_002271649.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
>gi|356499630|ref|XP_003518640.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|388495948|gb|AFK36040.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449521259|ref|XP_004167647.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449463450|ref|XP_004149447.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297841293|ref|XP_002888528.1| hypothetical protein ARALYDRAFT_894344 [Arabidopsis lyrata subsp. lyrata] gi|297334369|gb|EFH64787.1| hypothetical protein ARALYDRAFT_894344 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
TAIR|locus:2033344309 CLPP3 "CLP protease proteolyti 0.908 0.967 0.663 5.1e-106
TAIR|locus:2163538292 CLPP4 "CLP protease P4" [Arabi 0.680 0.767 0.471 2.6e-53
UNIPROTKB|P63786195 clpP "ATP-dependent Clp protea 0.522 0.882 0.610 5.6e-52
TIGR_CMR|CPS_3785220 CPS_3785 "ATP-dependent Clp pr 0.525 0.786 0.578 8.3e-51
TIGR_CMR|SO_1794202 SO_1794 "ATP-dependent Clp pro 0.522 0.851 0.604 1.1e-50
TIGR_CMR|BA_5380193 BA_5380 "ATP-dependent Clp pro 0.519 0.886 0.578 1.3e-50
TIGR_CMR|CHY_0325195 CHY_0325 "ATP-dependent Clp pr 0.522 0.882 0.587 1.3e-50
UNIPROTKB|P0A6G7207 clpP [Escherichia coli K-12 (t 0.522 0.830 0.575 3.6e-50
TIGR_CMR|VC_1922200 VC_1922 "ATP-dependent Clp pro 0.522 0.86 0.587 4.6e-50
TAIR|locus:2196120298 CLPP5 "nuclear encoded CLP pro 0.513 0.567 0.591 5.2e-49
TAIR|locus:2033344 CLPP3 "CLP protease proteolytic subunit 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1049 (374.3 bits), Expect = 5.1e-106, P = 5.1e-106
 Identities = 205/309 (66%), Positives = 244/309 (78%)

Query:     1 MEMSL--TASSFSKPLFFSNQSLSKTHFLXXXXXXXXXXXIKTRRPTCIKAANS-SPSIA 57
             MEMSL   +SS S P+   N      +F             KT +P C++++ S S    
Sbjct:     1 MEMSLRLASSSTSNPICLLNPG-KNLNFPIRNHRIP-----KTSKPFCVRSSMSLSKPPR 54

Query:    58 QTLSTNWDVSNFAVNNNTSSPY-LPKFEELDTTNMLLRQRIIFLGSQVDDLTADFIISQL 116
             QTLS+NWDVS+F++++   SP  LP FEELDTTNMLLRQRI+FLGSQVDD+TAD +ISQL
Sbjct:    55 QTLSSNWDVSSFSIDSVAQSPSRLPSFEELDTTNMLLRQRIVFLGSQVDDMTADLVISQL 114

Query:   117 LFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLAASMGAFLLAAGS 176
             L LDAEDS++DI LFINSPGGS+TAGMGIYDAMK CKADVST+CLGLAASMGAFLLA+GS
Sbjct:   115 LLLDAEDSERDITLFINSPGGSITAGMGIYDAMKQCKADVSTVCLGLAASMGAFLLASGS 174

Query:   177 KGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELD 236
             KGKRYCMPN++VMIHQPLGTAGGKAT+MSIRIREM YHK+KLNKI SR TGKP  +IE D
Sbjct:   175 KGKRYCMPNSKVMIHQPLGTAGGKATEMSIRIREMMYHKIKLNKIFSRITGKPESEIESD 234

Query:   237 TDRDNFMDAWEAKEYGLVDAVIDDGKPGLVAPTSEAIPPPKPRVWHMWNIEGSRKAKKKL 296
             TDRDNF++ WEAKEYGL+DAVIDDGKPGL+AP  +  PPPK +VW +W +EG++K    L
Sbjct:   235 TDRDNFLNPWEAKEYGLIDAVIDDGKPGLIAPIGDGTPPPKTKVWDLWKVEGTKKDNTNL 294

Query:   297 PSEHNLLQN 305
             PSE ++ QN
Sbjct:   295 PSERSMTQN 303
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009840 "chloroplastic endopeptidase Clp complex" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009532 "plastid stroma" evidence=IDA
TAIR|locus:2163538 CLPP4 "CLP protease P4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P63786 clpP "ATP-dependent Clp protease proteolytic subunit" [Staphylococcus aureus subsp. aureus MW2 (taxid:196620)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3785 CPS_3785 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1794 SO_1794 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5380 BA_5380 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0325 CHY_0325 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6G7 clpP [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1922 VC_1922 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TAIR|locus:2196120 CLPP5 "nuclear encoded CLP protease 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SXJ6CLPP3_ARATH3, ., 4, ., 2, 1, ., 9, 20.72490.81150.8640yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.976
3rd Layer3.4.21.920.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00022336001
RecName- Full=ATP-dependent Clp protease proteolytic subunit; EC=3.4.21.92; (320 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00035353001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (493 aa)
• •   • 0.935
GSVIVG00037260001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (389 aa)
• •   • 0.900
GSVIVG00031954001
SubName- Full=Chromosome chr18 scaffold_61, whole genome shotgun sequence; (595 aa)
• •   • 0.891
GSVIVG00022204001
SubName- Full=Chromosome chr6 scaffold_25, whole genome shotgun sequence; (582 aa)
  •   • 0.571
GSVIVG00024837001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (606 aa)
  •   • 0.562
GSVIVG00034177001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (531 aa)
  •   • 0.558
GSVIVG00034341001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (634 aa)
  •   • 0.549
GSVIVG00026904001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (363 aa)
      • 0.534
GSVIVG00027807001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (471 aa)
      • 0.532
GSVIVG00021042001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (888 aa)
      • 0.530

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
PRK00277200 PRK00277, clpP, ATP-dependent Clp protease proteol 1e-104
cd07017171 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) 1e-101
pfam00574182 pfam00574, CLP_protease, Clp protease 2e-99
COG0740200 COG0740, ClpP, Protease subunit of ATP-dependent C 2e-89
TIGR00493192 TIGR00493, clpP, ATP-dependent Clp endopeptidase, 5e-89
PRK12553207 PRK12553, PRK12553, ATP-dependent Clp protease pro 2e-83
CHL00028200 CHL00028, clpP, ATP-dependent Clp protease proteol 3e-77
PRK12551196 PRK12551, PRK12551, ATP-dependent Clp protease pro 4e-74
PRK14514221 PRK14514, PRK14514, ATP-dependent Clp protease pro 7e-69
cd07013162 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is 7e-64
PRK14513201 PRK14513, PRK14513, ATP-dependent Clp protease pro 2e-55
PRK12552222 PRK12552, PRK12552, ATP-dependent Clp protease-lik 8e-50
PRK14512197 PRK14512, PRK14512, ATP-dependent Clp protease pro 1e-46
cd00394161 cd00394, Clp_protease_like, Caseinolytic protease 7e-42
cd07016160 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) 2e-32
COG0616317 COG0616, SppA, Periplasmic serine proteases (ClpP 2e-06
cd07023208 cd07023, S49_Sppa_N_C, Signal peptide peptidase A 0.001
TIGR00706208 TIGR00706, SppA_dom, signal peptide peptidase SppA 0.004
>gnl|CDD|178955 PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information 
 Score =  303 bits (779), Expect = e-104
 Identities = 108/167 (64%), Positives = 137/167 (82%)

Query: 92  LLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKL 151
           LL++RIIFLG +V+D  A+ I++QLLFL+AED  KDI L+INSPGGSVTAG+ IYD M+ 
Sbjct: 28  LLKERIIFLGGEVEDHMANLIVAQLLFLEAEDPDKDIYLYINSPGGSVTAGLAIYDTMQF 87

Query: 152 CKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREM 211
            K DVSTIC+G AASMGAFLLAAG+KGKR+ +PN+R+MIHQPLG   G+ATD+ I  RE+
Sbjct: 88  IKPDVSTICIGQAASMGAFLLAAGAKGKRFALPNSRIMIHQPLGGFQGQATDIEIHAREI 147

Query: 212 SYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVI 258
              K +LN+IL+  TG+P+++IE DTDRDNFM A EAKEYGL+D V+
Sbjct: 148 LKLKKRLNEILAEHTGQPLEKIEKDTDRDNFMSAEEAKEYGLIDEVL 194

Length = 200
>gnl|CDD|132928 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|201316 pfam00574, CLP_protease, Clp protease Back     alignment and domain information
>gnl|CDD|223811 COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|188055 TIGR00493, clpP, ATP-dependent Clp endopeptidase, proteolytic subunit ClpP Back     alignment and domain information
>gnl|CDD|237133 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|214340 CHL00028, clpP, ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>gnl|CDD|139060 PRK12551, PRK12551, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|184722 PRK14514, PRK14514, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132924 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|237742 PRK14513, PRK14513, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|183588 PRK12552, PRK12552, ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|237741 PRK14512, PRK14512, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132923 cd00394, Clp_protease_like, Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>gnl|CDD|132927 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|223689 COG0616, SppA, Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|132934 cd07023, S49_Sppa_N_C, Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>gnl|CDD|213553 TIGR00706, SppA_dom, signal peptide peptidase SppA, 36K type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 329
KOG0840275 consensus ATP-dependent Clp protease, proteolytic 100.0
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 100.0
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 100.0
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 100.0
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 100.0
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 100.0
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 100.0
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 100.0
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 100.0
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 100.0
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 100.0
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 100.0
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 99.97
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 99.97
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.95
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 99.94
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 99.85
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 99.85
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.83
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 99.83
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 99.82
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 99.81
PRK10949618 protease 4; Provisional 99.78
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 99.78
PRK11778330 putative inner membrane peptidase; Provisional 99.74
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 99.71
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 99.69
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 99.54
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 99.36
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 99.31
PRK10949 618 protease 4; Provisional 99.25
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 98.91
COG3904245 Predicted periplasmic protein [Function unknown] 98.7
PRK06688259 enoyl-CoA hydratase; Provisional 98.69
PRK05869222 enoyl-CoA hydratase; Validated 98.69
PRK06495257 enoyl-CoA hydratase; Provisional 98.68
PRK08258277 enoyl-CoA hydratase; Provisional 98.64
PRK07511260 enoyl-CoA hydratase; Provisional 98.63
PRK03580261 carnitinyl-CoA dehydratase; Provisional 98.62
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 98.6
PRK06190258 enoyl-CoA hydratase; Provisional 98.6
PRK06143256 enoyl-CoA hydratase; Provisional 98.58
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 98.55
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 98.54
PRK08138261 enoyl-CoA hydratase; Provisional 98.53
PRK07938249 enoyl-CoA hydratase; Provisional 98.52
PRK05980260 enoyl-CoA hydratase; Provisional 98.52
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 98.52
PRK09076258 enoyl-CoA hydratase; Provisional 98.52
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 98.52
PRK06210272 enoyl-CoA hydratase; Provisional 98.52
PRK08150255 enoyl-CoA hydratase; Provisional 98.52
PRK08260296 enoyl-CoA hydratase; Provisional 98.51
PLN02888265 enoyl-CoA hydratase 98.51
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.5
PRK05981266 enoyl-CoA hydratase; Provisional 98.5
PRK07509262 enoyl-CoA hydratase; Provisional 98.49
PRK07854243 enoyl-CoA hydratase; Provisional 98.49
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 98.49
PRK07658257 enoyl-CoA hydratase; Provisional 98.49
PRK08139266 enoyl-CoA hydratase; Validated 98.48
PLN02921327 naphthoate synthase 98.48
PRK07468262 enoyl-CoA hydratase; Provisional 98.48
PRK05864276 enoyl-CoA hydratase; Provisional 98.48
PRK06023251 enoyl-CoA hydratase; Provisional 98.48
PLN02600251 enoyl-CoA hydratase 98.47
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 98.47
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 98.47
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 98.47
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 98.46
PRK07327268 enoyl-CoA hydratase; Provisional 98.46
PRK09245266 enoyl-CoA hydratase; Provisional 98.45
PRK06127269 enoyl-CoA hydratase; Provisional 98.45
PRK06494259 enoyl-CoA hydratase; Provisional 98.45
PRK05995262 enoyl-CoA hydratase; Provisional 98.44
PRK06072248 enoyl-CoA hydratase; Provisional 98.43
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 98.43
PRK08290288 enoyl-CoA hydratase; Provisional 98.43
PRK05862257 enoyl-CoA hydratase; Provisional 98.43
PRK06142272 enoyl-CoA hydratase; Provisional 98.43
PRK07657260 enoyl-CoA hydratase; Provisional 98.42
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 98.42
PRK06144262 enoyl-CoA hydratase; Provisional 98.42
PRK06213229 enoyl-CoA hydratase; Provisional 98.38
PRK08252254 enoyl-CoA hydratase; Provisional 98.38
PRK08140262 enoyl-CoA hydratase; Provisional 98.38
PRK06563255 enoyl-CoA hydratase; Provisional 98.38
PRK08788287 enoyl-CoA hydratase; Validated 98.37
PRK08321302 naphthoate synthase; Validated 98.36
PRK07260255 enoyl-CoA hydratase; Provisional 98.36
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 98.35
PRK07799263 enoyl-CoA hydratase; Provisional 98.34
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 98.34
PLN02267239 enoyl-CoA hydratase/isomerase family protein 98.34
PRK12478298 enoyl-CoA hydratase; Provisional 98.32
PRK08259254 enoyl-CoA hydratase; Provisional 98.31
PRK08272302 enoyl-CoA hydratase; Provisional 98.31
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.27
PRK05870249 enoyl-CoA hydratase; Provisional 98.27
PRK07659260 enoyl-CoA hydratase; Provisional 98.23
PRK07827260 enoyl-CoA hydratase; Provisional 98.23
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 98.21
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 98.18
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 98.17
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 98.17
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.16
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 98.16
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 98.15
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.15
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 98.14
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 98.14
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 98.13
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 98.13
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.11
PLN02874 379 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.1
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 98.07
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 98.06
PRK11730 715 fadB multifunctional fatty acid oxidation complex 98.03
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 97.99
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 97.98
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 97.87
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 97.75
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 97.58
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 97.51
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 97.41
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 97.18
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 97.15
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 96.88
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 96.73
PRK07189301 malonate decarboxylase subunit beta; Reviewed 96.72
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 96.49
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 96.27
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 96.19
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 96.12
KOG1679291 consensus Enoyl-CoA hydratase [Lipid transport and 96.03
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 95.17
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 95.11
PF06833234 MdcE: Malonate decarboxylase gamma subunit (MdcE); 94.05
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase compon 93.66
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 92.94
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 92.04
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 91.88
KOG0016266 consensus Enoyl-CoA hydratase/isomerase [Lipid tra 91.41
cd06567224 Peptidase_S41 C-terminal processing peptidase fami 89.51
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 86.09
cd07560211 Peptidase_S41_CPP C-terminal processing peptidase; 85.86
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 82.12
PF08496155 Peptidase_S49_N: Peptidase family S49 N-terminal; 80.92
KOG1684401 consensus Enoyl-CoA hydratase [Lipid transport and 80.71
>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=8.5e-55  Score=401.54  Aligned_cols=248  Identities=49%  Similarity=0.739  Sum_probs=212.9

Q ss_pred             cccccCCCcceecccccccccccccccCCCccceecccCcceeeccCCCccccccccCCccccccccCCCCCCCCCCccc
Q 020205            5 LTASSFSKPLFFSNQSLSKTHFLTAANNTNTSTTIKTRRPTCIKAANSSPSIAQTLSTNWDVSNFAVNNNTSSPYLPKFE   84 (329)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~   84 (329)
                      +.+++..+++|-.|+....++- .+.   +-.-..+...+.++++-+...++......+|.+|++.......-    +..
T Consensus        10 ~s~~~~~~~~~~l~P~~~~~~~-~~~---~~~r~~~~~~~~s~~sg~~~~~~~~~~~~~~~~p~~~~~~~~rG----~~~   81 (275)
T KOG0840|consen   10 LSSSSSPKRFSGLNPASTSNFP-KQR---NVRRQLKSSTPKSLRSGGSSNSRGWSLRAPILVPRFPIESPGRG----RER   81 (275)
T ss_pred             cCcccccchhcccCchhhhhcc-ccc---cchhhhhccCcccccccCCCCCCcccccccccCCcceeeccccC----CCC
Confidence            5666666777777765544443 222   22222233344456555555555666777888886543333222    457


Q ss_pred             cCChhhhhhcCcEEEEccccChhHHHHHHHHHHhhhhcCCCCCeEEEEeCCCCchhHHHHHHHHHHhcCCCeEEEEcccc
Q 020205           85 ELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLA  164 (329)
Q Consensus        85 ~~di~~~ll~~rII~l~g~Id~~~a~~ii~~L~~l~~~~~~k~I~L~INSPGGsV~ag~aIyd~Ir~~~~pV~t~v~G~A  164 (329)
                      ++|++++||++|||||+++||+.+++.|++||++|+.+++.|+|+||||||||+|++|++|||.|+.++.||.|+|.|+|
T Consensus        82 ~~Di~s~LlreRIi~lg~~Idd~va~~viaqlL~Ld~ed~~K~I~lyINSPGG~vtaglAIYDtMq~ik~~V~Tic~G~A  161 (275)
T KOG0840|consen   82 PYDIYSRLLRERIVFLGQPIDDDVANLVIAQLLYLDSEDPKKPIYLYINSPGGSVTAGLAIYDTMQYIKPDVSTICVGLA  161 (275)
T ss_pred             cccHHHHHHHhheeeeCCcCcHHHHHHHHHHHHHhhccCCCCCeEEEEeCCCCccchhhhHHHHHHhhCCCceeeehhhH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHhcCCCCcEEEecCceEEEeccCCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHhhhcCCceec
Q 020205          165 ASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMD  244 (329)
Q Consensus       165 ASaas~Ia~AGdkg~R~a~PnS~imIHqp~~~~~G~~~dl~~~a~el~~~~~~i~~iya~~tG~s~e~I~~l~d~d~~lt  244 (329)
                      ||+|++|++||.||+|+++||+++|||||.+++.|++.|+.++++|+++.++.+.++|+++||++.|+|.++|+||+||+
T Consensus       162 as~aalLLaaG~KG~R~alPnsriMIhQP~gga~Gqa~Di~i~akE~~~~k~~l~~i~a~~Tgq~~e~i~~d~dRd~fms  241 (275)
T KOG0840|consen  162 ASMAALLLAAGAKGKRYALPNSRIMIHQPSGGAGGQATDIVIQAKELMRIKEYLNEIYAKHTGQPLEVIEKDMDRDRFMS  241 (275)
T ss_pred             HhHHHHHHhcCCCcceeecCCceeEEeccCCCcCccchHHHHHHHHHHHHHHHHHHHHHHhcCCcHHHHHhhhcccccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCceeecCC
Q 020205          245 AWEAKEYGLVDAVIDD  260 (329)
Q Consensus       245 a~EAve~GLID~I~~~  260 (329)
                      |+||+||||||+|++.
T Consensus       242 a~EA~eyGliD~v~~~  257 (275)
T KOG0840|consen  242 AEEAKEYGLIDKVIDH  257 (275)
T ss_pred             HHHHHHhcchhhhhcC
Confidence            9999999999999985

>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>COG3904 Predicted periplasmic protein [Function unknown] Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>PF06833 MdcE: Malonate decarboxylase gamma subunit (MdcE); InterPro: IPR009648 This family consists of several bacterial malonate decarboxylase gamma subunit proteins Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] Back     alignment and domain information
>cd06567 Peptidase_S41 C-terminal processing peptidase family S41 Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>cd07560 Peptidase_S41_CPP C-terminal processing peptidase; serine protease family S41 Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08496 Peptidase_S49_N: Peptidase family S49 N-terminal; InterPro: IPR013703 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
3st9_A197 Crystal Structure Of Clpp In Heptameric Form From S 2e-58
3qwd_A203 Crystal Structure Of Clpp From Staphylococcus Aureu 2e-58
3v5i_A203 The Crystal Structure Of The Mutant Clpp S98a (Stap 5e-58
3tt6_A196 Structure Of Clpp From Bacillus Subtilis In Compres 2e-57
3ktg_A199 Structure Of Clpp From Bacillus Subtilis In Monocli 2e-57
3tt7_A197 Structure Of Clpp From Bacillus Subtilis In Complex 2e-57
3kti_A199 Structure Of Clpp In Complex With Adep1 Length = 19 2e-57
3mt6_R207 Structure Of Clpp From Escherichia Coli In Complex 3e-57
1yg8_A193 The Structure Of A V6a Variant Of Clpp. Length = 19 3e-57
1tyf_A193 The Structure Of Clpp At 2.3 Angstrom Resolution Su 3e-57
3hln_A193 Crystal Structure Of Clpp A153c Mutant With Inter-H 4e-57
2zl0_A196 Crystal Structure Of H.Pylori Clpp Length = 196 1e-50
2zl3_A196 Crystal Structure Of H.Pylori Clpp S99a Length = 19 2e-50
2c8t_A206 The 3.0 A Resolution Structure Of Caseinolytic Clp 9e-49
2cby_A208 Crystal Structure Of The Atp-Dependent Clp Protease 1e-48
2ce3_A200 Crystal Structure Of The Atp-Dependent Clp Protease 1e-48
3p2l_A201 Crystal Structure Of Atp-Dependent Clp Protease Sub 3e-45
2f6i_A215 Crystal Structure Of The Clpp Protease Catalytic Do 1e-42
1tg6_A277 Crystallography And Mutagenesis Point To An Essenti 5e-42
3q7h_A195 Structure Of The Clpp Subunit Of The Atp-Dependent 2e-39
1y7o_A218 The Structure Of Streptococcus Pneumoniae A153p Clp 3e-36
4hnk_A219 Crystal Structure Of An Enzyme Length = 219 1e-20
4gm2_A205 The Crystal Structure Of A Peptidase From Plasmodiu 2e-20
>pdb|3ST9|A Chain A, Crystal Structure Of Clpp In Heptameric Form From Staphylococcus Aureus Length = 197 Back     alignment and structure 
Iteration: 1

 Score =  222 bits (566), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 135/172 (78%)
Query: 87  DTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIY 146
           D  + LL+ RII LGSQ+DD  A+ I+SQLLFL A+DS+KDI L+INSPGGSVTAG  IY
Sbjct: 21  DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIY 80
Query: 147 DAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSI 206
           D ++  K DV TIC+G+AASMG+FLLAAG+KGKR+ +PNA VMIHQPLG A G+AT++ I
Sbjct: 81  DTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEI 140
Query: 207 RIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVI 258
               +   + KLN+ILS  TG+ +++I+ DTDRDNF+ A EAKEYGL+D V+
Sbjct: 141 AANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVM 192
>pdb|3QWD|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus Length = 203 Back     alignment and structure
>pdb|3V5I|A Chain A, The Crystal Structure Of The Mutant Clpp S98a (Staphylococcus Aureus) Length = 203 Back     alignment and structure
>pdb|3TT6|A Chain A, Structure Of Clpp From Bacillus Subtilis In Compressed State Length = 196 Back     alignment and structure
>pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199 Back     alignment and structure
>pdb|3TT7|A Chain A, Structure Of Clpp From Bacillus Subtilis In Complex With Dfp Length = 197 Back     alignment and structure
>pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1 Length = 199 Back     alignment and structure
>pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207 Back     alignment and structure
>pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp. Length = 193 Back     alignment and structure
>pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests A Model For Atp-Dependent Proteolysis Length = 193 Back     alignment and structure
>pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193 Back     alignment and structure
>pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp Length = 196 Back     alignment and structure
>pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a Length = 196 Back     alignment and structure
>pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp Protease 1 From Mycobacterium Tuberculosis Length = 206 Back     alignment and structure
>pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208 Back     alignment and structure
>pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 200 Back     alignment and structure
>pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit P From Francisella Tularensis Length = 201 Back     alignment and structure
>pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain From Plasmodium Falciparum Length = 215 Back     alignment and structure
>pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role For The N- Terminus Of Human Mitochondrial Clpp Length = 277 Back     alignment and structure
>pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp Protease From Coxiella Burnetii Length = 195 Back     alignment and structure
>pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp Length = 218 Back     alignment and structure
>pdb|4HNK|A Chain A, Crystal Structure Of An Enzyme Length = 219 Back     alignment and structure
>pdb|4GM2|A Chain A, The Crystal Structure Of A Peptidase From Plasmodium Falciparum Length = 205 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 1e-106
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 1e-105
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 1e-105
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 1e-104
2f6i_A215 ATP-dependent CLP protease, putative; structural g 1e-104
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 1e-102
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 1e-101
3viv_A230 441AA long hypothetical NFED protein; protein-pept 8e-37
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 7e-04
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Length = 208 Back     alignment and structure
 Score =  308 bits (791), Expect = e-106
 Identities = 87/168 (51%), Positives = 125/168 (74%)

Query: 92  LLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKL 151
           LL +RIIFLGS+V+D  A+ + +Q+L L AED+ KDI L+INSPGGS++AGM IYD M L
Sbjct: 24  LLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVL 83

Query: 152 CKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREM 211
              D++T  +G+AASMG FLLAAG+KGKRY +P+AR+++HQPLG   G A D++I+  + 
Sbjct: 84  APCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPLGGVTGSAADIAIQAEQF 143

Query: 212 SYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVID 259
           +  K ++ ++ +  TG+P+++IE D+DRD +  A EA EYG VD +I 
Sbjct: 144 AVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIIT 191
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Length = 193 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Length = 203 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Length = 201 Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Length = 215 Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Length = 218 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Length = 277 Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Length = 230 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Length = 593 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 100.0
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 100.0
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 100.0
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 100.0
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 100.0
2f6i_A215 ATP-dependent CLP protease, putative; structural g 100.0
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 100.0
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 100.0
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.96
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 99.87
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.84
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.78
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 98.96
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 98.93
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 98.9
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 98.88
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 98.88
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 98.87
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 98.86
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 98.84
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 98.82
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 98.8
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 98.79
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 98.77
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 98.77
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 98.76
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 98.76
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 98.75
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 98.75
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 98.73
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 98.73
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 98.72
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 98.72
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 98.72
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 98.7
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 98.69
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 98.68
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 98.68
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 98.65
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 98.65
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 98.65
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 98.63
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 98.63
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 98.62
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 98.62
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 98.62
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 98.62
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 98.61
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 98.6
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 98.6
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 98.6
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 98.58
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 98.58
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 98.58
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 98.58
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 98.58
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 98.57
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 98.57
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 98.57
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 98.57
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 98.57
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 98.56
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 98.55
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 98.55
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 98.55
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 98.55
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 98.54
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 98.53
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 98.52
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 98.51
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 98.5
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 98.5
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 98.5
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 98.49
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 98.47
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 98.46
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 98.44
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 98.42
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 98.42
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 98.41
4hdt_A353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 98.39
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 98.38
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 98.37
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 98.37
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 98.37
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 98.3
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 98.3
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.2
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.12
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 98.09
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 98.01
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 98.0
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 98.0
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 97.72
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 97.71
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 97.67
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 97.65
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 97.54
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 97.32
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 97.28
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 97.05
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 97.02
2x24_A793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 96.23
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 94.55
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 93.92
3k8x_A758 Acetyl-COA carboxylase; transferase, carboxyltrans 93.7
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 93.57
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 93.49
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 92.7
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 92.65
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 92.2
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 91.66
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 91.6
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 82.13
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 81.82
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
Probab=100.00  E-value=7.2e-50  Score=363.13  Aligned_cols=177  Identities=33%  Similarity=0.523  Sum_probs=169.2

Q ss_pred             ccCChhhhhhcCcEEEEccccChhHHHHHHHHHHhhhhcCCCCCeEEEEeCCC----------CchhHHHHHHHHHHhcC
Q 020205           84 EELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPG----------GSVTAGMGIYDAMKLCK  153 (329)
Q Consensus        84 ~~~di~~~ll~~rII~l~g~Id~~~a~~ii~~L~~l~~~~~~k~I~L~INSPG----------GsV~ag~aIyd~Ir~~~  153 (329)
                      .++|+|++||++|||||+++|++.+++.|+++|++|+.+++.++|.|+|||||          |+|++|++|||+|+.++
T Consensus        17 ~~~di~s~Ll~~Riifl~~~I~d~~a~~iiaqLl~L~~ed~~k~I~lyINSpG~~~~~~~~~~G~v~aglaIyd~m~~~~   96 (205)
T 4gm2_A           17 LYFQGPSLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGDIDNNKIINLNGITDVISIVDVINYIS   96 (205)
T ss_dssp             -----CHHHHTTTEEEECSCCCHHHHHHHHHHHHHHHHHCTTCCEEEEEEECTTEETTEESCTTHHHHHHHHHHHHHHSS
T ss_pred             CCcCHHHHHhcCCEEEECCEEcHHHHHHHHHHHHHHHhcCCCCCEEEEEeCCCCCCcCCCCCCCCHHHHHHHHHHHHhcC
Confidence            46899999999999999999999999999999999999999999999999999          99999999999999999


Q ss_pred             CCeEEEEccccchHHHHHHhcCCCCcEEEecCceEEEeccCCCC-CCChhhHHHHHHHHHHHHHHHHHHHHHHcCCCHHH
Q 020205          154 ADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTA-GGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQ  232 (329)
Q Consensus       154 ~pV~t~v~G~AASaas~Ia~AGdkg~R~a~PnS~imIHqp~~~~-~G~~~dl~~~a~el~~~~~~i~~iya~~tG~s~e~  232 (329)
                      .||+|+|.|+|||+|++|++||++|+|++.|||++|||||+++. .|++.|++++++++.+.++.+.++|+++||++.++
T Consensus        97 ~~V~t~~~G~AaS~as~il~aG~~gkR~~lP~a~iMIHqP~~~~~~G~a~di~i~a~el~~~~~~i~~iya~~TG~~~e~  176 (205)
T 4gm2_A           97 SDVYTYCLGKAYGIACILASSGKKGYRFSLKNSSFCLNQSYSIIPFNQATNIEIQNKEIMNTKKKVIEIISKNTEKDTNV  176 (205)
T ss_dssp             SCEEEEEEEEEETHHHHHHTTSCTTCEEECTTCEEEECCCCCCCCSSCCSCHHHHHHHHHHHHHHHHHHHHHHHTCCHHH
T ss_pred             CCEEEEEEeeehhHHHHHHhcCCCCCEEecCCCEEEEecCcccccccCHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHH
Confidence            99999999999999999999999999999999999999999998 99999999999999999999999999999999999


Q ss_pred             HHhhhcCCceecHHHHHHcCCceeecCC
Q 020205          233 IELDTDRDNFMDAWEAKEYGLVDAVIDD  260 (329)
Q Consensus       233 I~~l~d~d~~lta~EAve~GLID~I~~~  260 (329)
                      |.++|++++||+|+||++|||||+|++.
T Consensus       177 I~~~m~rd~~msa~EA~eyGlID~V~~~  204 (205)
T 4gm2_A          177 ISNVLERDKYFNADEAVDFKLIDHILEK  204 (205)
T ss_dssp             HHHHTTSCEEEEHHHHHHTTSCSEECCC
T ss_pred             HHHHhcCCcccCHHHHHHcCCccEeecC
Confidence            9999999999999999999999999874
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 329
d1yg6a1183 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Es 6e-76
d2cbya1179 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {My 2e-65
d1tg6a1193 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Hum 1e-64
d1y7oa1192 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Str 6e-54
d2f6ia1190 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {P 7e-53
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Clp protease, ClpP subunit
domain: Clp protease, ClpP subunit
species: Escherichia coli [TaxId: 562]

 Score =  229 bits (584), Expect = 6e-76
 Identities = 99/173 (57%), Positives = 136/173 (78%)

Query: 87  DTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIY 146
           D  + LL++R+IFL  QV+D  A+ I++Q+LFL+AE+ +KDI L+INSPGG +TAGM IY
Sbjct: 8   DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIY 67

Query: 147 DAMKLCKADVSTICLGLAASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSI 206
           D M+  K DVSTIC+G AASMGAFLL AG+KGKR+C+PN+RVMIHQPLG   G+ATD+ I
Sbjct: 68  DTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEI 127

Query: 207 RIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMDAWEAKEYGLVDAVID 259
             RE+   K ++N++++  TG+ ++QIE DT+RD F+ A EA EYGLVD+++ 
Sbjct: 128 HAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILT 180
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 193 Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Length = 192 Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 100.0
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 100.0
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 100.0
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 100.0
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 100.0
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 98.67
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 98.61
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 98.59
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.59
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 98.58
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 98.57
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.53
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 98.5
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 98.46
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 98.45
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.42
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 98.34
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 98.32
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 98.3
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 98.08
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 97.97
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 97.77
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 97.53
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 97.45
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 97.37
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 97.24
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 96.38
d1uyra2404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 95.77
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 95.14
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 95.05
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 93.54
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 93.19
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 92.7
d1fc6a4294 Photosystem II D1 C-terminal processing protease { 84.26
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Clp protease, ClpP subunit
domain: Clp protease, ClpP subunit
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]

Probab=100.00  E-value=5.8e-48  Score=345.35  Aligned_cols=176  Identities=45%  Similarity=0.747  Sum_probs=172.2

Q ss_pred             cCChhhhhhcCcEEEEccccChhHHHHHHHHHHhhhhcCCCCCeEEEEeCCCCchhHHHHHHHHHHhcCCCeEEEEcccc
Q 020205           85 ELDTTNMLLRQRIIFLGSQVDDLTADFIISQLLFLDAEDSKKDIRLFINSPGGSVTAGMGIYDAMKLCKADVSTICLGLA  164 (329)
Q Consensus        85 ~~di~~~ll~~rII~l~g~Id~~~a~~ii~~L~~l~~~~~~k~I~L~INSPGGsV~ag~aIyd~Ir~~~~pV~t~v~G~A  164 (329)
                      ++|+|++|+++|||||+|+|++.+++.++++|++++.+++.++|.|+||||||+|++|++|||+|+.++.||+|+|.|.|
T Consensus        16 ~~Di~s~l~~~Riifl~g~I~~~~~~~~i~~l~~l~~~~~~~~I~l~InS~GG~v~~g~~i~d~i~~~~~~V~tv~~G~a   95 (193)
T d1tg6a1          16 AYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQA   95 (193)
T ss_dssp             -CBHHHHHHTTTEEEEESSBCHHHHHHHHHHHHHHHHHCSSSCEEEEEEECCBCHHHHHHHHHHHHHSCSCEEEEEEEEE
T ss_pred             hhhHhHHHhccCEEEECCEEchHHHHHHHHHHHHhcccCCCcEEEEEeecCcccHHHHHHHHHHHHhhcCceEEEEccch
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHhcCCCCcEEEecCceEEEeccCCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHhhhcCCceec
Q 020205          165 ASMGAFLLAAGSKGKRYCMPNARVMIHQPLGTAGGKATDMSIRIREMSYHKVKLNKILSRATGKPVQQIELDTDRDNFMD  244 (329)
Q Consensus       165 ASaas~Ia~AGdkg~R~a~PnS~imIHqp~~~~~G~~~dl~~~a~el~~~~~~i~~iya~~tG~s~e~I~~l~d~d~~lt  244 (329)
                      ||+|++|++||++|+|++.|||++|+|||+++..|++.|+..+++++.+.++.+.++|+++||++.+++++++++|+||+
T Consensus        96 aS~a~~il~aG~~g~R~~~pns~~miHq~~~~~~G~~~di~~~~~el~~~~~~i~~i~a~~Tg~~~~~i~~~~~rD~~lt  175 (193)
T d1tg6a1          96 ASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMS  175 (193)
T ss_dssp             ETHHHHHHHTSCTTCEEECTTCEEEECCCCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHSSCEEEC
T ss_pred             HHHHHHHhhcCccCccccCcccHHHhcCCccCCCcCHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHhccCccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCceeecCC
Q 020205          245 AWEAKEYGLVDAVIDD  260 (329)
Q Consensus       245 a~EAve~GLID~I~~~  260 (329)
                      |+||++|||||+|++.
T Consensus       176 a~EAl~yGliD~Ii~~  191 (193)
T d1tg6a1         176 PMEAQEFGILDKVLVH  191 (193)
T ss_dssp             HHHHHHHTSCSEECSS
T ss_pred             HHHHHHcCCCCEEccC
Confidence            9999999999999875
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure