Citrus Sinensis ID: 021718

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MERKPLAAAQTNREYEKFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLGNNKWSSFSKEFPISSNYDFNEISAKFEGGKLFIKHPKIITPADHQQEEKPQAQAVTEAPKPQKPESDYSEAHQKREQDQQAATATQQVISPPSAAGTNGPEKSGKVDRPRKSTIAEKQSSRKANNNEEAKAASVEAKITATQKNKHLAEEVKSTSGARETVEKDKKVVDYDAAASAEAGKEAAGSLNERASKYRTEDLKQALGGWVMELKQPRKIMNFTVAILLVLVVYIYAKNAIGYIGKSKN
cccccccccccccccccccccccEEEcccEEEEEEEcccccccccEEEEEcccEEEEEEEEEccccEEEEEEEEEEcccccccccEEEEEEccEEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccc
cccccccccccccEEHccccccccEccccccEEEEEcccccccEEEEEEEcccEEEEEcccccccccEEEEEEEccccccccccHEEEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccHHHHHHccccccHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
merkplaaaqtnreyekfepstewaredEFDTLIvnlpgfrkeQLKVQVTTSKkmrisgerplgnnkwssfskefpissnydfneisakfeggklfikhpkiitpadhqqeekpqaqavteapkpqkpesdyseAHQKREQDQQAATATqqvisppsaagtngpeksgkvdrprkstiaEKQSSRKANNNEEAKAASVEAKITATQKNKHLAEEVkstsgaretvekdkkvvdyDAAASAEAGKEAAGSLNERASKYRTEDLKQALGGWVMELKQPRKIMNFTVAILLVLVVYIYAKNAigyigkskn
merkplaaaqtnreyekfepstewareDEFDTLIvnlpgfrkeqLKVQvttskkmrisgerplgnnkwssfskEFPISSNYDFNEISAKFEGGKLFIKHPKIITPADHQQEEKPQAQAVTEAPKPQKPESDYSEAHQKREQDQQAATATQqvisppsaagtngpeksgkvdrprkstiaekqssrkannneeakaasveakitatqknkhlaeevkstsgaretvekdkkvVDYDAAAsaeagkeaagslneraskyrTEDLKQALGGWVMELKQPRKIMNFTVAILLVLVVYIYAKnaigyigkskn
MERKPLAAAQTNREYEKFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLGNNKWSSFSKEFPISSNYDFNEISAKFEGGKLFIKHPKIITPADHQQEEKPQAQAVTEAPKPQKPESDYSEAHQKREqdqqaatatqqVISPPSAAGTNGPEKSGKVDRPRKSTIAEKQSSRkannneeakaasveakITATQKNKHLAEEVKSTSGARETVEKDKKVVDYDaaasaeagkeaagsLNERASKYRTEDLKQALGGWVMELKQPRKIMNFTvaillvlvvyiyaKNAIGYIGKSKN
***************************DEFDTLIVNLPGFRKEQLKV***************************FPISSNYDFNEISAKFEGGKLFIKHPKII**************************************************************************************************************************************************************LKQALGGWVMELKQPRKIMNFTVAILLVLVVYIYAKNAIGYIG****
****************KFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGE******KWSSFSKEFPISSNYDFNEISAKFEGGKLFIK*******************************************************************************************************************************************************************************K**RKIMNFTVAILLVLVVYIYAKN**********
***********************WAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLGNNKWSSFSKEFPISSNYDFNEISAKFEGGKLFIKHPKIITPAD******************************************************************************************VEAKIT**********************EKDKKVVDYDAA************LNERASKYRTEDLKQALGGWVMELKQPRKIMNFTVAILLVLVVYIYAKNAIGYIGKSKN
*********QTNREYEKFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLGNNKWSSFSKEFPISSNYDFNEISAKFEGGKLFIKHPKII******************************************************************************************************************************************************ASKYRTEDLKQALGGWVMELKQPRKIMNFTVAILLVLVVYIYAKNAIG*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERKPLAAAQTNREYEKFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLGNNKWSSFSKEFPISSNYDFNEISAKFEGGKLFIKHPKIITPADHQQEEKPQAQAVTEAPKPQKPESDYSEAHQKREQDQQAATATQQVISPPSAAGTNGPEKSGKVDRPRKSTIAEKQSSRKAxxxxxxxxxxxxxxxxxxxxxKHLAEEVKSTSGARETVEKDKKVVDYDAAASAEAGKEAAGSLNERASKYRTEDLKQALGGWVMELKQPRKIMNFTVAILLVLVVYIYAKNAIGYIGKSKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q7XUW5215 23.2 kDa heat shock prote no no 0.262 0.376 0.270 2e-05
P19244197 22.7 kDa class IV heat sh N/A no 0.331 0.517 0.258 2e-05
P13853157 17.6 kDa class I heat sho no no 0.295 0.579 0.302 7e-05
P30236192 22.0 kDa class IV heat sh no no 0.288 0.463 0.267 0.0001
P04794154 17.5 kDa class I heat sho no no 0.295 0.590 0.275 0.0001
O49710134 15.4 kDa class V heat sho no no 0.324 0.746 0.297 0.0003
>sp|Q7XUW5|HS232_ORYSJ 23.2 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP23.2 PE=2 SV=2 Back     alignment and function desciption
 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 15/96 (15%)

Query: 22  TEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPL--------GNNKW----- 68
            +W    +   ++V++PG RKE L+V+V  ++ +RISGER          G + W     
Sbjct: 78  VDWRETGDAHEVVVDVPGMRKEDLRVEVEDNRVLRISGERRREETTEQKGGGDHWHREER 137

Query: 69  --SSFSKEFPISSNYDFNEISAKFEGGKLFIKHPKI 102
               F ++  +  N D + I+A  + G L ++  K+
Sbjct: 138 SYGRFWRQLRLPDNADLDSIAASLDNGVLTVRFRKL 173

Oryza sativa subsp. japonica (taxid: 39947)
>sp|P19244|HSP41_PEA 22.7 kDa class IV heat shock protein OS=Pisum sativum GN=HSP22.7 PE=2 SV=1 Back     alignment and function description
>sp|P13853|HS17C_ARATH 17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2 Back     alignment and function description
>sp|P30236|HSP41_SOYBN 22.0 kDa class IV heat shock protein OS=Glycine max GN=HSP22.0 PE=3 SV=1 Back     alignment and function description
>sp|P04794|HSP14_SOYBN 17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1 Back     alignment and function description
>sp|O49710|HS154_ARATH 15.4 kDa class V heat shock protein OS=Arabidopsis thaliana GN=HSP15.4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
224132136323 predicted protein [Populus trichocarpa] 0.980 0.934 0.361 5e-42
224131690323 predicted protein [Populus trichocarpa] 0.938 0.894 0.368 2e-41
224102963271 predicted protein [Populus trichocarpa] 0.873 0.992 0.396 2e-37
255549593262 small heat-shock protein, putative [Rici 0.811 0.954 0.381 3e-36
255549591264 small heat-shock protein, putative [Rici 0.730 0.852 0.387 2e-33
255549589255 small heat-shock protein, putative [Rici 0.711 0.858 0.411 4e-29
224102961208 predicted protein [Populus trichocarpa] 0.405 0.600 0.519 4e-29
296084003315 unnamed protein product [Vitis vinifera] 0.918 0.898 0.327 3e-28
15209175247 Hsp20/alpha crystallin family protein [S 0.759 0.947 0.315 1e-27
15209179247 Hsp20/alpha crystallin family protein [S 0.772 0.963 0.299 2e-27
>gi|224132136|ref|XP_002328194.1| predicted protein [Populus trichocarpa] gi|222837709|gb|EEE76074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  177 bits (449), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 175/329 (53%), Gaps = 27/329 (8%)

Query: 1   MERKPLAAAQTNREYEKFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGE 60
           ME KP   A   R +E+FEPS +W RE   DTL + LPGF+KEQLKVQVT+S+ +R+SGE
Sbjct: 1   MESKPNGNAAAARVHEEFEPSIDWVRETGADTLRIYLPGFKKEQLKVQVTSSRVLRVSGE 60

Query: 61  RPLGNNKWSSFSKEFPISSNYDFNEISAKFEGGKLFIKHPKIITPADHQQEEKPQAQAVT 120
           R L  N+WS+F KE PISSNYD NEI+A+FE G L++K PKII P   + +E  QA++  
Sbjct: 61  RQLSGNRWSTFRKEIPISSNYDTNEIAARFEKGILYVKQPKIIVPDAPKPQE--QARSPV 118

Query: 121 EAPK-PQKPESDYSEAH--QKREQDQQAATATQQVISPPSAAGTNG-------PEKSGKV 170
           EA K  QKP  + ++    Q   + +Q +++ +  + PPS + T         P    + 
Sbjct: 119 EASKNDQKPAQENAQPPPIQAPGKPEQKSSSVEGKVEPPSESATKPKKQPQEKPASEQQP 178

Query: 171 DRPRKSTIAEKQSSRKANNNE-----------EAKAASVEAKITATQKNKHLAEEVKSTS 219
           + P      EKQ   K    E           E      E    +T+  +  A+ + +TS
Sbjct: 179 EDPVAKVGMEKQMGGKIEGAEDDNLSPRTPRKEKDPVKYEWNEKSTKNGQDEAKGIATTS 238

Query: 220 GARETVEKDKKVVDYDAAASAEAGKEAAGSLNERASKYRTEDLKQALGGWVMELKQPRKI 279
            +     K + +VD    ++    ++A   L     K R E  K+   G VM++K+PR +
Sbjct: 239 KS----SKPENLVDSSLDSTNLVKEKAEKGLLSGTEKLRMESYKKDFSGLVMDMKKPRTL 294

Query: 280 MNFTVAILLVLVVYIYAKNAIGYIGKSKN 308
           +N  + IL + V+ IY +NAI  + KS N
Sbjct: 295 VNLVLVILFITVLGIYGRNAIRSLKKSDN 323

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224131690|ref|XP_002328084.1| predicted protein [Populus trichocarpa] gi|222837599|gb|EEE75964.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102963|ref|XP_002312872.1| predicted protein [Populus trichocarpa] gi|222849280|gb|EEE86827.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255549593|ref|XP_002515848.1| small heat-shock protein, putative [Ricinus communis] gi|223545003|gb|EEF46517.1| small heat-shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255549591|ref|XP_002515847.1| small heat-shock protein, putative [Ricinus communis] gi|223545002|gb|EEF46516.1| small heat-shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255549589|ref|XP_002515846.1| small heat-shock protein, putative [Ricinus communis] gi|223545001|gb|EEF46515.1| small heat-shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224102961|ref|XP_002312871.1| predicted protein [Populus trichocarpa] gi|222849279|gb|EEE86826.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296084003|emb|CBI24391.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15209175|gb|AAK91893.1|AC091627_6 Hsp20/alpha crystallin family protein [Solanum demissum] Back     alignment and taxonomy information
>gi|15209179|gb|AAK91897.1|AC091627_10 Hsp20/alpha crystallin family protein [Solanum demissum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
TAIR|locus:2045144224 AT2G27140 "AT2G27140" [Arabido 0.412 0.566 0.458 2.5e-28
TAIR|locus:2147137249 AT5G20970 "AT5G20970" [Arabido 0.405 0.502 0.407 2.8e-27
TAIR|locus:2175438366 RTM2 "AT5G04890" [Arabidopsis 0.412 0.346 0.374 1.7e-15
TAIR|locus:2020033183 AT1G54400 "AT1G54400" [Arabido 0.314 0.530 0.363 3.1e-12
TAIR|locus:2174269161 HSP18.2 "heat shock protein 18 0.347 0.664 0.309 4.8e-08
TAIR|locus:2024862157 AT1G53540 [Arabidopsis thalian 0.292 0.573 0.333 1.8e-07
TAIR|locus:2075805 490 AT3G10680 "AT3G10680" [Arabido 0.318 0.2 0.297 1.4e-06
TAIR|locus:2042977153 AT2G29500 "AT2G29500" [Arabido 0.327 0.660 0.283 1.4e-06
TAIR|locus:2075256156 HSP17.4 "heat shock protein 17 0.292 0.576 0.305 1.8e-06
TAIR|locus:2141632134 AT4G21870 [Arabidopsis thalian 0.305 0.701 0.313 1.8e-06
TAIR|locus:2045144 AT2G27140 "AT2G27140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 291 (107.5 bits), Expect = 2.5e-28, Sum P(2) = 2.5e-28
 Identities = 60/131 (45%), Positives = 78/131 (59%)

Query:     9 AQTNREYEKFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLGNNKW 68
             A  NR Y++FEP + W  E  F+ L + LPGFRKEQLKVQVTT++K+R+ G+RP G NKW
Sbjct:     8 ANANRIYDEFEPLSNWKTEQGFEALTIYLPGFRKEQLKVQVTTTRKLRVMGDRPAGANKW 67

Query:    69 SSFSKEFPISSNYDFNEISAKFEGGKLFIKHPKIITPADHQQEEKPQAQAVTEAPKPQK- 127
               F KEFPI  N D + +SAKFEG  L ++ P+   P   Q    P   A    P P++ 
Sbjct:    68 IRFRKEFPIPPNIDVDSVSAKFEGANLVVRLPRT-EPMGKQPS--PIGTATKPPPVPKEN 124

Query:   128 PESDYSEAHQK 138
             P      A +K
Sbjct:   125 PNLPSPSAKEK 135
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0009408 "response to heat" evidence=ISS;RCA
GO:0016020 "membrane" evidence=IDA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2147137 AT5G20970 "AT5G20970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175438 RTM2 "AT5G04890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020033 AT1G54400 "AT1G54400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174269 HSP18.2 "heat shock protein 18.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024862 AT1G53540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075805 AT3G10680 "AT3G10680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042977 AT2G29500 "AT2G29500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075256 HSP17.4 "heat shock protein 17.4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141632 AT4G21870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_66000056
hypothetical protein (323 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 5e-11
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 1e-10
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain 1e-09
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 8e-06
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 2e-05
PRK05035695 PRK05035, PRK05035, electron transport complex pro 0.004
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information 
 Score = 57.6 bits (140), Expect = 5e-11
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 24  WAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLGNNK---WSSFSKEFPISSN 80
           W + D+   + V+LPG +KE +KV+V     + ISG+R     +   +  F + F +  +
Sbjct: 1   WYQTDDEVVVTVDLPGVKKEDIKVEVE-DNVLTISGKREEEEERERSYGEFERSFELPED 59

Query: 81  YDFNEISAKFEGGKLFIKHPK 101
            D  +  A  E G L I  PK
Sbjct: 60  VDPEKSKASLENGVLEITLPK 80

sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is this ACD. sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps. p23 is a cochaperone of the Hsp90 chaperoning pathway. It binds Hsp90 and participates in the folding of a number of Hsp90 clients including the progesterone receptor. p23 also has a passive chaperoning activity. p23 in addition may act as the cytosolic prostaglandin E2 synthase. Included in this family is the p23-like C-terminal CHORD-SGT1 (CS) domain of suppressor of G2 allele of Skp1 (Sgt1) and the p23-like domains of human butyrate-induced transcript 1 (hB-ind1), NUD (nuclear distribution) C, Melusin, and NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR). Length = 80
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.85
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.83
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.82
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.81
PRK11597142 heat shock chaperone IbpB; Provisional 99.81
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.81
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.8
PRK10743137 heat shock protein IbpA; Provisional 99.8
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.79
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.79
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.79
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.78
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.78
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.76
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.75
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.73
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.72
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.71
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.62
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.5
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.46
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.43
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.15
cd0646384 p23_like Proteins containing this p23_like domain 98.82
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 98.61
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.56
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 98.44
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 97.99
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 97.7
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 97.65
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 97.51
cd0646892 p23_CacyBP p23_like domain found in proteins simil 97.28
cd0648887 p23_melusin_like p23_like domain similar to the C- 97.22
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 97.19
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 96.55
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 96.43
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.15
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 94.98
KOG1309196 consensus Suppressor of G2 allele of skp1 [Signal 94.97
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 93.94
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 91.42
PF14913194 DPCD: DPCD protein family 89.07
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information 
Probab=99.85  E-value=4.9e-21  Score=151.24  Aligned_cols=81  Identities=32%  Similarity=0.576  Sum_probs=73.6

Q ss_pred             ceeeEEcCCeEEEEEEcCCCCCCCcEEEEEeCceEEEEEEeecC-----------CceeeEEEEEEECCCCcccCceEEE
Q 021718           21 STEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLG-----------NNKWSSFSKEFPISSNYDFNEISAK   89 (308)
Q Consensus        21 ~vDI~Etdd~yvI~vdLPGfkkEdI~V~V~d~~~L~IsGer~~~-----------e~~~grF~R~f~LP~nVD~d~IsA~   89 (308)
                      .+||+|+++.|+|.++||||++++|.|++.+++.|+|+|++...           ++.+++|.|+|.||.+||.+.|+|+
T Consensus         1 ~~dv~E~~~~~~i~~~lPGv~~edi~i~v~~~~~L~I~g~~~~~~~~~~~~~~~~e~~~g~f~r~i~LP~~v~~~~i~A~   80 (92)
T cd06472           1 RVDWKETPEAHVFKADVPGVKKEDVKVEVEDGRVLRISGERKKEEEKKGDDWHRVERSSGRFVRRFRLPENADADEVKAF   80 (92)
T ss_pred             CccEEEcCCeEEEEEECCCCChHhEEEEEeCCCEEEEEEEecccccccCCCEEEEEEeccEEEEEEECCCCCCHHHCEEE
Confidence            47999999999999999999999999999974689999997542           2346789999999999999999999


Q ss_pred             EeCCEEEEEEeC
Q 021718           90 FEGGKLFIKHPK  101 (308)
Q Consensus        90 feNGVLtItlPK  101 (308)
                      |.||||+|++||
T Consensus        81 ~~nGvL~I~lPK   92 (92)
T cd06472          81 LENGVLTVTVPK   92 (92)
T ss_pred             EECCEEEEEecC
Confidence            999999999998

sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. ScHsp26 is temperature-regulated, it switches from an inactive to a chaperone-active form upon elevation in temperature. It associates into large 24-mers storage forms which upon heat shock disassociate into dimers. These dimers initiate the interaction with non-native substrate proteins and re-assemble into large globular assemblies having one monomer of substrate bound per dimer. This group also contains Arabidopsis thaliana (Ath) Hsp15.7, a peroxisomal matrix protein which can complement the morphological phenotype of S. cerevisiae mutants deficient in Hsps26. AthHsp15.7 is minimally expressed under normal conditions and is strongly induced by heat and oxidative st
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>PF14913 DPCD: DPCD protein family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 1e-07
1gme_A151 Heat shock protein 16.9B; small heat shock protein 1e-07
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 5e-07
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 3e-06
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 5e-06
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 1e-05
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 2e-05
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 4e-05
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 1e-04
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 1e-04
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure
 Score = 48.8 bits (117), Expect = 1e-07
 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 8/95 (8%)

Query: 15  YEKFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPL-GNNKW----- 68
           YE   P  +   E  +  ++ +L GF KE++K +V+   ++ I  ER +           
Sbjct: 20  YELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQR 79

Query: 69  -SSFSKEFPISSNYDFNE-ISAKFEGGKLFIKHPK 101
                K   +  N   +  IS K+E G L I+ P 
Sbjct: 80  PKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPI 114
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Length = 85 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.89
4fei_A102 Heat shock protein-related protein; stress respons 99.89
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.84
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.83
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.83
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.82
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.82
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.82
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.77
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.74
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.74
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.63
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 98.86
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 98.84
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.91
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.76
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 97.71
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 97.46
3igf_A374 ALL4481 protein; two-domained protein consisting o 97.24
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 97.23
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 97.23
2o30_A131 Nuclear movement protein; MCSG, structural genomic 97.21
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 97.15
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 97.1
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 97.03
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 96.75
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 96.58
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
Probab=99.89  E-value=7.5e-23  Score=161.66  Aligned_cols=86  Identities=28%  Similarity=0.443  Sum_probs=79.5

Q ss_pred             cCCCceeeEEcCCeEEEEEEcCCCCCCCcEEEEEeCceEEEEEEeecC-----------CceeeEEEEEEECCCCcccCc
Q 021718           17 KFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLG-----------NNKWSSFSKEFPISSNYDFNE   85 (308)
Q Consensus        17 d~eP~vDI~Etdd~yvI~vdLPGfkkEdI~V~V~d~~~L~IsGer~~~-----------e~~~grF~R~f~LP~nVD~d~   85 (308)
                      .|.|++||+++++.|+|.++||||++++|+|++.+ +.|+|+|++...           ++.+++|.|+|.||.+||.+.
T Consensus         2 ~~~P~~di~e~~~~~~v~~~lPG~~~edi~v~~~~-~~L~I~g~~~~~~~~~~~~~~~~er~~g~f~r~~~LP~~vd~~~   80 (100)
T 3gla_A            2 QWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDK-GILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADG   80 (100)
T ss_dssp             CSCCCEEEEECSSEEEEEEECTTSCGGGCEEEEET-TEEEEEEEECCGGGSSGGGEEEECCCCEEEEEEEECCTTBCTTS
T ss_pred             CccCcEEEEECCCEEEEEEECCCCCHHHEEEEEEC-CEEEEEEEEcCcCccCCccEEEEeecceEEEEEEECCCCcChHH
Confidence            69999999999999999999999999999999998 799999998652           345778999999999999999


Q ss_pred             eEEEEeCCEEEEEEeCcC
Q 021718           86 ISAKFEGGKLFIKHPKII  103 (308)
Q Consensus        86 IsA~feNGVLtItlPK~~  103 (308)
                      |+|+|+||||+|++||..
T Consensus        81 i~A~~~~GvL~I~~pK~~   98 (100)
T 3gla_A           81 ITAAGRNGVLEIRIPKRP   98 (100)
T ss_dssp             CEEEEETTEEEEEEEBC-
T ss_pred             eEEEEeCCEEEEEEecCC
Confidence            999999999999999965
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 2e-09
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 1e-05
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

 Score = 53.2 bits (127), Expect = 2e-09
 Identities = 26/113 (23%), Positives = 44/113 (38%), Gaps = 18/113 (15%)

Query: 18  FEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGER-----------PLGNN 66
                +W    E      +LPG +KE++KV+V     + +SGER                
Sbjct: 41  ANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVER 100

Query: 67  KWSSFSKEFPISSNYDFNEISAKFEGGKLFIKHPKIITPADHQQEEKPQAQAV 119
               F + F +  +    E+ A  E G L +  PK        + +KP+ +A+
Sbjct: 101 SSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKA-------EVKKPEVKAI 146
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.83
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.82
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 98.05
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 97.01
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 96.43
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 96.25
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 96.1
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

Probab=99.83  E-value=1.6e-20  Score=157.22  Aligned_cols=89  Identities=26%  Similarity=0.451  Sum_probs=78.7

Q ss_pred             cCCCceeeEEcCCeEEEEEEcCCCCCCCcEEEEEeCceEEEEEEeecC-----------CceeeEEEEEEECCCCcccCc
Q 021718           17 KFEPSTEWAREDEFDTLIVNLPGFRKEQLKVQVTTSKKMRISGERPLG-----------NNKWSSFSKEFPISSNYDFNE   85 (308)
Q Consensus        17 d~eP~vDI~Etdd~yvI~vdLPGfkkEdI~V~V~d~~~L~IsGer~~~-----------e~~~grF~R~f~LP~nVD~d~   85 (308)
                      .+.|.+||.++++.|+|.++||||+++||.|++++++.|+|+|++...           ++.+++|.|+|.||.+||.++
T Consensus        40 ~~~p~~dv~e~~~~~~i~~~lPG~~~edi~v~v~~~~~l~i~~~~~~~~~~~~~~~~~~e~~~~~f~r~~~LP~~vd~~~  119 (150)
T d1gmea_          40 FANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEE  119 (150)
T ss_dssp             HGGGCEEEEECSSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCCCCCCTTCEEEECCCCCCCEEEEEECSSCCCGGG
T ss_pred             cCCCceeEEECCCEEEEEEEeCCCccCCEEEEEEEccceeEEEEEecccccccceeeeeeeccceEEEEEECCCCeeece
Confidence            356899999999999999999999999999999975689999987652           234567999999999999999


Q ss_pred             eEEEEeCCEEEEEEeCcCCC
Q 021718           86 ISAKFEGGKLFIKHPKIITP  105 (308)
Q Consensus        86 IsA~feNGVLtItlPK~~~p  105 (308)
                      |+|+|+||||+|++||....
T Consensus       120 i~A~~~nGvL~I~lpK~~~~  139 (150)
T d1gmea_         120 VKAGLENGVLTVTVPKAEVK  139 (150)
T ss_dssp             CEEEEETTEEEEEEECCCCC
T ss_pred             eEEEEECCEEEEEEEcCCcC
Confidence            99999999999999997643
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure