Citrus Sinensis ID: 021775

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MAAALRSFLKKRALTCSEPMLMRRLVSSQPAPVDSSSFAQRLRDLPKDLPATNIKRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSSIANAQTITLP
cHHHHHHHHHHHHcccccHHHHHHHccccccccccHHHHHHHHcccccccccccccHHHHHHcccccEEccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHccEEEEEccccccHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHcccEEEcccccccccHHHHHHcHHHHHHHcccccccEEEEccccccccccHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccccEEEEEccHHHHHHcccc
cHHHHHHHcccccccccccHHHHHHccccccccccccccccHccccccccccHHHHHHHHHHccccEEEEEccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHccccccccccEEEccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHcHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccHHHccEEEEEccHHHHHHHccc
MAAALRSFLKKRaltcsepmLMRRlvssqpapvdsssFAQRLrdlpkdlpatnikrdvsqligrtpLVFLNKVSEGCGAYIAVKQEmfqptasikdrpavamledaenknlispgkttiieptsgnmgISMAFMAAMKGYKMvltmpsytslERRVTMRAFGadliltdpakgmggtVKKAQELLEStpnafmlqqfsnpantrvhfettgpeiwedtmgQVDIFVMGigsggtvsgvgqylksqnpnvkiygvepaesnilnggkpgphlitgngvgfkpdildMDVMEKVLEVSSIAnaqtitlp
MAAALRSFLkkraltcsepMLMRRLVssqpapvdsssFAQRLrdlpkdlpatnikrdvsqligrtpLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDaenknlispgkttiieptsgNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLiltdpakgmgGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVssianaqtitlp
MAAALRSFLKKRALTCSEPMLMRRLVSSQPAPVDSSSFAQRLRDLPKDLPATNIKRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSSIANAQTITLP
*****************************************************IKRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPT*************************TTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGM****************AFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSSI*********
****************************************************NIKRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSSIANAQTITLP
MAAALRSFLKKRALTCSEPMLMRRL***********SFAQRLRDLPKDLPATNIKRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSSIANAQTITLP
********************************************LPKDLPATNIKRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSSIANAQT*T**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAALRSFLKKRALTCSEPMLMRRLVSSQPAPVDSSSFAQRLRDLPKDLPATNIKRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSSIANAQTITLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query307 2.2.26 [Sep-21-2011]
Q1KLZ1375 L-3-cyanoalanine synthase N/A no 0.957 0.784 0.826 1e-136
Q1KLZ2376 L-3-cyanoalanine synthase N/A no 0.957 0.781 0.805 1e-134
Q76MX2351 Bifunctional L-3-cyanoala N/A no 0.885 0.774 0.834 1e-129
Q9S757368 Bifunctional L-3-cyanoala yes no 0.951 0.793 0.767 1e-128
Q9FS29347 Bifunctional L-3-cyanoala N/A no 0.879 0.778 0.766 1e-122
Q43153368 Bifunctional L-3-cyanoala N/A no 0.944 0.788 0.770 1e-120
P32260383 Cysteine synthase, chloro N/A no 0.869 0.697 0.595 7e-88
O81155386 Cysteine synthase, chloro N/A no 0.843 0.670 0.599 2e-87
Q43317325 Cysteine synthase OS=Citr N/A no 0.830 0.784 0.572 1e-82
O23733322 Cysteine synthase OS=Bras N/A no 0.804 0.767 0.591 1e-82
>sp|Q1KLZ1|CAS2_MALDO L-3-cyanoalanine synthase 2, mitochondrial OS=Malus domestica GN=CAS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  483 bits (1243), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 247/299 (82%), Positives = 271/299 (90%), Gaps = 5/299 (1%)

Query: 3   AALRSFLKKRA-LTCSEPMLMRRLVS---SQPAPVDSSSFAQRLRDLPKDLPATNIKRDV 58
           AALRSFLKKR+ + C+   +  RL S   SQP P DS SFAQR+ +LPKDLPAT IK  V
Sbjct: 2   AALRSFLKKRSSVLCNGGAVRHRLFSAQVSQPIP-DSPSFAQRIGNLPKDLPATQIKTQV 60

Query: 59  SQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTT 118
           SQLIGRTP+V+LNKV+EGCGA+IAVKQEMFQPTASIKDRPA++M+ DAE K LI+PG+TT
Sbjct: 61  SQLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGETT 120

Query: 119 IIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTV 178
           +IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRV MR FGADLILTDP KGMGGTV
Sbjct: 121 LIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRCFGADLILTDPTKGMGGTV 180

Query: 179 KKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGV 238
           KKA +LLESTPNAFMLQQFSNPANT+VHFETTGPEIWEDT GQVDIFVMGIGSGGTVSGV
Sbjct: 181 KKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGV 240

Query: 239 GQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSS 297
           GQYLKS+NPNV+IYGVEPAESN+LNGGKPGPH ITGNGVGFKPDILDMD+ME+V+EV S
Sbjct: 241 GQYLKSKNPNVQIYGVEPAESNVLNGGKPGPHSITGNGVGFKPDILDMDMMERVIEVRS 299
Probably involved in the detoxification of cyanide that arises from ethylene biosynthesis in ripening fruits. Has only background level of in vitro cysteine synthase activity.
Malus domestica (taxid: 3750)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 9
>sp|Q1KLZ2|CAS1_MALDO L-3-cyanoalanine synthase 1, mitochondrial OS=Malus domestica GN=CAS1 PE=1 SV=1 Back     alignment and function description
>sp|Q76MX2|CAS1_SOLTU Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial OS=Solanum tuberosum GN=PCAS-1 PE=1 SV=1 Back     alignment and function description
>sp|Q9S757|CYSC1_ARATH Bifunctional L-3-cyanoalanine synthase/cysteine synthase C1, mitochondrial OS=Arabidopsis thaliana GN=CYSC1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FS29|CAS2_SOLTU Bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial OS=Solanum tuberosum GN=PCAS-2 PE=1 SV=1 Back     alignment and function description
>sp|Q43153|CYSC_SPIOL Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial OS=Spinacia oleracea GN=CYSC PE=1 SV=1 Back     alignment and function description
>sp|P32260|CYSKP_SPIOL Cysteine synthase, chloroplastic/chromoplastic OS=Spinacia oleracea GN=CYSK PE=1 SV=2 Back     alignment and function description
>sp|O81155|CYSKP_SOLTU Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 Back     alignment and function description
>sp|O23733|CYSK1_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
357507415380 Cysteine synthase [Medicago truncatula] 0.990 0.8 0.815 1e-142
224064041375 predicted protein [Populus trichocarpa] 0.918 0.752 0.886 1e-140
37719662370 beta-cyanoalanine synthase [Hevea brasil 0.954 0.791 0.833 1e-136
37719666370 beta-cyanoalanine synthase [Hevea brasil 0.954 0.791 0.833 1e-136
147809366371 hypothetical protein VITISV_028023 [Viti 0.957 0.792 0.827 1e-135
356531983373 PREDICTED: cysteine synthase, chloroplas 0.960 0.790 0.829 1e-135
225454278371 PREDICTED: cysteine synthase, chloroplas 0.957 0.792 0.827 1e-135
359489630389 PREDICTED: cysteine synthase, chloroplas 0.944 0.745 0.828 1e-134
164652579377 beta-cyanoalanine synthase [Manihot escu 0.957 0.779 0.816 1e-134
122179245375 RecName: Full=L-3-cyanoalanine synthase 0.957 0.784 0.826 1e-134
>gi|357507415|ref|XP_003623996.1| Cysteine synthase [Medicago truncatula] gi|355499011|gb|AES80214.1| Cysteine synthase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 257/315 (81%), Positives = 281/315 (89%), Gaps = 11/315 (3%)

Query: 3   AALRSFLKKR--------ALTCSEPMLMRRLVSSQPAPVDSSSFAQRLRDLPKDLPATNI 54
           A+L SFLK+         A+ C  PM+MRRL+++     DSSSFAQR+RDLPKDLP TNI
Sbjct: 2   ASLMSFLKRTSSSSSSSLAVACQHPMMMRRLMTTTATSADSSSFAQRIRDLPKDLPGTNI 61

Query: 55  KRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISP 114
           K+ VSQLIGRTPLV+LNKV+EGCGAYIAVKQEM QPTASIKDRPA+AM+EDAE KNLI+P
Sbjct: 62  KKHVSQLIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTASIKDRPALAMMEDAEKKNLITP 121

Query: 115 GKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGM 174
           GKT +IEPTSGNMGIS+AFMAAMKGYKMVLTMPSYTSLERRV MRAFGA+LILTDP KGM
Sbjct: 122 GKTILIEPTSGNMGISLAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGAELILTDPTKGM 181

Query: 175 GGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGT 234
           GGTVKKA +LLESTPNAFMLQQFSNPANT+VHFETTGPEIWEDT GQVDIFVMGIGSGGT
Sbjct: 182 GGTVKKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGIGSGGT 241

Query: 235 VSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLE 294
           VSGVGQYLKSQNPNVKIYGVEP+ESN+LNGGKPGPH ITGNGVGFKPDILDMDVMEKVLE
Sbjct: 242 VSGVGQYLKSQNPNVKIYGVEPSESNVLNGGKPGPHQITGNGVGFKPDILDMDVMEKVLE 301

Query: 295 VSS---IANAQTITL 306
           VSS   +  A+T+ L
Sbjct: 302 VSSEDAVNMARTLAL 316

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224064041|ref|XP_002301362.1| predicted protein [Populus trichocarpa] gi|222843088|gb|EEE80635.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|37719662|gb|AAP41851.1| beta-cyanoalanine synthase [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|37719666|gb|AAP41852.1| beta-cyanoalanine synthase [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|147809366|emb|CAN62383.1| hypothetical protein VITISV_028023 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356531983|ref|XP_003534555.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225454278|ref|XP_002276013.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 1 [Vitis vinifera] gi|297745315|emb|CBI40395.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489630|ref|XP_003633951.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|164652579|gb|ABY64889.1| beta-cyanoalanine synthase [Manihot esculenta] Back     alignment and taxonomy information
>gi|122179245|sp|Q1KLZ1.1|CAS2_MALDO RecName: Full=L-3-cyanoalanine synthase 2, mitochondrial; Short=MdCAS2; Flags: Precursor gi|93359261|gb|ABF13210.1| beta-cyanoalanine synthase 2 [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
UNIPROTKB|Q1KLZ1375 CAS2 "L-3-cyanoalanine synthas 0.957 0.784 0.785 4.6e-121
UNIPROTKB|Q1KLZ2376 CAS1 "L-3-cyanoalanine synthas 0.957 0.781 0.765 9.8e-119
UNIPROTKB|Q76MX2351 PCAS-1 "Bifunctional L-3-cyano 0.885 0.774 0.791 1e-114
TAIR|locus:2082837368 CYSC1 "cysteine synthase C1" [ 0.951 0.793 0.727 7.3e-114
UNIPROTKB|Q43153368 CYSC "Bifunctional L-3-cyanoal 0.856 0.714 0.787 1e-107
TAIR|locus:2080417433 OASC "O-acetylserine (thiol) l 0.798 0.565 0.555 2.1e-75
TAIR|locus:2130419322 OASA1 "O-acetylserine (thiol) 0.804 0.767 0.554 2.7e-75
TAIR|locus:2043964392 OASB "O-acetylserine (thiol) l 0.798 0.625 0.538 7.5e-73
TAIR|locus:2114804324 CYSD1 "cysteine synthase D1" [ 0.827 0.783 0.503 4.9e-69
TAIR|locus:2143814323 CYSD2 "cysteine synthase D2" [ 0.824 0.783 0.482 6.7e-65
UNIPROTKB|Q1KLZ1 CAS2 "L-3-cyanoalanine synthase 2, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
 Score = 1191 (424.3 bits), Expect = 4.6e-121, P = 4.6e-121
 Identities = 235/299 (78%), Positives = 259/299 (86%)

Query:     3 AALRSFLKKRA-LTCSEPMLMRRLVS---SQPAPVDSSSFAQRLRDLPKDLPATNIKRDV 58
             AALRSFLKKR+ + C+   +  RL S   SQP P DS SFAQR+ +LPKDLPAT IK  V
Sbjct:     2 AALRSFLKKRSSVLCNGGAVRHRLFSAQVSQPIP-DSPSFAQRIGNLPKDLPATQIKTQV 60

Query:    59 SQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTT 118
             SQLIGRTP+V+LNKV+EGCGA+IAVKQEMFQPTASIKDRPA++M+ DAE K LI+PG+TT
Sbjct:    61 SQLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGETT 120

Query:   119 IIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTV 178
             +IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRV MR FGADLILTDP KGMGGTV
Sbjct:   121 LIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRCFGADLILTDPTKGMGGTV 180

Query:   179 KKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMXXXXXXXXXXX 238
             KKA +LLESTPNAFMLQQFSNPANT+VHFETTGPEIWEDT GQVDIFVM           
Sbjct:   181 KKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGV 240

Query:   239 XQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSS 297
              QYLKS+NPNV+IYGVEPAESN+LNGGKPGPH ITGNGVGFKPDILDMD+ME+V+EV S
Sbjct:   241 GQYLKSKNPNVQIYGVEPAESNVLNGGKPGPHSITGNGVGFKPDILDMDMMERVIEVRS 299
GO:0009836 "fruit ripening, climacteric" evidence=IDA
GO:0050017 "L-3-cyanoalanine synthase activity" evidence=IDA
UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q76MX2 PCAS-1 "Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms
TAIR|locus:2082837 CYSC1 "cysteine synthase C1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q43153 CYSC "Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043964 OASB "O-acetylserine (thiol) lyase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0A535CYSK_MYCBO2, ., 5, ., 1, ., 4, 70.50610.79470.7870yesno
P0A534CYSK_MYCTU2, ., 5, ., 1, ., 4, 70.50610.79470.7870yesno
Q43153CYSC_SPIOL4, ., 4, ., 1, ., 90.77020.94460.7880N/Ano
Q9FS29CAS2_SOLTU4, ., 4, ., 1, ., 90.76610.87940.7780N/Ano
O32978CYSK_MYCLE2, ., 5, ., 1, ., 4, 70.48810.81430.8064yesno
Q7DDL5CYSK_NEIMB2, ., 5, ., 1, ., 4, 70.48200.81100.8032yesno
Q1KLZ2CAS1_MALDO4, ., 4, ., 1, ., 90.80530.95760.7819N/Ano
Q1KLZ1CAS2_MALDO4, ., 4, ., 1, ., 90.82600.95760.784N/Ano
Q76MX2CAS1_SOLTU4, ., 4, ., 1, ., 90.83450.88590.7749N/Ano
Q9S757CYSC1_ARATH4, ., 4, ., 1, ., 90.76760.95110.7934yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
PLN02556368 PLN02556, PLN02556, cysteine synthase/L-3-cyanoala 0.0
TIGR01136299 TIGR01136, cysKM, cysteine synthase 1e-120
cd01561291 cd01561, CBS_like, CBS_like: This subgroup include 1e-120
PLN02565322 PLN02565, PLN02565, cysteine synthase 1e-119
TIGR01139298 TIGR01139, cysK, cysteine synthase A 1e-113
COG0031300 COG0031, CysK, Cysteine synthase [Amino acid trans 1e-110
PLN00011323 PLN00011, PLN00011, cysteine synthase 1e-105
PLN03013429 PLN03013, PLN03013, cysteine synthase 1e-104
PRK10717330 PRK10717, PRK10717, cysteine synthase A; Provision 2e-79
PRK11761296 PRK11761, cysM, cysteine synthase B; Provisional 1e-75
TIGR01138290 TIGR01138, cysM, cysteine synthase B 8e-68
TIGR01137 454 TIGR01137, cysta_beta, cystathionine beta-synthase 4e-67
cd00640244 cd00640, Trp-synth-beta_II, Tryptophan synthase be 1e-64
TIGR03945304 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio 3e-62
pfam00291295 pfam00291, PALP, Pyridoxal-phosphate dependent enz 2e-56
PLN02356423 PLN02356, PLN02356, phosphateglycerate kinase 2e-33
COG1171347 COG1171, IlvA, Threonine dehydratase [Amino acid t 4e-24
cd01562304 cd01562, Thr-dehyd, Threonine dehydratase: The fir 1e-21
PRK06382 406 PRK06382, PRK06382, threonine dehydratase; Provisi 6e-17
TIGR01127 380 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, m 3e-16
PRK08198 404 PRK08198, PRK08198, threonine dehydratase; Provisi 7e-15
PRK08526 403 PRK08526, PRK08526, threonine dehydratase; Provisi 2e-14
PRK08639 420 PRK08639, PRK08639, threonine dehydratase; Validat 1e-13
TIGR02079 409 TIGR02079, THD1, threonine dehydratase 3e-13
TIGR01124 499 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, b 2e-12
cd01563324 cd01563, Thr-synth_1, Threonine synthase is a pyri 2e-12
PRK08638333 PRK08638, PRK08638, threonine dehydratase; Validat 3e-12
PRK12483 521 PRK12483, PRK12483, threonine dehydratase; Reviewe 5e-12
PRK06815317 PRK06815, PRK06815, hypothetical protein; Provisio 7e-12
PLN02550 591 PLN02550, PLN02550, threonine dehydratase 9e-12
PRK06608338 PRK06608, PRK06608, threonine dehydratase; Provisi 4e-11
PRK07334 403 PRK07334, PRK07334, threonine dehydratase; Provisi 2e-10
PRK06381319 PRK06381, PRK06381, threonine synthase; Validated 2e-10
PRK09224 504 PRK09224, PRK09224, threonine dehydratase; Reviewe 8e-10
TIGR02991317 TIGR02991, ectoine_eutB, ectoine utilization prote 2e-09
COG0498411 COG0498, ThrC, Threonine synthase [Amino acid tran 3e-09
TIGR00260328 TIGR00260, thrC, threonine synthase 1e-07
PRK05638 442 PRK05638, PRK05638, threonine synthase; Validated 1e-07
PRK06721352 PRK06721, PRK06721, threonine synthase; Reviewed 2e-07
PRK07048321 PRK07048, PRK07048, serine/threonine dehydratase; 4e-07
PRK06110322 PRK06110, PRK06110, hypothetical protein; Provisio 5e-07
PRK07476322 PRK07476, eutB, threonine dehydratase; Provisional 1e-06
PRK08197394 PRK08197, PRK08197, threonine synthase; Validated 2e-06
PRK08246310 PRK08246, PRK08246, threonine dehydratase; Provisi 2e-06
PRK06450338 PRK06450, PRK06450, threonine synthase; Validated 3e-06
PRK06352351 PRK06352, PRK06352, threonine synthase; Validated 8e-06
PLN02970328 PLN02970, PLN02970, serine racemase 1e-05
TIGR03528396 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammoni 0.001
PRK08206399 PRK08206, PRK08206, diaminopropionate ammonia-lyas 0.001
PRK08329347 PRK08329, PRK08329, threonine synthase; Validated 0.004
>gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information 
 Score =  532 bits (1371), Expect = 0.0
 Identities = 245/295 (83%), Positives = 268/295 (90%), Gaps = 4/295 (1%)

Query: 3   AALRSFLKKRALTCSEPMLMRRLVSSQPAPVDSSSFAQRLRDLPKDLPATNIKRDVSQLI 62
           AAL S LK+R+        +R+L     + V S SFAQRLRDLPKDLP T IK D SQLI
Sbjct: 2   AALLSRLKRRSSIPPSSHTLRKL----FSTVGSPSFAQRLRDLPKDLPGTKIKTDASQLI 57

Query: 63  GRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEP 122
           G+TPLV+LNKV+EGCGAYIA KQEMFQPT+SIKDRPA+AM+EDAE KNLI+PGKTT+IEP
Sbjct: 58  GKTPLVYLNKVTEGCGAYIAAKQEMFQPTSSIKDRPALAMIEDAEKKNLITPGKTTLIEP 117

Query: 123 TSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKAQ 182
           TSGNMGIS+AFMAAMKGYKM+LTMPSYTSLERRVTMRAFGA+L+LTDP KGMGGTVKKA 
Sbjct: 118 TSGNMGISLAFMAAMKGYKMILTMPSYTSLERRVTMRAFGAELVLTDPTKGMGGTVKKAY 177

Query: 183 ELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQYL 242
           ELLESTP+AFMLQQFSNPANT+VHFETTGPEIWEDT+GQVDIFVMGIGSGGTVSGVG+YL
Sbjct: 178 ELLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTLGQVDIFVMGIGSGGTVSGVGKYL 237

Query: 243 KSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSS 297
           KS+NPNVKIYGVEPAESN+LNGGKPGPH ITGNGVGFKPDILDMDVMEKVLEVSS
Sbjct: 238 KSKNPNVKIYGVEPAESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEKVLEVSS 292

Length = 368
>gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase Back     alignment and domain information
>gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase Back     alignment and domain information
>gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A Back     alignment and domain information
>gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase Back     alignment and domain information
>gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase Back     alignment and domain information
>gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional Back     alignment and domain information
>gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA Back     alignment and domain information
>gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase Back     alignment and domain information
>gnl|CDD|224092 COG1171, IlvA, Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107205 cd01562, Thr-dehyd, Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>gnl|CDD|180550 PRK06382, PRK06382, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|130197 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, medium form Back     alignment and domain information
>gnl|CDD|236182 PRK08198, PRK08198, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|181457 PRK08526, PRK08526, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|236318 PRK08639, PRK08639, threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|233712 TIGR02079, THD1, threonine dehydratase Back     alignment and domain information
>gnl|CDD|130194 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>gnl|CDD|107206 cd01563, Thr-synth_1, Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>gnl|CDD|236317 PRK08638, PRK08638, threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|237111 PRK12483, PRK12483, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|180709 PRK06815, PRK06815, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178165 PLN02550, PLN02550, threonine dehydratase Back     alignment and domain information
>gnl|CDD|235842 PRK06608, PRK06608, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|235994 PRK07334, PRK07334, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|235789 PRK06381, PRK06381, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|236417 PRK09224, PRK09224, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|132036 TIGR02991, ectoine_eutB, ectoine utilization protein EutB Back     alignment and domain information
>gnl|CDD|223572 COG0498, ThrC, Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|232896 TIGR00260, thrC, threonine synthase Back     alignment and domain information
>gnl|CDD|235539 PRK05638, PRK05638, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|136018 PRK06721, PRK06721, threonine synthase; Reviewed Back     alignment and domain information
>gnl|CDD|235918 PRK07048, PRK07048, serine/threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|235699 PRK06110, PRK06110, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236025 PRK07476, eutB, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|181283 PRK08197, PRK08197, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|181319 PRK08246, PRK08246, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|180565 PRK06450, PRK06450, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|180539 PRK06352, PRK06352, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|215524 PLN02970, PLN02970, serine racemase Back     alignment and domain information
>gnl|CDD|234245 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammonia-lyase Back     alignment and domain information
>gnl|CDD|236186 PRK08206, PRK08206, diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>gnl|CDD|236244 PRK08329, PRK08329, threonine synthase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 307
PRK07591421 threonine synthase; Validated 100.0
PRK08197394 threonine synthase; Validated 100.0
COG0031300 CysK Cysteine synthase [Amino acid transport and m 100.0
PLN03013429 cysteine synthase 100.0
PLN02556368 cysteine synthase/L-3-cyanoalanine synthase 100.0
PLN02565322 cysteine synthase 100.0
PLN02569484 threonine synthase 100.0
PRK08329347 threonine synthase; Validated 100.0
PRK06450338 threonine synthase; Validated 100.0
PRK06260397 threonine synthase; Validated 100.0
PRK05638 442 threonine synthase; Validated 100.0
PLN00011323 cysteine synthase 100.0
TIGR01136299 cysKM cysteine synthases. This model discriminates 100.0
TIGR01139298 cysK cysteine synthase A. This model distinguishes 100.0
PRK11761296 cysM cysteine synthase B; Provisional 100.0
COG1171347 IlvA Threonine dehydratase [Amino acid transport a 100.0
TIGR01138290 cysM cysteine synthase B. Alternate name: O-acetyl 100.0
cd01561291 CBS_like CBS_like: This subgroup includes Cystathi 100.0
PRK10717330 cysteine synthase A; Provisional 100.0
PLN02356423 phosphateglycerate kinase 100.0
PRK08526 403 threonine dehydratase; Provisional 100.0
PRK06382 406 threonine dehydratase; Provisional 100.0
PLN02970328 serine racemase 100.0
PRK12483 521 threonine dehydratase; Reviewed 100.0
PRK06352351 threonine synthase; Validated 100.0
PRK07476322 eutB threonine dehydratase; Provisional 100.0
TIGR02991317 ectoine_eutB ectoine utilization protein EutB. Mem 100.0
PRK08198 404 threonine dehydratase; Provisional 100.0
KOG1252362 consensus Cystathionine beta-synthase and related 100.0
PRK08638333 threonine dehydratase; Validated 100.0
TIGR03844398 cysteate_syn cysteate synthase. Members of this fa 100.0
cd06447404 D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph 100.0
PLN02550 591 threonine dehydratase 100.0
TIGR02079 409 THD1 threonine dehydratase. This model represents 100.0
PRK06110322 hypothetical protein; Provisional 100.0
PRK07334 403 threonine dehydratase; Provisional 100.0
cd06448316 L-Ser-dehyd Serine dehydratase is a pyridoxal phos 100.0
TIGR01137 454 cysta_beta cystathionine beta-synthase. Members of 100.0
PRK08639 420 threonine dehydratase; Validated 100.0
PRK02991441 D-serine dehydratase; Provisional 100.0
TIGR01127 380 ilvA_1Cterm threonine dehydratase, medium form. A 100.0
PRK08813349 threonine dehydratase; Provisional 100.0
TIGR01124 499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 100.0
PRK06721352 threonine synthase; Reviewed 100.0
PRK07048321 serine/threonine dehydratase; Validated 100.0
PRK07409353 threonine synthase; Validated 100.0
PRK06608338 threonine dehydratase; Provisional 100.0
PRK06815317 hypothetical protein; Provisional 100.0
PRK09224 504 threonine dehydratase; Reviewed 100.0
TIGR02035431 D_Ser_am_lyase D-serine ammonia-lyase. This family 100.0
PRK08246310 threonine dehydratase; Provisional 100.0
cd01563324 Thr-synth_1 Threonine synthase is a pyridoxal phos 100.0
cd01562304 Thr-dehyd Threonine dehydratase: The first step in 100.0
KOG1250 457 consensus Threonine/serine dehydratases [Amino aci 100.0
PRK06381319 threonine synthase; Validated 100.0
KOG1251323 consensus Serine racemase [Signal transduction mec 100.0
PRK08206399 diaminopropionate ammonia-lyase; Provisional 100.0
TIGR00260328 thrC threonine synthase. Involved in threonine bio 100.0
TIGR01747376 diampropi_NH3ly diaminopropionate ammonia-lyase fa 100.0
cd00640244 Trp-synth-beta_II Tryptophan synthase beta superfa 100.0
TIGR03528396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem 100.0
TIGR01415419 trpB_rel pyridoxal-phosphate dependent TrpB-like e 100.0
COG0498411 ThrC Threonine synthase [Amino acid transport and 100.0
PRK12391427 tryptophan synthase subunit beta; Reviewed 100.0
KOG1481391 consensus Cysteine synthase [Amino acid transport 100.0
PRK13028402 tryptophan synthase subunit beta; Provisional 100.0
TIGR00263385 trpB tryptophan synthase, beta subunit. Tryptophan 100.0
PRK04346397 tryptophan synthase subunit beta; Validated 100.0
cd06446365 Trp-synth_B Tryptophan synthase-beta: Trptophan sy 100.0
PRK03910331 D-cysteine desulfhydrase; Validated 100.0
TIGR01275311 ACC_deam_rel pyridoxal phosphate-dependent enzymes 100.0
PLN02618410 tryptophan synthase, beta chain 100.0
PF00291306 PALP: Pyridoxal-phosphate dependent enzyme; InterP 100.0
PRK12390337 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
TIGR01274337 ACC_deam 1-aminocyclopropane-1-carboxylate deamina 100.0
cd06449307 ACCD Aminocyclopropane-1-carboxylate deaminase (AC 100.0
PRK13802695 bifunctional indole-3-glycerol phosphate synthase/ 100.0
PRK13803610 bifunctional phosphoribosylanthranilate isomerase/ 100.0
PRK14045329 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
COG0133396 TrpB Tryptophan synthase beta chain [Amino acid tr 99.96
PRK09225462 threonine synthase; Validated 99.96
cd01560460 Thr-synth_2 Threonine synthase catalyzes the final 99.95
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 99.95
COG1350432 Predicted alternative tryptophan synthase beta-sub 99.94
KOG1395477 consensus Tryptophan synthase beta chain [Amino ac 99.91
COG3048443 DsdA D-serine dehydratase [Amino acid transport an 99.81
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 90.85
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 89.67
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 88.81
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 87.75
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 87.28
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 87.21
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 87.02
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 86.08
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 85.76
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 85.32
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 84.16
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 83.98
PRK12743256 oxidoreductase; Provisional 83.82
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 83.29
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 83.23
PRK03562621 glutathione-regulated potassium-efflux system prot 81.86
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 81.75
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 81.67
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 81.48
TIGR01064473 pyruv_kin pyruvate kinase. This enzyme is a homote 81.41
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 80.73
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 80.64
>PRK07591 threonine synthase; Validated Back     alignment and domain information 
Probab=100.00  E-value=8.5e-61  Score=460.14  Aligned_cols=292  Identities=19%  Similarity=0.199  Sum_probs=250.6

Q ss_pred             HHHhhccc---------C-CCCCceeeecccccCCCCCCchhHhhhcCCCC---CCCCccchhHhhhcccCCCccccccc
Q 021775            6 RSFLKKRA---------L-TCSEPMLMRRLVSSQPAPVDSSSFAQRLRDLP---KDLPATNIKRDVSQLIGRTPLVFLNK   72 (307)
Q Consensus         6 ~~~~~~~~---------c-~Cg~~l~~~y~~~~~~~~~~~~~~~~~~~~~~---~~lp~~~~~~~v~~~~g~TPl~~~~~   72 (307)
                      ++|..|+.         | +||++|++.||++.+++.+.++.+....+++|   +|||+... .++++++|+|||+++++
T Consensus        19 l~C~~Cg~~~~~~~~~~C~~cg~~l~~~y~~~~~~~~~~~~~~~~~~~~~wry~~~lp~~~~-~~v~l~eG~TPLv~~~~   97 (421)
T PRK07591         19 LKCRECGAEYPLGPIHVCEECFGPLEVAYDYDAIRKRVSRESIEAGPKSIWRYRDLLPVPAD-NPVDLGPGFTPLVKADR   97 (421)
T ss_pred             EEeCCCCCcCCCCCCccCCCCCCeEEEEechhhhccccChhhhhccccchhcchhhCccccC-CCCcCCCCCCcceEhHH
Confidence            78999984         9 99999999999876654444444444456888   45777543 25999999999999999


Q ss_pred             ccccCCC-eEEEEeCCCCCCCcchhHHHHHHHHHHHHcCCCCCCCcEEEeeCCChHHHHHHHHHHHcCCeEEEEECCCCC
Q 021775           73 VSEGCGA-YIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTS  151 (307)
Q Consensus        73 l~~~~g~-~l~~K~E~~nptGS~KdR~a~~~l~~a~~~g~~~~g~~~vv~~SsGN~g~alA~~a~~~G~~~~ivvp~~~~  151 (307)
                      |++.+|. +||+|+|++|||||||||++.+++.+|++.|     .++|+++|+||||+|+|++|+++|++|+||||++++
T Consensus        98 l~~~lG~~~l~~K~E~~nPtGSfKdRga~~~v~~A~~~g-----~~~vv~aSsGN~g~alA~~aa~~Gl~~~I~vP~~~~  172 (421)
T PRK07591         98 LARELGLKNLYIKDDSVNPTHSFKDRVVSVALTAARELG-----FTTVACASTGNLANSVAAHAARAGLDSCVFIPADLE  172 (421)
T ss_pred             HHHHhCCCcEEEEeCCCCCccChHHHHHHHHHHHHHHcC-----CCEEEEeCCCHHHHHHHHHHHHcCCCEEEEEcCCCC
Confidence            9999995 9999999999999999999999999999998     456999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCeEEEeCCCCChHHHHHHHHHHHHhCCCcEEcCCCCChhHHHHHHHHHHHHHHHhhCCC-CCEEEEecC
Q 021775          152 LERRVTMRAFGADLILTDPAKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQ-VDIFVMGIG  230 (307)
Q Consensus       152 ~~k~~~~~~~GA~V~~v~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~np~~~~~G~~t~~~Ei~~q~~~~-~d~vv~pvG  230 (307)
                      ..|+.+++.|||+|+.++++  ++++.+.+++++++.++++++|++.||+.++ |++|+++||++|+++. ||+||+|+|
T Consensus       173 ~~k~~~~~~~GA~Vi~v~g~--~d~a~~~a~~~~~~~~~~~~~n~~~~p~~ie-G~~Tia~Ei~eQl~~~~pD~iv~pvG  249 (421)
T PRK07591        173 AGKIVGTLVYGPTLVAVDGN--YDDVNRLCSELANEHEGWGFVNINLRPYYAE-GSKTLGYEVAEQLGWRLPDQVVAPLA  249 (421)
T ss_pred             HHHHHHHHHcCCEEEEECCC--HHHHHHHHHHHHHhcCCEEEecCCCCccccc-chHHHHHHHHHHcCCCCCCEEEEeCC
Confidence            99999999999999999974  8899999999998866899999988999997 9999999999999765 999999999


Q ss_pred             chhHHHHHHHHHHhc-------CCCcEEEEEeCCCCccccC----CCC------cCcccCccCCCCCc-----ccccccc
Q 021775          231 SGGTVSGVGQYLKSQ-------NPNVKIYGVEPAESNILNG----GKP------GPHLITGNGVGFKP-----DILDMDV  288 (307)
Q Consensus       231 ~Gg~~~Gi~~~~k~~-------~~~~~vigVe~~~~~~~~~----~~~------~~~~~~gi~~~~~p-----~~~~~~~  288 (307)
                      +||+++|++++|+++       .+.+|||+|||++++++..    +..      ..+++++|.++...     ..+.+++
T Consensus       250 ~Gg~~~Gv~~g~kel~~~g~i~~~~prii~Vq~~g~~~~~~~~~~g~~~~~~~~~~tia~~l~~~~p~~~~~~~~~i~~~  329 (421)
T PRK07591        250 SGSLLTKIDKGFQELIKVGLVEDKPVRVFGAQAEGCSPIAQAFKEGRDVVKPVKPNTIAKSLAIGNPADGPYALDIARRT  329 (421)
T ss_pred             chHHHHHHHHHHHHHHhcCCccCCCceEEEEecCCCCHHHHHHHcCCCcccCCCCCchhhheecCCCCCcHHHHHHHHHh
Confidence            999999999999998       5889999999999877642    221      35677777654321     1233567


Q ss_pred             cCcEEEECHHHHHHhccC
Q 021775          289 MEKVLEVSSIANAQTITL  306 (307)
Q Consensus       289 ~d~~v~Vsd~e~~~a~~l  306 (307)
                      .+.++.|+|+|+++|+++
T Consensus       330 ~g~~v~Vsd~ei~~a~~~  347 (421)
T PRK07591        330 GGAIEDVTDEEIIEGIKL  347 (421)
T ss_pred             CCEEEEECHHHHHHHHHH
Confidence            889999999999999874

>PRK08197 threonine synthase; Validated Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03013 cysteine synthase Back     alignment and domain information
>PLN02556 cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>PLN02565 cysteine synthase Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>PLN00011 cysteine synthase Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>PLN02356 phosphateglycerate kinase Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PLN02970 serine racemase Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>PRK07476 eutB threonine dehydratase; Provisional Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>PRK02991 D-serine dehydratase; Provisional Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>TIGR00260 thrC threonine synthase Back     alignment and domain information
>TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>TIGR00263 trpB tryptophan synthase, beta subunit Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information
>PLN02618 tryptophan synthase, beta chain Back     alignment and domain information
>PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] Back     alignment and domain information
>KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
3vbe_A344 Crystal Structure Of Beta-Cyanoalanine Synthase In 1e-125
3vc3_A344 Crystal Structure Of Beta-Cyanoalanine Synthase K95 1e-124
4aec_A430 Crystal Structure Of The Arabidopsis Thaliana O-Ace 5e-84
1z7w_A322 Crystal Structure Of O-Acetylserine Sulfhydrylase F 2e-83
2isq_A320 Crystal Structure Of O-Acetylserine Sulfhydrylase F 5e-83
1z7y_A322 Crystal Structure Of The Arabidopsis Thaliana O-Ace 9e-83
2q3d_A313 2.2 A Resolution Crystal Structure Of O-acetylserin 4e-62
2q3b_A313 1.8 A Resolution Crystal Structure Of O-Acetylserin 2e-61
3rr2_A314 Structure Of A Cysteine Synthase (O-Acetylserine Su 5e-61
4i1y_A314 The Structure Of Cysteine Synthase From Mycobacteri 6e-61
2egu_A308 Crystal Structure Of O-Acetylserine Sulfhydrase Fro 1e-56
3t4p_A334 Crystal Structure Of O-Acetyl Serine Sulfhydrylase 3e-56
1ve1_A304 Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh 1e-55
4air_A354 Leishmania Major Cysteine Synthase Length = 354 3e-55
1oas_A322 O-Acetylserine Sulfhydrylase From Salmonella Typhim 7e-53
1d6s_A322 Crystal Structure Of The K41a Mutant Of O-Acetylser 4e-52
3fca_A291 Genetic Incorporation Of A Metal-Ion Chelating Amin 3e-46
1o58_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase ( 6e-46
1y7l_A316 O-Acetylserine Sulfhydrylase Complex Length = 316 4e-40
3bm5_A338 Crystal Structure Of O-Acetyl-Serine Sulfhydrylase 1e-39
2pqm_A343 Crystal Structure Of Cysteine Synthase (Oass) From 1e-39
2jc3_A303 Structure Of O-acetylserine Sulfhydrylase B From Sa 2e-39
2bhs_A303 Crystal Structure Of Cysteine Synthase B Length = 3 1e-38
2bht_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase B 1e-38
2v03_A303 High Resolution Structure And Catalysis Of An O- Ac 5e-38
3dwg_A325 Crystal Structure Of A Sulfur Carrier Protein Compl 1e-36
3dwi_A323 Crystal Structure Of Mycobacterium Tuberculosis Cys 7e-36
3dki_A326 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobac 8e-36
1m54_A363 Cystathionine-Beta Synthase: Reduced Vicinal Thiols 7e-34
1jbq_A435 Structure Of Human Cystathionine Beta-Synthase: A U 2e-33
3pc2_A 527 Full Length Structure Of Cystathionine Beta-Synthas 6e-32
1wkv_A389 Crystal Structure Of O-Phosphoserine Sulfhydrylase 1e-07
3vsc_A389 Crystal Structure Of The K127a Mutant Of O-Phosphos 6e-07
1tdj_A 514 Threonine Deaminase (Biosynthetic) From E. Coli Len 3e-05
3hmk_A339 Crystal Structure Of Serine Racemase Length = 339 1e-04
3l6b_A346 X-Ray Crystal Structure Of Human Serine Racemase In 2e-04
3ss7_X442 Crystal Structure Of Holo D-Serine Dehydratase From 7e-04
3r0z_A 448 Crystal Structure Of Apo D-Serine Deaminase From Sa 9e-04
>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 Back     alignment and structure 
Iteration: 1

 Score =  443 bits (1139), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 211/247 (85%), Positives = 226/247 (91%)
Query: 51  ATNIKRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKN 110
           +TNIK+ VSQLIGRTPLV+LNKV+EGCGAY+AVKQEM QPTASIKDRPA AM+ DAE KN
Sbjct: 22  STNIKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKN 81
Query: 111 LISPGKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDP 170
           LI+PGKTT+IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGA+LILTDP
Sbjct: 82  LITPGKTTLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDP 141
Query: 171 AKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMXXX 230
           AKGMGGTVKKA ELLE+TPNA MLQQFSNPANT+VHFETTGPEIWEDT GQVDIFVM   
Sbjct: 142 AKGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIG 201
Query: 231 XXXXXXXXXQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVME 290
                    QYLKS+NPNVKIYGVEP+ESN+LNGGKPGPH ITGNGVGFKPDILD+DVME
Sbjct: 202 SGGTVSGVGQYLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDILDLDVME 261
Query: 291 KVLEVSS 297
           KVLEVSS
Sbjct: 262 KVLEVSS 268
>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 Back     alignment and structure
>pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 Back     alignment and structure
>pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 Back     alignment and structure
>pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 Back     alignment and structure
>pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 Back     alignment and structure
>pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 Back     alignment and structure
>pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 Back     alignment and structure
>pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 Back     alignment and structure
>pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 Back     alignment and structure
>pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 Back     alignment and structure
>pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 Back     alignment and structure
>pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 Back     alignment and structure
>pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 Back     alignment and structure
>pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 Back     alignment and structure
>pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 Back     alignment and structure
>pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 Back     alignment and structure
>pdb|1Y7L|A Chain A, O-Acetylserine Sulfhydrylase Complex Length = 316 Back     alignment and structure
>pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 Back     alignment and structure
>pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 Back     alignment and structure
>pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 Back     alignment and structure
>pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 Back     alignment and structure
>pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 Back     alignment and structure
>pdb|3DWG|A Chain A, Crystal Structure Of A Sulfur Carrier Protein Complex Found In The Cysteine Biosynthetic Pathway Of Mycobacterium Tuberculosis Length = 325 Back     alignment and structure
>pdb|3DWI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cysm, The Cysteine Synthase B Length = 323 Back     alignment and structure
>pdb|3DKI|A Chain A, 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobacterium Tuberculosis An O-Phosphoserine Dependent Cysteine Synthase Length = 326 Back     alignment and structure
>pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 Back     alignment and structure
>pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 Back     alignment and structure
>pdb|3PC2|A Chain A, Full Length Structure Of Cystathionine Beta-Synthase From Drosophila Length = 527 Back     alignment and structure
>pdb|1WKV|A Chain A, Crystal Structure Of O-Phosphoserine Sulfhydrylase Length = 389 Back     alignment and structure
>pdb|3VSC|A Chain A, Crystal Structure Of The K127a Mutant Of O-Phosphoserine Sulfhydrylase Complexed With External Schiff Base Of Pyridoxal 5'-Phosphate With O- Phospho-L-Serine Length = 389 Back     alignment and structure
>pdb|1TDJ|A Chain A, Threonine Deaminase (Biosynthetic) From E. Coli Length = 514 Back     alignment and structure
>pdb|3HMK|A Chain A, Crystal Structure Of Serine Racemase Length = 339 Back     alignment and structure
>pdb|3L6B|A Chain A, X-Ray Crystal Structure Of Human Serine Racemase In Complex Malonate A Potent Inhibitor Length = 346 Back     alignment and structure
>pdb|3SS7|X Chain X, Crystal Structure Of Holo D-Serine Dehydratase From Escherichia Coli At 1.55 A Resolution Length = 442 Back     alignment and structure
>pdb|3R0Z|A Chain A, Crystal Structure Of Apo D-Serine Deaminase From Salmonella Typhimurium Length = 448 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 1e-159
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 1e-157
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 1e-156
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 1e-156
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 1e-149
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 1e-145
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 1e-140
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 1e-138
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 1e-129
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 1e-127
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 1e-125
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 1e-113
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 1e-113
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 1e-109
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 2e-21
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 9e-21
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomera 4e-20
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 2e-19
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 2e-19
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 2e-18
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 2e-18
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 2e-18
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 3e-18
4d9i_A398 Diaminopropionate ammonia-lyase; fold type II PLP- 5e-18
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 1e-17
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 1e-17
1e5x_A 486 Threonine synthase; threonine biosynthesis, PLP en 9e-17
3ss7_X442 D-serine dehydratase; type II fold, ALFA,beta-elim 3e-15
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 4e-04
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 Back     alignment and structure
 Score =  450 bits (1159), Expect = e-159
 Identities = 152/296 (51%), Positives = 210/296 (70%), Gaps = 1/296 (0%)

Query: 2   AAALRSFLKKRALTCSEPMLMRRLVSSQPAPVDSSSFAQRLRDLPKDLPATNIKRDVSQL 61
           +  + S     A   S  M  R+  S         S               NI  +VSQL
Sbjct: 62  SPEISSLSFSSASDFSLAMK-RQSRSFADGSERDPSVVCEAVKRETGPDGLNIADNVSQL 120

Query: 62  IGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIE 121
           IG+TP+V+LN +++GC A IA K E+ +P  S+KDR   +M+ DAE K  ISPGK+ ++E
Sbjct: 121 IGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFISPGKSVLVE 180

Query: 122 PTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKA 181
           PTSGN GI +AF+AA +GY+++LTMP+  S+ERRV ++AFGA+L+LTDPAKGM G V+KA
Sbjct: 181 PTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAKGMTGAVQKA 240

Query: 182 QELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQY 241
           +E+L++TP+A+MLQQF NPAN ++H+ETTGPEIW+DT G+VDIFV GIG+GGT++GVG++
Sbjct: 241 EEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFVAGIGTGGTITGVGRF 300

Query: 242 LKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSS 297
           +K +NP  ++ GVEP ES+IL+GGKPGPH I G G GF P  LD  +M++V+ +SS
Sbjct: 301 IKEKNPKTQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQKIMDEVIAISS 356
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Length = 372 Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Length = 323 Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} PDB: 3l6r_A* 3hmk_A* 3l6c_A* Length = 346 Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Length = 360 Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Length = 318 Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Length = 366 Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Length = 311 Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Length = 514 Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Length = 398 Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Length = 352 Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Length = 351 Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Length = 486 Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Length = 442 Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
3vc3_A344 Beta-cyanoalnine synthase; beta-cyanoalanine synth 100.0
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 100.0
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 100.0
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 100.0
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 100.0
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 100.0
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 100.0
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 100.0
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 100.0
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 100.0
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 100.0
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 100.0
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 100.0
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 100.0
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 100.0
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 100.0
4h27_A364 L-serine dehydratase/L-threonine deaminase; PLP de 100.0
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomera 100.0
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 100.0
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 100.0
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 100.0
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 100.0
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 100.0
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 100.0
1e5x_A486 Threonine synthase; threonine biosynthesis, PLP en 100.0
3ss7_X442 D-serine dehydratase; type II fold, ALFA,beta-elim 100.0
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 100.0
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 100.0
4d9b_A342 D-cysteine desulfhydrase; fold type II PLP-depende 100.0
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 100.0
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbo 100.0
4d9i_A398 Diaminopropionate ammonia-lyase; fold type II PLP- 100.0
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 100.0
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 100.0
1x1q_A418 Tryptophan synthase beta chain; structural genomic 100.0
1v8z_A388 Tryptophan synthase beta chain 1; beta+alpha, rike 100.0
1qop_B396 Tryptophan synthase beta chain; lyase, carbon-oxyg 100.0
2o2e_A422 Tryptophan synthase beta chain; amino-acid biosynt 100.0
1kl7_A 514 Threonine synthase; threonine synthesis, pyridoxal 100.0
1vb3_A428 Threonine synthase; PLP-dependent enzyme, lyase; H 100.0
4f4f_A 468 Threonine synthase; structural genomics, niaid, na 100.0
3v7n_A 487 Threonine synthase; ssgcid, structural genomics, s 100.0
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.21
1vp8_A201 Hypothetical protein AF0103; putative pyruvate kin 92.66
3c85_A183 Putative glutathione-regulated potassium-efflux S 91.94
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 91.85
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 91.73
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 91.66
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 91.65
3krt_A456 Crotonyl COA reductase; structural genomics, prote 91.51
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 91.31
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 90.85
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 90.77
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 90.68
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 90.42
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 89.46
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 89.31
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 88.94
4eye_A342 Probable oxidoreductase; structural genomics, niai 88.87
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 88.74
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 88.72
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 88.7
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 88.5
3gms_A340 Putative NADPH:quinone reductase; structural genom 88.16
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 87.61
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 87.55
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 87.54
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 87.09
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 86.59
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 86.56
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 86.56
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 86.56
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 86.35
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 86.29
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 85.97
1t57_A206 Conserved protein MTH1675; structural genomics, FM 85.85
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 85.75
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 85.49
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 85.3
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 85.28
3fbg_A346 Putative arginate lyase; structural genomics, unkn 85.14
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 84.85
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 84.74
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 84.66
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 84.65
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 84.59
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 84.34
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 84.03
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 84.0
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 83.53
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 83.53
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 83.35
3e03_A274 Short chain dehydrogenase; structural genomics, PS 83.11
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 82.87
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 82.78
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 82.5
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 82.47
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 81.95
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 81.17
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 80.88
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 80.49
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 80.36
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 80.35
>3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* Back     alignment and structure
Probab=100.00  E-value=8.2e-59  Score=435.18  Aligned_cols=251  Identities=87%  Similarity=1.301  Sum_probs=235.0

Q ss_pred             hHhhhcccCCCcccccccccccCCCeEEEEeCCCCCCCcchhHHHHHHHHHHHHcCCCCCCCcEEEeeCCChHHHHHHHH
Q 021775           55 KRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEPTSGNMGISMAFM  134 (307)
Q Consensus        55 ~~~v~~~~g~TPl~~~~~l~~~~g~~l~~K~E~~nptGS~KdR~a~~~l~~a~~~g~~~~g~~~vv~~SsGN~g~alA~~  134 (307)
                      .+.|+..+|+|||+++++|++.+|++||+|+|++|||||||||++.++|.+|.++|.+.+|.++||++|+||||+|+|++
T Consensus        26 ~~~i~~lIG~TPLv~~~~Ls~~~G~~IylK~E~lnptGSfK~RgA~~~i~~a~~~g~l~~g~~~Vv~aSsGN~g~alA~~  105 (344)
T 3vc3_A           26 KKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIADRPAYAMITDAEEKNLITPGKTTLIEPTSGNMGISMAFM  105 (344)
T ss_dssp             BSSGGGGSCCCCEEECCSTTTTCCSEEEEEEGGGSTTSBTTHHHHHHHHHHHHHTTCCCTTTCEEEEECSSHHHHHHHHH
T ss_pred             hccHhhhcCCCceEECcccchhhCCEEEEEecCCCCCCCcHHHHHHHHHHHHHHcCCCCCCCCEEEEeCCcHHHHHHHHH
Confidence            34789999999999999999999999999999999999999999999999999999999998889999999999999999


Q ss_pred             HHHcCCeEEEEECCCCCHHHHHHHHHcCCeEEEeCCCCChHHHHHHHHHHHHhCCCcEEcCCCCChhHHHHHHHHHHHHH
Q 021775          135 AAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEI  214 (307)
Q Consensus       135 a~~~G~~~~ivvp~~~~~~k~~~~~~~GA~V~~v~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~np~~~~~G~~t~~~Ei  214 (307)
                      |+++|++|+||||++++..|+.+++.|||+|+.++...++.++...+.++..+.++.++++||+||.++++||+|+++||
T Consensus       106 aa~~G~~~~IvmP~~~~~~k~~~~~~~GA~Vv~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~np~~~~a~~~t~g~EI  185 (344)
T 3vc3_A          106 AAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGPEI  185 (344)
T ss_dssp             HHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHSTTEECCCTTTCHHHHHHHHHTHHHHH
T ss_pred             HHHcCCcEEEEECCCChHHHHHHHHHcCCEEEEECCCCcchHHHHHHHHHHhhccCceeccccccchhHHHHHHHHHHHH
Confidence            99999999999999999999999999999999998754556666777777767679999999999999988999999999


Q ss_pred             HHhhCCCCCEEEEecCchhHHHHHHHHHHhcCCCcEEEEEeCCCCccccCCCCcCcccCccCCCCCcccccccccCcEEE
Q 021775          215 WEDTMGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLE  294 (307)
Q Consensus       215 ~~q~~~~~d~vv~pvG~Gg~~~Gi~~~~k~~~~~~~vigVe~~~~~~~~~~~~~~~~~~gi~~~~~p~~~~~~~~d~~v~  294 (307)
                      ++|+++.||+||+|+|+||+++|+++++|+.+|+++||+|||++++.+..+.++++.++|++.+..+.....+.+|+++.
T Consensus       186 ~eq~~~~~d~vv~~vGgGG~~~Gi~~~~k~~~p~v~vigVep~~s~~l~~~~~~~~~i~g~g~~~~~~~~~~~~~d~~v~  265 (344)
T 3vc3_A          186 WEDTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDILDLDVMEKVLE  265 (344)
T ss_dssp             HHHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEEGGGCGGGTCCCCCCSCTTSCCSSCCTTCCGGGCSEEEE
T ss_pred             HHHhCCCceEEEEecCCccchHHHhhhhHhhCCCceEEEEcCCCChhhcCCCCCCeeEecccccccCcccchhhceEEEE
Confidence            99998889999999999999999999999999999999999999999998888889999999988888888899999999


Q ss_pred             ECHHHHHHhcc
Q 021775          295 VSSIANAQTIT  305 (307)
Q Consensus       295 Vsd~e~~~a~~  305 (307)
                      |+|+|++++++
T Consensus       266 v~d~eai~a~~  276 (344)
T 3vc3_A          266 VSSEDAVNMAR  276 (344)
T ss_dssp             ECHHHHHHHHH
T ss_pred             ECHHHHHHHHH
Confidence            99999999876
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} Back     alignment and structure
>3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1vp8_A Hypothetical protein AF0103; putative pyruvate kinase, structural genomics, joint center structural genomics, JCSG; HET: MSE FMN; 1.30A {Archaeoglobus fulgidus} SCOP: c.49.1.2 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1t57_A Conserved protein MTH1675; structural genomics, FMN; HET: FMN; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.49.1.2 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 307
d1z7wa1320 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C 4e-64
d1o58a_293 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 2e-56
d1ve1a1302 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C 1e-51
d1y7la1310 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C 5e-50
d1jbqa_355 c.79.1.1 (A:) Cystathionine beta-synthase {Human ( 8e-49
d1fcja_302 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 4e-46
d2bhsa1292 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C 5e-37
d1tdja1331 c.79.1.1 (A:5-335) Threonine deaminase {Escherichi 1e-35
d1wkva1382 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C 7e-32
d1v71a1318 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S 2e-30
d1ve5a1310 c.79.1.1 (A:2-311) Threonine deaminase {Thermus th 4e-22
d1tyza_338 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 6e-22
d1f2da_341 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 8e-22
d1v7ca_351 c.79.1.1 (A:) Threonine synthase {Thermus thermoph 9e-22
d1p5ja_319 c.79.1.1 (A:) L-serine dehydratase {Human (Homo sa 5e-21
d1j0aa_325 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 5e-20
d1v8za1386 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subun 8e-20
d1e5xa_ 477 c.79.1.1 (A:) Threonine synthase {Mouse-ear cress 1e-19
d1qopb_390 c.79.1.1 (B:) Tryptophan synthase, beta-subunit {S 5e-16
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  203 bits (516), Expect = 4e-64
 Identities = 144/251 (57%), Positives = 194/251 (77%)

Query: 54  IKRDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLIS 113
           I +DV++LIG TPLV+LN V+EGC   +A K EM +P +S+KDR   +M+ DAE K LI 
Sbjct: 3   IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK 62

Query: 114 PGKTTIIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKG 173
           PG++ +IEPTSGN G+ +AF AA KGYK+++TMP+  S ERR+ + AFG +L+LTDPAKG
Sbjct: 63  PGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKG 122

Query: 174 MGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGG 233
           M G + KA+E+L  TPN +MLQQF NPAN ++H+ETTGPEIW+ T G++D FV GIG+GG
Sbjct: 123 MKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGG 182

Query: 234 TVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVL 293
           T++G G+YLK QN NVK+YGVEP ES IL+GGKPGPH I G G GF P +L++D++++V+
Sbjct: 183 TITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVV 242

Query: 294 EVSSIANAQTI 304
           +VSS  +    
Sbjct: 243 QVSSDESIDMA 253
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Length = 351 Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 386 Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 477 Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Length = 390 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1ve1a1302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1o58a_293 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
d1e5xa_477 Threonine synthase {Mouse-ear cress (Arabidopsis t 100.0
d1v71a1318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 100.0
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1p5ja_319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 100.0
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 100.0
d1ve5a1310 Threonine deaminase {Thermus thermophilus [TaxId: 100.0
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1v7ca_351 Threonine synthase {Thermus thermophilus [TaxId: 2 100.0
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 100.0
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 100.0
d1j0aa_325 1-aminocyclopropane-1-carboxylate deaminase {Archa 100.0
d1tyza_338 1-aminocyclopropane-1-carboxylate deaminase {Pseud 100.0
d1f2da_341 1-aminocyclopropane-1-carboxylate deaminase {Yeast 100.0
d1vb3a1428 Threonine synthase {Escherichia coli [TaxId: 562]} 99.84
d1kl7a_ 511 Threonine synthase {Baker's yeast (Saccharomyces c 98.84
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.38
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.18
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.75
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.69
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.65
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.43
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 95.12
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.86
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 94.78
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.76
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 94.43
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.29
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.27
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.12
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.08
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.67
d1vp8a_190 Hypothetical protein AF0103 {Archaeoglobus fulgidu 93.48
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 93.28
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 92.87
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.83
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 92.06
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 90.99
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 90.81
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.75
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 90.34
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 89.94
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.83
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.57
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.42
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.3
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.94
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 86.76
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.27
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 85.91
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 84.46
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 83.95
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 83.89
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 83.85
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 83.41
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 83.05
d1t57a_186 Hypothetical protein MTH1675 {Methanobacterium the 82.76
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 82.61
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 82.04
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 81.84
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 81.81
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 81.33
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 80.44
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 80.38
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 80.3
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 80.18
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=2.7e-56  Score=412.30  Aligned_cols=250  Identities=57%  Similarity=1.014  Sum_probs=230.6

Q ss_pred             HhhhcccCCCcccccccccccCCCeEEEEeCCCCCCCcchhHHHHHHHHHHHHcCCCCCCCcEEEeeCCChHHHHHHHHH
Q 021775           56 RDVSQLIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTIIEPTSGNMGISMAFMA  135 (307)
Q Consensus        56 ~~v~~~~g~TPl~~~~~l~~~~g~~l~~K~E~~nptGS~KdR~a~~~l~~a~~~g~~~~g~~~vv~~SsGN~g~alA~~a  135 (307)
                      +.|+..+|+|||+++++|++.+|.+||+|+|++|||||||||++.++|.+|+++|.++++.++||++||||||.|+|++|
T Consensus         5 ~~i~~~iG~TPLv~~~~l~~~~g~~i~~K~E~~nptGSfKdRgA~~~i~~a~~~g~~~~~~~~vv~aSsGN~g~a~A~~a   84 (320)
T d1z7wa1           5 KDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTA   84 (320)
T ss_dssp             SSGGGGSSCCCEEECCGGGTTCSSEEEEEEGGGSTTSBTHHHHHHHHHHHHHHTTSCCTTTCEEEEECSSHHHHHHHHHH
T ss_pred             hhhhhhcCCCCeEECCCcccccCCEEEEEeCCCCCccCcHHHHHHHHHHHHHHcCCCCCCCceEEeeCCchHHHHHHHHH
Confidence            46888999999999999999999999999999999999999999999999999998888878899999999999999999


Q ss_pred             HHcCCeEEEEECCCCCHHHHHHHHHcCCeEEEeCCCCChHHHHHHHHHHHHhCCCcEEcCCCCChhHHHHHHHHHHHHHH
Q 021775          136 AMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKKAQELLESTPNAFMLQQFSNPANTRVHFETTGPEIW  215 (307)
Q Consensus       136 ~~~G~~~~ivvp~~~~~~k~~~~~~~GA~V~~v~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~np~~~~~G~~t~~~Ei~  215 (307)
                      +.+|++|+||||++++..|+.+++.|||+|+.++...+..+....+.+...+.++++++++++|+.|+.+||+|+|+||+
T Consensus        85 ~~~g~~~~iv~p~~~~~~k~~~i~~~Ga~vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~g~~t~~~EI~  164 (320)
T d1z7wa1          85 AAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIW  164 (320)
T ss_dssp             HHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHCTTEEECCTTTCTHHHHHHHHTHHHHHH
T ss_pred             HhhccceEEeehhhhhhhhhhhhhccCcceEEeeccccccccchhHHHHHHhCCCceecccccccchHHHhhhhHHHHHH
Confidence            99999999999999999999999999999999986433344445555555555689999999999988889999999999


Q ss_pred             HhhCCCCCEEEEecCchhHHHHHHHHHHhcCCCcEEEEEeCCCCccccCCCCcCcccCccCCCCCcccccccccCcEEEE
Q 021775          216 EDTMGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEV  295 (307)
Q Consensus       216 ~q~~~~~d~vv~pvG~Gg~~~Gi~~~~k~~~~~~~vigVe~~~~~~~~~~~~~~~~~~gi~~~~~p~~~~~~~~d~~v~V  295 (307)
                      +|+.+.||+||+|+|+||+++|++++|++.+|.++++||||.+++.+..+.+.++.++||+.+.+|+.+..+.+|+++.|
T Consensus       165 ~q~~~~~D~vv~~vGgGg~~~Gi~~~~k~~~~~~~~igve~~~s~~~~~~~~~~~~~~gig~~~~~~~~~~~~id~~~~V  244 (320)
T d1z7wa1         165 KGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQV  244 (320)
T ss_dssp             HHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEEGGGCGGGTCCCCCCSCTTSCCSSCCTTCCGGGCSEEEEE
T ss_pred             HhccCCCCEEEeCCCCCcccchhhhhhhhhhcceeeecccccCCccccCCCCCCceeeeccCCcCcchhhhhhcceeecc
Confidence            99977799999999999999999999999999999999999999988888888899999999999999999999999999


Q ss_pred             CHHHHHHhcc
Q 021775          296 SSIANAQTIT  305 (307)
Q Consensus       296 sd~e~~~a~~  305 (307)
                      +|+|++++++
T Consensus       245 ~d~e~~~a~~  254 (320)
T d1z7wa1         245 SSDESIDMAR  254 (320)
T ss_dssp             CHHHHHHHHH
T ss_pred             CHHHHHHHHH
Confidence            9999999986
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Back     information, alignment and structure
>d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vp8a_ c.49.1.2 (A:) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t57a_ c.49.1.2 (A:) Hypothetical protein MTH1675 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure