Citrus Sinensis ID: 021849
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 306 | ||||||
| 255545990 | 361 | conserved hypothetical protein [Ricinus | 0.614 | 0.520 | 0.546 | 1e-38 | |
| 225459069 | 400 | PREDICTED: double-stranded RNA-binding p | 0.732 | 0.56 | 0.421 | 2e-36 | |
| 302142076 | 415 | unnamed protein product [Vitis vinifera] | 0.545 | 0.402 | 0.502 | 3e-36 | |
| 356510122 | 359 | PREDICTED: double-stranded RNA-binding p | 0.545 | 0.465 | 0.526 | 9e-34 | |
| 356515734 | 359 | PREDICTED: double-stranded RNA-binding p | 0.477 | 0.406 | 0.556 | 2e-33 | |
| 255637537 | 359 | unknown [Glycine max] | 0.477 | 0.406 | 0.556 | 2e-33 | |
| 224067130 | 355 | predicted protein [Populus trichocarpa] | 0.784 | 0.676 | 0.404 | 1e-31 | |
| 449470070 | 344 | PREDICTED: double-stranded RNA-binding p | 0.336 | 0.299 | 0.626 | 6e-27 | |
| 449511425 | 351 | PREDICTED: double-stranded RNA-binding p | 0.336 | 0.293 | 0.626 | 6e-27 | |
| 357465225 | 780 | DsRNA-binding protein [Medicago truncatu | 0.483 | 0.189 | 0.490 | 6e-26 |
| >gi|255545990|ref|XP_002514055.1| conserved hypothetical protein [Ricinus communis] gi|223547141|gb|EEF48638.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 166 bits (421), Expect = 1e-38, Method: Compositional matrix adjust.
Identities = 105/192 (54%), Positives = 128/192 (66%), Gaps = 4/192 (2%)
Query: 1 MNYAIPLYQCRKDEASGK-VQFSCTVEIGDIRYIGGAAKTKKEAEIKAARTALLAIQSSA 59
MNYAIPLY C+K+E+ G+ F CTVEIG I YIG +AKTKKEAEIKAARTALLAIQ SA
Sbjct: 114 MNYAIPLYLCQKNESPGRGTLFKCTVEIGGIHYIGASAKTKKEAEIKAARTALLAIQLSA 173
Query: 60 SELSGNSAGNTQLTVLPSRKRGPEVANNPEETVNVPKAKKGRFKKKILKMKRPGGRMDRT 119
SE S NS GN QLTV+P RKRG E A EE +NVPKAKK RF+KK LK K G ++D
Sbjct: 174 SESSHNSIGNCQLTVIPFRKRGAETAAVLEEAMNVPKAKKARFRKKTLKKKHSGNKVDHN 233
Query: 120 QLQNTGNMENINASQEGSKVSQANTSGIQGVSTEVLAVEGTMDCQEGRSEIEPIEREMPA 179
Q + GN ++ Q GS+ + + S +QG ++L + T + ++GR E ERE
Sbjct: 234 QGETIGNKKD---GQAGSESDKNDASVVQGTGHQLLPMLSTSNSEDGRLVPESSERETTD 290
Query: 180 VNDALPHHIGGD 191
V AL HI GD
Sbjct: 291 VTGALVCHISGD 302
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225459069|ref|XP_002285663.1| PREDICTED: double-stranded RNA-binding protein 1 [Vitis vinifera] gi|147781065|emb|CAN68128.1| hypothetical protein VITISV_043706 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302142076|emb|CBI19279.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356510122|ref|XP_003523789.1| PREDICTED: double-stranded RNA-binding protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356515734|ref|XP_003526553.1| PREDICTED: double-stranded RNA-binding protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255637537|gb|ACU19095.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224067130|ref|XP_002302370.1| predicted protein [Populus trichocarpa] gi|222844096|gb|EEE81643.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449470070|ref|XP_004152741.1| PREDICTED: double-stranded RNA-binding protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449511425|ref|XP_004163953.1| PREDICTED: double-stranded RNA-binding protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357465225|ref|XP_003602894.1| DsRNA-binding protein [Medicago truncatula] gi|355491942|gb|AES73145.1| DsRNA-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 306 | ||||||
| TAIR|locus:2024407 | 419 | HYL1 "HYPONASTIC LEAVES 1" [Ar | 0.918 | 0.670 | 0.322 | 4.4e-21 | |
| UNIPROTKB|Q0IQN6 | 424 | DRB8 "Double-stranded RNA-bind | 0.464 | 0.334 | 0.370 | 1.2e-13 |
| TAIR|locus:2024407 HYL1 "HYPONASTIC LEAVES 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 251 (93.4 bits), Expect = 4.4e-21, P = 4.4e-21
Identities = 99/307 (32%), Positives = 137/307 (44%)
Query: 1 MNYAIPLYQCRKDEASGKV-QFSCTVEIGDIRYXXXXXXXXXXXXXXXXXXXLLAIQSSA 59
MNYAIPLYQC+K E G+V QF+CTVEIG I+Y LLAIQS
Sbjct: 113 MNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQSDT 172
Query: 60 SELSGNSAGNTQLTVLPSRKRGPEVANNPEETVNVPKAKKGRFKKKILKMKRPGGRMDRT 119
N NTQLTVLP K+ + A +ETV KA+K +FKKK K KR +
Sbjct: 173 KNNLANY--NTQLTVLPCEKKTIQAAIPLKETVKTLKARKAQFKKKAQKGKRTVAKNPED 230
Query: 120 QL---QNTGNMENINASQEGSKVSQANTSGIQGVSTEVLAVEGTMDCQEGRSEIEPIERE 176
+ Q T + +N + + + + +S + G+ A G+++ + + E P E
Sbjct: 231 IIIPPQPTDHCQNDQSEKIETTPNLEPSSCMNGLKE---AAFGSVETE--KIETTP-NLE 284
Query: 177 MPAVNDALPHHIGGDSETIHSAATHCSDRSS--NEASEMGTSSLAKEVNEVTPGVGTSSV 234
P+ + L G ET T + S N E S+ E E TP + SS
Sbjct: 285 PPSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLEPSS- 343
Query: 235 SCHTTALAKEVNEGTPNEGTSTALTEEVNEPS---GIMEAA--SMTNNS--TLGQIESSC 287
C L KE G+ E T + PS G+ EAA S+ T +ESS
Sbjct: 344 -C-MNGL-KEAAFGSV-ETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLESSS 399
Query: 288 VIPGINQ 294
+ G+ +
Sbjct: 400 CMSGLKE 406
|
|
| UNIPROTKB|Q0IQN6 DRB8 "Double-stranded RNA-binding protein 8" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00015092001 | SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (394 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00026189001 | • | • | 0.528 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 306 | |||
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 7e-09 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 3e-08 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 8e-08 | |
| PRK00102 | 229 | PRK00102, rnc, ribonuclease III; Reviewed | 0.001 | |
| TIGR02191 | 220 | TIGR02191, RNaseIII, ribonuclease III, bacterial | 0.003 |
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
Score = 51.1 bits (123), Expect = 7e-09
Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 1/56 (1%)
Query: 1 MNYAIPLYQCRKDE-ASGKVQFSCTVEIGDIRYIGGAAKTKKEAEIKAARTALLAI 55
+P Y+ ++E +F+ V +G G +KKEA+ AA AL +
Sbjct: 13 RGKPLPEYELVEEEGPDHAPRFTVEVTVGGKITGEGEGSSKKEAKQNAAEAALRKL 68
|
Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III, RNases H1, and dsRNA dependent adenosine deaminases. Length = 68 |
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 306 | |||
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 99.37 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 99.36 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 99.32 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 99.3 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 99.28 | |
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 99.27 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 99.24 | |
| PRK14718 | 467 | ribonuclease III; Provisional | 99.05 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 99.02 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 98.41 | |
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 98.21 | |
| KOG1817 | 533 | consensus Ribonuclease [RNA processing and modific | 98.11 | |
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 97.75 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 97.55 | |
| KOG3769 | 333 | consensus Ribonuclease III domain proteins [Transl | 96.36 | |
| KOG4334 | 650 | consensus Uncharacterized conserved protein, conta | 96.07 | |
| PF03368 | 90 | Dicer_dimer: Dicer dimerisation domain; InterPro: | 86.65 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 81.54 |
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
Probab=99.37 E-value=2e-12 Score=89.98 Aligned_cols=54 Identities=26% Similarity=0.370 Sum_probs=49.7
Q ss_pred CCCCceEEe-eccCCCCCceEEEEEEECCEEeeCCCCCCHHHHHHHHHHHHHHHH
Q 021849 2 NYAIPLYQC-RKDEASGKVQFSCTVEIGDIRYIGGAAKTKKEAEIKAARTALLAI 55 (306)
Q Consensus 2 nL~lP~Y~i-~ksGPdHdk~FtAeV~IgGk~yG~G~GrSKKEAEQaAAK~AL~aL 55 (306)
++..|.|.+ ...||+|.+.|+|.|.|+|+.++.|.|+|||+|++.||+.||..|
T Consensus 14 ~~~~~~y~~~~~~g~~~~~~f~~~v~i~~~~~~~g~g~sKk~Ak~~AA~~al~~L 68 (68)
T cd00048 14 GKPLPEYELVEEEGPDHAPRFTVEVTVGGKITGEGEGSSKKEAKQNAAEAALRKL 68 (68)
T ss_pred CCCCCeEEEeeeeCCCCCCeEEEEEEECCEEEEEeecCCHHHHHHHHHHHHHHhC
Confidence 467899986 668999999999999999999999999999999999999999865
|
Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III, RNases H1, and dsRNA dependent adenosine deaminases. |
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >PRK14718 ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
| >KOG1817 consensus Ribonuclease [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 306 | ||||
| 2l2m_A | 77 | Solution Structure Of The Second Dsrbd Of Hyl1 Leng | 2e-09 | ||
| 3adj_A | 76 | Structure Of Arabidopsis Hyl1 And Its Molecular Imp | 2e-09 |
| >pdb|2L2M|A Chain A, Solution Structure Of The Second Dsrbd Of Hyl1 Length = 77 | Back alignment and structure |
|
| >pdb|3ADJ|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 76 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 306 | |||
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 3e-13 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 1e-10 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 2e-04 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 2e-07 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 1e-06 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 3e-06 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 1e-05 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 1e-05 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 1e-05 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 7e-05 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 9e-05 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 2e-04 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 2e-04 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 2e-04 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 3e-04 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 2e-04 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 3e-04 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 3e-04 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 3e-04 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 4e-04 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 5e-04 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 5e-04 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 6e-04 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 8e-04 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 8e-04 |
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 | Back alignment and structure |
|---|
Score = 63.1 bits (154), Expect = 3e-13
Identities = 40/60 (66%), Positives = 45/60 (75%), Gaps = 1/60 (1%)
Query: 1 MNYAIPLYQCRKDE-ASGKVQFSCTVEIGDIRYIGGAAKTKKEAEIKAARTALLAIQSSA 59
MNYAIPLYQC+K E QF+CTVEIG I+Y G A +TKK+AEI A RTALLAIQS
Sbjct: 17 MNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQSDT 76
|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 88 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 306 | |||
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 99.67 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 99.66 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 99.64 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 99.61 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 99.59 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 99.59 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 99.59 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 99.59 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 99.59 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 99.59 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 99.58 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 99.58 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 99.57 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 99.56 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 99.54 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 99.54 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 99.54 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 99.53 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 99.52 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 99.52 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 99.52 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 99.51 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 99.45 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 99.43 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 99.43 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.34 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 99.3 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.28 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.27 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 99.19 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 99.13 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.06 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 98.95 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 98.48 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 91.55 | |
| 2kou_A | 102 | Dicer-like protein 4; ATP-binding, endonuclease, h | 86.32 | |
| 2db2_A | 119 | KIAA0890 protein; DSRM domain, structural genomics | 80.43 |
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
Probab=99.67 E-value=1.7e-16 Score=117.31 Aligned_cols=55 Identities=31% Similarity=0.398 Sum_probs=51.1
Q ss_pred CCCCceEEeeccCCCCCceEEEEEEECCEEeeCCCC-CCHHHHHHHHHHHHHHHHh
Q 021849 2 NYAIPLYQCRKDEASGKVQFSCTVEIGDIRYIGGAA-KTKKEAEIKAARTALLAIQ 56 (306)
Q Consensus 2 nL~lP~Y~i~ksGPdHdk~FtAeV~IgGk~yG~G~G-rSKKEAEQaAAK~AL~aL~ 56 (306)
.+.+|.|++..+||+|+++|+|+|+|+|+.|+.|.| +|||+|||.||+.||..|.
T Consensus 17 ~~~~p~Y~~~~~Gp~h~~~F~~~v~v~g~~~~~G~G~~sKK~Aeq~AA~~al~~L~ 72 (73)
T 3adg_A 17 KLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELA 72 (73)
T ss_dssp TCCCCEEEEEEESSTTSCEEEEEEEETTEEEECCSCBSSHHHHHHHHHHHHHHHHT
T ss_pred CCCCCEEEEEeECCCCCCeEEEEEEECCEEEEeeeccCCHHHHHHHHHHHHHHHhh
Confidence 357899987767999999999999999999999999 9999999999999999885
|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2db2_A KIAA0890 protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 306 | ||||
| d1x48a1 | 76 | d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p | 2e-06 | |
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 6e-06 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 3e-05 | |
| d2nuga2 | 68 | d.50.1.1 (A:151-218) RNase III, C-terminal domain | 1e-04 | |
| d2dmya1 | 84 | d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin | 0.001 | |
| d2b7va1 | 71 | d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R | 0.002 | |
| d1di2a_ | 69 | d.50.1.1 (A:) Double-stranded RNA-binding protein | 0.002 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 0.004 |
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: dsRBD-like superfamily: dsRNA-binding domain-like family: Double-stranded RNA-binding domain (dsRBD) domain: dsRNA-dependent protein kinase pkr species: Mouse (Mus musculus) [TaxId: 10090]
Score = 43.1 bits (101), Expect = 2e-06
Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
Query: 5 IPLYQCRKDE-ASGKVQFSCTVEIGDIRYIGGAAKTKKEAEIKAARTALLAIQSSASELS 63
+ + + + + +F C +IG Y G+ TK+EA+ AA+ A + S + +
Sbjct: 14 LSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTA 73
Query: 64 GNS 66
G S
Sbjct: 74 GTS 76
|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 306 | |||
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 99.59 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.59 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 99.53 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 99.51 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.49 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.48 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 99.46 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 99.46 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.44 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.44 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 99.42 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.42 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.39 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.39 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 99.39 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 99.32 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 99.23 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 99.16 |
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: dsRBD-like superfamily: dsRNA-binding domain-like family: Double-stranded RNA-binding domain (dsRBD) domain: RNase III, C-terminal domain species: Thermotoga maritima [TaxId: 2336]
Probab=99.59 E-value=8.3e-16 Score=110.36 Aligned_cols=53 Identities=32% Similarity=0.397 Sum_probs=49.6
Q ss_pred CCCceEEe-eccCCCCCceEEEEEEECCEEeeCCCCCCHHHHHHHHHHHHHHHH
Q 021849 3 YAIPLYQC-RKDEASGKVQFSCTVEIGDIRYIGGAAKTKKEAEIKAARTALLAI 55 (306)
Q Consensus 3 L~lP~Y~i-~ksGPdHdk~FtAeV~IgGk~yG~G~GrSKKEAEQaAAK~AL~aL 55 (306)
+.+|.|.+ ..+||+|++.|++.|.|+|+.++.|.|+|||+|||.||+.||..|
T Consensus 15 ~~~P~Y~~~~~~g~~h~~~F~~~v~v~~~~~~~g~g~sKK~Aeq~AA~~aL~~L 68 (69)
T d1o0wa2 15 KVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKL 68 (69)
T ss_dssp SSCCEEEEEEEECCTTSCEEEEEEEETTEEEEEEEESSHHHHHHHHHHHHHHHH
T ss_pred CCCCEEEEEEeeCCCCCceEEEEEEECCEEEEEEEeCCHHHHHHHHHHHHHHHh
Confidence 57899975 557999999999999999999999999999999999999999987
|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|