Citrus Sinensis ID: 021865

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MSAATFSSLCFSRGCFWKDEAKNSPRVMKGSGKVKISSIRGSATLPTKSLQVEDGKTQKSEKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMVTVSLRCF
ccHHcHHHHHcccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHcccccEEEEEEEEccccccHHHcccccccccccccccccccccccccEEEEcccHHHHHHHHHcccccccEEEcccccccccHHHHHHHHcccccccccccccccccccccHHHHccccEEEccccHHHHHHHHHHHHHHccccccccEEEEEccccccccccccccccccEEccccccccccccccHHHHHHHHHHccccccEEEEEcccccccccEEEcc
ccHHHHHHHHcccccEccccccccHHHHccccccccccEEEEEEccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHccccEEEEEEEccccccccHHHHcHccccccccccccccHHHHHcccEEEEEcccHHHHHHHHHHHcccEEEEcccccEcccHHHHHHHHccccccHHHHHHHHcccHHHcHHHHHHccEEEccccHHHHHHHHHHHHHHccccccccEEEEccccccccccccccccHHHHHHHHccEcccccccccHHHHHHHHHHccccEEEEEccccccccccEEEcc
msaatfsslcfsrgcfwkdeaknsprvmkgsgkvkissirgsatlptkslqvedgktqksEKQVRIGLLGASGYTGAEIVRLLAnhpyfgiklmtadrkagqsigsvfphlisqdlptmvavkdadfsnvdavfcclphgttqEIIKGLPKSLKIVDLSADFRLRDVSEyeewygqphiapdlqkEAVYGLTEISREDIknarlvanpgcyptsiqlplvPLIQANLIQYRNIIIdaksgvsgagrgakeaNLYSEIAEGIYsygvtrhrhvpeieqgltgfasskvtvsftphlmpmVTVSLRCF
msaatfsslcfsrgcfwkdeaknsprvmkgsgkvkissirgsatlptkslqvedgktqksekqVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTqeiikglpkslKIVDLSADFRLRDVSEYEEwygqphiapdlqKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAksgvsgagrgaKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMVTVSLRCF
MSAATFSSLCFSRGCFWKDEAKNSPRVMKGSGKVKISSIRGSATLPTKSLQVEDGKTQKSEKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMVTVSLRCF
*****FSSLCFSRGCFWK*********************************************VRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMVTVSL***
********LCFSRGCFWKDEAK********************************************GLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMVTVSLRCF
MSAATFSSLCFSRGCFWKDEAKNSPRVMKGSGKVKISSIRGSATLPTKS************KQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMVTVSLRCF
*****FSSLCFSRGCFWKDEAKNSPRVMKGSGKVKISSIRGSATLP**************EKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSGV****RGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMVTVSLRCF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAATFSSLCFSRGCFWKDEAKNSPRVMKGSGKVKISSIRGSATLPTKSLQVEDGKTQKSEKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMVTVSLRCF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
Q93Z70401 Probable N-acetyl-gamma-g yes no 0.954 0.728 0.728 1e-122
Q6AV34415 Probable N-acetyl-gamma-g yes no 0.931 0.686 0.707 1e-115
Q2RRM4352 N-acetyl-gamma-glutamyl-p yes no 0.774 0.673 0.603 9e-79
B6JHG4352 N-acetyl-gamma-glutamyl-p yes no 0.774 0.673 0.563 7e-76
Q9LA02342 N-acetyl-gamma-glutamyl-p yes no 0.764 0.684 0.531 2e-69
B9KSY0342 N-acetyl-gamma-glutamyl-p yes no 0.761 0.681 0.551 8e-68
Q3J277342 N-acetyl-gamma-glutamyl-p yes no 0.761 0.681 0.547 1e-67
Q1GHL0342 N-acetyl-gamma-glutamyl-p yes no 0.764 0.684 0.519 3e-67
A4WQY7342 N-acetyl-gamma-glutamyl-p yes no 0.761 0.681 0.547 6e-67
A3PK36342 N-acetyl-gamma-glutamyl-p yes no 0.761 0.681 0.542 7e-67
>sp|Q93Z70|ARGC_ARATH Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic OS=Arabidopsis thaliana GN=At2g19940 PE=1 SV=2 Back     alignment and function desciption
 Score =  436 bits (1122), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 217/298 (72%), Positives = 249/298 (83%), Gaps = 6/298 (2%)

Query: 2   SAATFSSLCFSRGCFWKDEAKNSPRVMKGSGKVKISSIRGSATLPTKSLQVEDGKTQKSE 61
           +A+ FSS+   +GC++K E K   RV     K +++     A+  + S +V    + K E
Sbjct: 3   TASAFSSI---QGCWFKGERKI--RVADKRAK-RLTLGSHVASPSSMSFRVSASSSVKPE 56

Query: 62  KQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVA 121
           K +RIGLLGASGYTGAEIVRLLANHP+F + LMTADRKAGQS+ SVFPHL +Q LPT+V+
Sbjct: 57  KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVS 116

Query: 122 VKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAP 181
           VKDADFS VDAVFCCLPHGTTQEIIK LP +LKIVDLSADFRLR+++EYEEWYGQPH A 
Sbjct: 117 VKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAV 176

Query: 182 DLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSGV 241
           +LQKE VYGLTEI REDIK ARLVANPGCYPT+IQLPLVPL++ANLI++ NIIIDAKSGV
Sbjct: 177 ELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGV 236

Query: 242 SGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMV 299
           SGAGRGAKEANLYSEIAEGI SYGVTRHRHVPEIEQGL+  A SKVTVSFTPHLMPM+
Sbjct: 237 SGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMI 294

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 3EC: 8
>sp|Q6AV34|ARGC_ORYSJ Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0617900 PE=1 SV=1 Back     alignment and function description
>sp|Q2RRM4|ARGC_RHORT N-acetyl-gamma-glutamyl-phosphate reductase OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=argC PE=3 SV=1 Back     alignment and function description
>sp|B6JHG4|ARGC_OLICO N-acetyl-gamma-glutamyl-phosphate reductase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=argC PE=3 SV=1 Back     alignment and function description
>sp|Q9LA02|ARGC_RHOCB N-acetyl-gamma-glutamyl-phosphate reductase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=argC PE=3 SV=2 Back     alignment and function description
>sp|B9KSY0|ARGC_RHOSK N-acetyl-gamma-glutamyl-phosphate reductase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=argC PE=3 SV=1 Back     alignment and function description
>sp|Q3J277|ARGC_RHOS4 N-acetyl-gamma-glutamyl-phosphate reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=argC PE=3 SV=1 Back     alignment and function description
>sp|Q1GHL0|ARGC_RUEST N-acetyl-gamma-glutamyl-phosphate reductase OS=Ruegeria sp. (strain TM1040) GN=argC PE=3 SV=1 Back     alignment and function description
>sp|A4WQY7|ARGC_RHOS5 N-acetyl-gamma-glutamyl-phosphate reductase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=argC PE=3 SV=1 Back     alignment and function description
>sp|A3PK36|ARGC_RHOS1 N-acetyl-gamma-glutamyl-phosphate reductase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=argC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
225428691398 PREDICTED: probable N-acetyl-gamma-gluta 0.947 0.728 0.765 1e-128
255561649400 N-acetyl-gamma-glutamyl-phosphate reduct 0.950 0.727 0.712 1e-121
297836262401 predicted protein [Arabidopsis lyrata su 0.950 0.725 0.725 1e-121
240254481401 N-acetyl-gamma-glutamyl-phosphate reduct 0.954 0.728 0.728 1e-120
147820070329 hypothetical protein VITISV_023769 [Viti 0.774 0.720 0.856 1e-120
16604368401 At2g19940/F6F22.3 [Arabidopsis thaliana] 0.954 0.728 0.728 1e-119
116786886 415 unknown [Picea sitchensis] 0.895 0.660 0.713 1e-119
56967310359 Chain A, X-Ray Structure Of Gene Product 0.820 0.699 0.812 1e-118
156763844405 putative reductase [Nicotiana tabacum] 0.869 0.656 0.756 1e-117
224123260352 predicted protein [Populus trichocarpa] 0.784 0.681 0.829 1e-117
>gi|225428691|ref|XP_002284953.1| PREDICTED: probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic [Vitis vinifera] gi|297741338|emb|CBI32469.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/298 (76%), Positives = 259/298 (86%), Gaps = 8/298 (2%)

Query: 1   MSAATFSSLCFSRGCFWKDEAKNSPRVMKGSGKVKISSIRGSATLPTKSLQVEDGKTQKS 60
           MS+A  SS+ F R  F K E K+S      +G+ K+  IRGS T   +S+Q  + K +KS
Sbjct: 1   MSSAHLSSIRFDREWFRKSETKSS------NGR-KLH-IRGSVTSSPQSVQFAEAKAEKS 52

Query: 61  EKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMV 120
            K VRIG+LGASGYTG+EIVRLLANHP+FGI LMTADRKAGQSIGSVFPHLI+QDLP MV
Sbjct: 53  GKAVRIGVLGASGYTGSEIVRLLANHPHFGITLMTADRKAGQSIGSVFPHLITQDLPDMV 112

Query: 121 AVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIA 180
           A+KDA FSNVDAVFCCLPHGTTQ+IIK LPKSLKIVDLSADFRL++++EYEEWYGQPH A
Sbjct: 113 AIKDAKFSNVDAVFCCLPHGTTQDIIKALPKSLKIVDLSADFRLQEIAEYEEWYGQPHRA 172

Query: 181 PDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSG 240
           PDLQKEAVYGLTEI RE+IK ARLVANPGCYPT+IQLPLVPL++ANLI+ RN+IIDAKSG
Sbjct: 173 PDLQKEAVYGLTEILREEIKAARLVANPGCYPTTIQLPLVPLLKANLIETRNLIIDAKSG 232

Query: 241 VSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPM 298
           VSGAGRGAKEANLY+EIAEGI+SYG+TRHRHVPEIEQGL+  A +KVTVSFTPHLMPM
Sbjct: 233 VSGAGRGAKEANLYTEIAEGIHSYGITRHRHVPEIEQGLSDAAHAKVTVSFTPHLMPM 290

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255561649|ref|XP_002521834.1| N-acetyl-gamma-glutamyl-phosphate reductase, putative [Ricinus communis] gi|223538872|gb|EEF40470.1| N-acetyl-gamma-glutamyl-phosphate reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297836262|ref|XP_002886013.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297331853|gb|EFH62272.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|240254481|ref|NP_565461.4| N-acetyl-gamma-glutamyl-phosphate reductase [Arabidopsis thaliana] gi|240254483|ref|NP_849993.4| N-acetyl-gamma-glutamyl-phosphate reductase [Arabidopsis thaliana] gi|334184607|ref|NP_180668.5| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana] gi|73921680|sp|Q93Z70.2|ARGC_ARATH RecName: Full=Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic; Short=AGPR; AltName: Full=N-acetyl-glutamate semialdehyde dehydrogenase; Short=NAGSA dehydrogenase; Flags: Precursor gi|227204139|dbj|BAH56921.1| AT2G19940 [Arabidopsis thaliana] gi|330251851|gb|AEC06945.1| N-acetyl-gamma-glutamyl-phosphate reductase [Arabidopsis thaliana] gi|330251852|gb|AEC06946.1| N-acetyl-gamma-glutamyl-phosphate reductase [Arabidopsis thaliana] gi|330253399|gb|AEC08493.1| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147820070|emb|CAN73785.1| hypothetical protein VITISV_023769 [Vitis vinifera] Back     alignment and taxonomy information
>gi|16604368|gb|AAL24190.1| At2g19940/F6F22.3 [Arabidopsis thaliana] gi|19699208|gb|AAL90970.1| At2g19940/F6F22.3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|116786886|gb|ABK24282.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|56967310|pdb|1XYG|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At2g19940 gi|56967311|pdb|1XYG|B Chain B, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At2g19940 gi|56967312|pdb|1XYG|C Chain C, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At2g19940 gi|56967313|pdb|1XYG|D Chain D, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At2g19940 gi|150261481|pdb|2Q49|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of Gene Product From Arabidopsis Thaliana At2g19940 gi|150261482|pdb|2Q49|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of Gene Product From Arabidopsis Thaliana At2g19940 gi|150261483|pdb|2Q49|C Chain C, Ensemble Refinement Of The Protein Crystal Structure Of Gene Product From Arabidopsis Thaliana At2g19940 gi|150261484|pdb|2Q49|D Chain D, Ensemble Refinement Of The Protein Crystal Structure Of Gene Product From Arabidopsis Thaliana At2g19940 gi|20197293|gb|AAC62122.2| putative N-acetyl-gamma-glutamyl-phosphate reductase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|156763844|emb|CAO99124.1| putative reductase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224123260|ref|XP_002330272.1| predicted protein [Populus trichocarpa] gi|222871307|gb|EEF08438.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
TAIR|locus:2051980401 AT2G19940 [Arabidopsis thalian 0.950 0.725 0.729 3.4e-109
TIGR_CMR|SPO_1876342 SPO_1876 "N-acetyl-gamma-gluta 0.761 0.681 0.529 5.5e-61
TIGR_CMR|ECH_1017346 ECH_1017 "N-acetyl-gamma-gluta 0.764 0.676 0.464 2.8e-57
TIGR_CMR|GSU_2874346 GSU_2874 "N-acetyl-gamma-gluta 0.758 0.670 0.454 8.9e-54
TIGR_CMR|CJE_0275342 CJE_0275 "N-acetyl-gamma-gluta 0.761 0.681 0.447 1.1e-50
TIGR_CMR|DET_1626341 DET_1626 "N-acetyl-gamma-gluta 0.758 0.680 0.426 4.7e-48
TIGR_CMR|CHY_2265337 CHY_2265 "N-acetyl-gamma-gluta 0.728 0.661 0.450 2.1e-45
TIGR_CMR|BA_4355345 BA_4355 "N-acetyl-gamma-glutam 0.764 0.678 0.378 2.2e-43
UNIPROTKB|P11446334 argC "N-acetylglutamylphosphat 0.718 0.658 0.404 1.9e-35
UNIPROTKB|P63562352 argC "N-acetyl-gamma-glutamyl- 0.741 0.644 0.381 1.9e-35
TAIR|locus:2051980 AT2G19940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1079 (384.9 bits), Expect = 3.4e-109, P = 3.4e-109
 Identities = 218/299 (72%), Positives = 251/299 (83%)

Query:     2 SAATFSSLCFSRGCFWKDEAKNSPRVM-KGSGKVKISSIRGSATLPTKSLQVEDGKTQKS 60
             +A+ FSS+   +GC++K E K   RV  K + ++ + S   S +  + S +V    + K 
Sbjct:     3 TASAFSSI---QGCWFKGERKI--RVADKRAKRLTLGSHVASPS--SMSFRVSASSSVKP 55

Query:    61 EKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMV 120
             EK +RIGLLGASGYTGAEIVRLLANHP+F + LMTADRKAGQS+ SVFPHL +Q LPT+V
Sbjct:    56 EKDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLV 115

Query:   121 AVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIA 180
             +VKDADFS VDAVFCCLPHGTTQEIIK LP +LKIVDLSADFRLR+++EYEEWYGQPH A
Sbjct:   116 SVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKA 175

Query:   181 PDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLIQYRNIIIDAKSG 240
              +LQKE VYGLTEI REDIK ARLVANPGCYPT+IQLPLVPL++ANLI++ NIIIDAKSG
Sbjct:   176 VELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSG 235

Query:   241 VSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPMV 299
             VSGAGRGAKEANLYSEIAEGI SYGVTRHRHVPEIEQGL+  A SKVTVSFTPHLMPM+
Sbjct:   236 VSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMI 294
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003942 "N-acetyl-gamma-glutamyl-phosphate reductase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA;ISS
GO:0006526 "arginine biosynthetic process" evidence=IEA
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA;ISS
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005730 "nucleolus" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0016020 "membrane" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0048481 "ovule development" evidence=RCA
TIGR_CMR|SPO_1876 SPO_1876 "N-acetyl-gamma-glutamyl-phosphate reductase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_1017 ECH_1017 "N-acetyl-gamma-glutamyl-phosphate reductase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2874 GSU_2874 "N-acetyl-gamma-glutamyl-phosphate reductase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0275 CJE_0275 "N-acetyl-gamma-glutamyl-phosphate reductase" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1626 DET_1626 "N-acetyl-gamma-glutamyl-phosphate reductase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2265 CHY_2265 "N-acetyl-gamma-glutamyl-phosphate reductase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4355 BA_4355 "N-acetyl-gamma-glutamyl-phosphate reductase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P11446 argC "N-acetylglutamylphosphate reductase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|P63562 argC "N-acetyl-gamma-glutamyl-phosphate reductase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93Z70ARGC_ARATH1, ., 2, ., 1, ., 3, 80.72810.95420.7281yesno
Q9LA02ARGC_RHOCB1, ., 2, ., 1, ., 3, 80.53190.76470.6842yesno
B6JHG4ARGC_OLICO1, ., 2, ., 1, ., 3, 80.56320.77450.6732yesno
A1B2K9ARGC_PARDP1, ., 2, ., 1, ., 3, 80.51470.76470.6842yesno
Q6AV34ARGC_ORYSJ1, ., 2, ., 1, ., 3, 80.70730.93130.6867yesno
B9KSY0ARGC_RHOSK1, ., 2, ., 1, ., 3, 80.55120.76140.6812yesno
Q163W4ARGC_ROSDO1, ., 2, ., 1, ., 3, 80.52360.75810.6783yesno
A3PK36ARGC_RHOS11, ., 2, ., 1, ., 3, 80.54270.76140.6812yesno
Q3A3B8ARGC_PELCD1, ., 2, ., 1, ., 3, 80.51470.76470.6782yesno
Q5LS92ARGC_RUEPO1, ., 2, ., 1, ., 3, 80.52990.76140.6812yesno
A4WQY7ARGC_RHOS51, ., 2, ., 1, ., 3, 80.54700.76140.6812yesno
Q1GHL0ARGC_RUEST1, ., 2, ., 1, ., 3, 80.51910.76470.6842yesno
Q28PV9ARGC_JANSC1, ., 2, ., 1, ., 3, 80.52760.76470.6842yesno
Q3J277ARGC_RHOS41, ., 2, ., 1, ., 3, 80.54700.76140.6812yesno
Q2RRM4ARGC_RHORT1, ., 2, ., 1, ., 3, 80.60330.77450.6732yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.1.380.824
3rd Layer1.2.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036526001
RecName- Full=N-acetyl-gamma-glutamyl-phosphate reductase; EC=1.2.1.38; (398 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00032389001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (351 aa)
•••• •• 0.999
GSVIVG00035727001
SubName- Full=Chromosome undetermined scaffold_80, whole genome shotgun sequence; (467 aa)
• •• •• 0.996
GSVIVG00033255001
SubName- Full=Chromosome chr9 scaffold_65, whole genome shotgun sequence; (463 aa)
• •• •• 0.996
GSVIVG00015101001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (525 aa)
• ••  • 0.984
GSVIVG00014587001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (261 aa)
•  •  • 0.981
GSVIVG00017913001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (430 aa)
•  •  • 0.977
GSVIVG00034896001
SubName- Full=Chromosome chr4 scaffold_73, whole genome shotgun sequence; (407 aa)
•  •  • 0.975
GSVIVG00023053001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (430 aa)
• ••  • 0.966
GSVIVG00028327001
SubName- Full=Chromosome chr10 scaffold_43, whole genome shotgun sequence; (416 aa)
•  • •• 0.928
GSVIVG00012224001
SubName- Full=Putative uncharacterized protein (Chromosome undetermined scaffold_359, whole gen [...] (253 aa)
•     • 0.893

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
PLN02968381 PLN02968, PLN02968, Probable N-acetyl-gamma-glutam 1e-159
PRK00436343 PRK00436, argC, N-acetyl-gamma-glutamyl-phosphate 1e-123
TIGR01850346 TIGR01850, argC, N-acetyl-gamma-glutamyl-phosphate 1e-121
COG0002349 COG0002, ArgC, Acetylglutamate semialdehyde dehydr 1e-100
smart00859123 smart00859, Semialdhyde_dh, Semialdehyde dehydroge 1e-35
pfam01118121 pfam01118, Semialdhyde_dh, Semialdehyde dehydrogen 3e-32
PRK11863313 PRK11863, PRK11863, N-acetyl-gamma-glutamyl-phosph 5e-19
TIGR00978 341 TIGR00978, asd_EA, aspartate-semialdehyde dehydrog 2e-17
PRK08664 349 PRK08664, PRK08664, aspartate-semialdehyde dehydro 7e-16
TIGR01851310 TIGR01851, argC_other, N-acetyl-gamma-glutamyl-pho 2e-14
COG0136 334 COG0136, Asd, Aspartate-semialdehyde dehydrogenase 3e-12
pfam02774167 pfam02774, Semialdhyde_dhC, Semialdehyde dehydroge 1e-10
TIGR01296 338 TIGR01296, asd_B, aspartate-semialdehyde dehydroge 4e-07
PLN02383 344 PLN02383, PLN02383, aspartate semialdehyde dehydro 3e-06
PRK06728 347 PRK06728, PRK06728, aspartate-semialdehyde dehydro 1e-04
cd05259282 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ethe 2e-04
cd05250214 cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical 4e-04
PRK14874 334 PRK14874, PRK14874, aspartate-semialdehyde dehydro 4e-04
>gnl|CDD|215522 PLN02968, PLN02968, Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information 
 Score =  450 bits (1158), Expect = e-159
 Identities = 202/262 (77%), Positives = 225/262 (85%)

Query: 37  SSIRGSATLPTKSLQVEDGKTQKSEKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTA 96
            + R S T   +S+      + KSE++ RI +LGASGYTGAE+ RLLANHP F I +MTA
Sbjct: 12  LASRASVTSSPQSVVSSASSSVKSEEKKRIFVLGASGYTGAEVRRLLANHPDFEITVMTA 71

Query: 97  DRKAGQSIGSVFPHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIV 156
           DRKAGQS GSVFPHLI+QDLP +VAVKDADFS+VDAVFCCLPHGTTQEIIK LPK LKIV
Sbjct: 72  DRKAGQSFGSVFPHLITQDLPNLVAVKDADFSDVDAVFCCLPHGTTQEIIKALPKDLKIV 131

Query: 157 DLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQ 216
           DLSADFRLRD++EYEEWYG PH AP+LQKEAVYGLTE+ RE+IK+ARLVANPGCYPT IQ
Sbjct: 132 DLSADFRLRDIAEYEEWYGHPHRAPELQKEAVYGLTELQREEIKSARLVANPGCYPTGIQ 191

Query: 217 LPLVPLIQANLIQYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIE 276
           LPLVPL++A LI+  NIIIDAKSGVSGAGRGAKEANLY+EIAEGI +YGVTRHRHVPEIE
Sbjct: 192 LPLVPLVKAGLIEPDNIIIDAKSGVSGAGRGAKEANLYTEIAEGIGAYGVTRHRHVPEIE 251

Query: 277 QGLTGFASSKVTVSFTPHLMPM 298
           QGL   A SKVT SFTPHLMPM
Sbjct: 252 QGLADAAGSKVTPSFTPHLMPM 273

Length = 381
>gnl|CDD|234761 PRK00436, argC, N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>gnl|CDD|233597 TIGR01850, argC, N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>gnl|CDD|223081 COG0002, ArgC, Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|214863 smart00859, Semialdhyde_dh, Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|201603 pfam01118, Semialdhyde_dh, Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|237004 PRK11863, PRK11863, N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|233220 TIGR00978, asd_EA, aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>gnl|CDD|236329 PRK08664, PRK08664, aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233598 TIGR01851, argC_other, N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>gnl|CDD|223214 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|217222 pfam02774, Semialdhyde_dhC, Semialdehyde dehydrogenase, dimerisation domain Back     alignment and domain information
>gnl|CDD|233347 TIGR01296, asd_B, aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>gnl|CDD|178009 PLN02383, PLN02383, aspartate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|136022 PRK06728, PRK06728, aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase (PCBER) like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187560 cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|237845 PRK14874, PRK14874, aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 100.0
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 100.0
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 100.0
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 100.0
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 100.0
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 100.0
PRK08040336 putative semialdehyde dehydrogenase; Provisional 100.0
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PLN02383344 aspartate semialdehyde dehydrogenase 100.0
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 100.0
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
KOG4354340 consensus N-acetyl-gamma-glutamyl-phosphate reduct 100.0
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 100.0
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 100.0
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 100.0
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 100.0
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 100.0
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 100.0
KOG4777 361 consensus Aspartate-semialdehyde dehydrogenase [Am 99.97
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 99.96
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 99.82
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 99.81
PF02774184 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimer 99.79
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 99.77
PRK08300302 acetaldehyde dehydrogenase; Validated 99.73
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 99.73
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 99.73
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 99.71
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 99.67
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 99.66
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 99.63
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 99.62
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 99.59
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 99.55
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 99.52
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 99.45
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 99.37
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 99.32
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 98.91
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.01
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 97.97
PRK00048257 dihydrodipicolinate reductase; Provisional 97.97
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.94
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 97.81
PRK13303265 L-aspartate dehydrogenase; Provisional 97.77
CHL00194317 ycf39 Ycf39; Provisional 97.77
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 97.77
TIGR00036266 dapB dihydrodipicolinate reductase. 97.73
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 97.68
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 97.47
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.43
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.36
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 97.31
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.3
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.27
PLN02427 386 UDP-apiose/xylose synthase 97.2
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.12
PRK11579 346 putative oxidoreductase; Provisional 97.09
PLN03209 576 translocon at the inner envelope of chloroplast su 97.08
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.07
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.06
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 97.04
COG0673342 MviM Predicted dehydrogenases and related proteins 97.02
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 97.02
PRK08818 370 prephenate dehydrogenase; Provisional 96.98
PRK14982340 acyl-ACP reductase; Provisional 96.98
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.96
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.9
PLN02695 370 GDP-D-mannose-3',5'-epimerase 96.9
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 96.88
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.87
PRK06444197 prephenate dehydrogenase; Provisional 96.86
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 96.8
PLN02256304 arogenate dehydrogenase 96.79
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 96.78
COG2910211 Putative NADH-flavin reductase [General function p 96.68
PRK07417279 arogenate dehydrogenase; Reviewed 96.68
PRK08655 437 prephenate dehydrogenase; Provisional 96.66
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 96.65
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 96.61
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 96.59
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 96.59
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.59
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 96.58
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 96.56
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.55
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.53
PLN02166436 dTDP-glucose 4,6-dehydratase 96.52
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 96.5
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 96.47
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 96.46
PLN02206442 UDP-glucuronate decarboxylase 96.39
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.38
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 96.35
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.35
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.35
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 96.34
PLN00016378 RNA-binding protein; Provisional 96.32
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 96.31
COG2085211 Predicted dinucleotide-binding enzymes [General fu 96.3
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 96.28
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 96.28
PRK07502307 cyclohexadienyl dehydrogenase; Validated 96.28
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.27
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.24
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.24
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.23
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 96.19
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 96.19
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.1
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 96.09
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 96.07
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 96.02
PRK07680273 late competence protein ComER; Validated 95.98
PRK06349 426 homoserine dehydrogenase; Provisional 95.98
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 95.97
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 95.95
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 95.94
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.94
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 95.9
PRK06270341 homoserine dehydrogenase; Provisional 95.89
PLN02775286 Probable dihydrodipicolinate reductase 95.85
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 95.84
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 95.8
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.8
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.79
PLN00198338 anthocyanidin reductase; Provisional 95.73
PRK08507275 prephenate dehydrogenase; Validated 95.72
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 95.72
PRK08219227 short chain dehydrogenase; Provisional 95.7
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.67
PRK12320 699 hypothetical protein; Provisional 95.62
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 95.56
PLN02712 667 arogenate dehydrogenase 95.55
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.53
PLN02214342 cinnamoyl-CoA reductase 95.53
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 95.5
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 95.45
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 95.43
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.41
PRK10206 344 putative oxidoreductase; Provisional 95.4
PRK06545 359 prephenate dehydrogenase; Validated 95.4
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 95.4
PTZ00325321 malate dehydrogenase; Provisional 95.39
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 95.38
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 95.37
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 95.36
PLN02896 353 cinnamyl-alcohol dehydrogenase 95.31
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.3
COG3804 350 Uncharacterized conserved protein related to dihyd 95.28
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 95.22
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 95.2
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 95.15
PRK05086312 malate dehydrogenase; Provisional 95.11
PLN02686367 cinnamoyl-CoA reductase 95.11
PRK06223307 malate dehydrogenase; Reviewed 95.05
PLN02650 351 dihydroflavonol-4-reductase 95.03
PRK05442326 malate dehydrogenase; Provisional 94.99
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 94.98
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 94.96
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 94.91
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 94.9
PRK07201 657 short chain dehydrogenase; Provisional 94.9
COG5322351 Predicted dehydrogenase [General function predicti 94.88
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 94.87
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 94.86
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.86
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 94.85
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 94.84
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 94.83
PLN02712667 arogenate dehydrogenase 94.83
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 94.82
PLN00203519 glutamyl-tRNA reductase 94.78
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 94.61
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 94.61
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 94.57
PRK13301267 putative L-aspartate dehydrogenase; Provisional 94.48
PLN00106323 malate dehydrogenase 94.47
PRK15059292 tartronate semialdehyde reductase; Provisional 94.46
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 94.46
PRK05865 854 hypothetical protein; Provisional 94.46
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.38
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 94.37
PRK10675338 UDP-galactose-4-epimerase; Provisional 94.35
PRK06046326 alanine dehydrogenase; Validated 94.33
PLN02778298 3,5-epimerase/4-reductase 94.3
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.3
PLN02688266 pyrroline-5-carboxylate reductase 94.28
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.27
TIGR00243 389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 94.23
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 94.2
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 94.18
PRK06179270 short chain dehydrogenase; Provisional 94.12
PRK12480330 D-lactate dehydrogenase; Provisional 94.1
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 94.08
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 94.07
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 94.07
PRK12829264 short chain dehydrogenase; Provisional 94.06
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 93.99
COG2344211 AT-rich DNA-binding protein [General function pred 93.91
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.91
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 93.86
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 93.85
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.83
PLN02696 454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 93.73
PRK07326237 short chain dehydrogenase; Provisional 93.71
PLN02353 473 probable UDP-glucose 6-dehydrogenase 93.64
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.6
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.59
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 93.56
PRK06436303 glycerate dehydrogenase; Provisional 93.55
PRK08605332 D-lactate dehydrogenase; Validated 93.53
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 93.52
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 93.51
PRK05993277 short chain dehydrogenase; Provisional 93.49
PRK05866293 short chain dehydrogenase; Provisional 93.46
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.43
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 93.4
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 93.37
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.35
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 93.33
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 93.31
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 93.3
PRK08267260 short chain dehydrogenase; Provisional 93.23
PRK09009235 C factor cell-cell signaling protein; Provisional 93.22
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 93.19
PLN02583297 cinnamoyl-CoA reductase 93.17
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.13
PLN02572 442 UDP-sulfoquinovose synthase 93.13
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.11
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 93.05
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.04
PRK08264238 short chain dehydrogenase; Validated 93.03
PRK07574385 formate dehydrogenase; Provisional 93.02
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 92.97
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 92.94
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 92.92
PRK08618325 ornithine cyclodeaminase; Validated 92.92
PRK06182273 short chain dehydrogenase; Validated 92.9
PRK06141314 ornithine cyclodeaminase; Validated 92.89
PRK13940414 glutamyl-tRNA reductase; Provisional 92.86
PRK06249313 2-dehydropantoate 2-reductase; Provisional 92.83
PRK13243333 glyoxylate reductase; Reviewed 92.82
PRK07806248 short chain dehydrogenase; Provisional 92.71
PTZ00431260 pyrroline carboxylate reductase; Provisional 92.65
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 92.58
cd01483143 E1_enzyme_family Superfamily of activating enzymes 92.58
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.57
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 92.52
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 92.51
PRK06953222 short chain dehydrogenase; Provisional 92.35
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 92.34
PLN02260 668 probable rhamnose biosynthetic enzyme 92.32
PRK05693274 short chain dehydrogenase; Provisional 92.3
PRK07774250 short chain dehydrogenase; Provisional 92.27
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 92.22
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 92.18
PRK09291257 short chain dehydrogenase; Provisional 92.17
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 92.17
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 92.15
PRK06180277 short chain dehydrogenase; Provisional 92.14
PRK06392326 homoserine dehydrogenase; Provisional 92.03
PTZ00117319 malate dehydrogenase; Provisional 91.95
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 91.93
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 91.92
TIGR01746 367 Thioester-redct thioester reductase domain. It has 91.87
PLN02928347 oxidoreductase family protein 91.82
PRK07454241 short chain dehydrogenase; Provisional 91.82
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 91.82
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 91.8
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 91.68
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 91.59
PRK06718202 precorrin-2 dehydrogenase; Reviewed 91.53
PLN03139386 formate dehydrogenase; Provisional 91.5
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 91.48
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.43
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 91.39
PRK07578199 short chain dehydrogenase; Provisional 91.39
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.27
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 91.26
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 91.17
PRK07023243 short chain dehydrogenase; Provisional 91.16
PLN02260668 probable rhamnose biosynthetic enzyme 91.14
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 91.07
PRK08291330 ectoine utilization protein EutC; Validated 91.02
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.01
PLN02653340 GDP-mannose 4,6-dehydratase 90.98
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.9
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 90.85
PLN02240 352 UDP-glucose 4-epimerase 90.85
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 90.8
PRK12921305 2-dehydropantoate 2-reductase; Provisional 90.79
PRK06138252 short chain dehydrogenase; Provisional 90.76
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.71
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 90.68
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 90.63
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 90.62
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 90.57
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 90.53
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 90.41
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 90.39
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 90.29
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 90.26
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 90.12
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 90.04
PRK06932314 glycerate dehydrogenase; Provisional 90.03
PRK08374336 homoserine dehydrogenase; Provisional 90.03
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 89.98
PRK06813346 homoserine dehydrogenase; Validated 89.83
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 89.82
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 89.81
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 89.78
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 89.73
PRK07890258 short chain dehydrogenase; Provisional 89.66
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 89.55
PRK06487317 glycerate dehydrogenase; Provisional 89.54
PRK09496 453 trkA potassium transporter peripheral membrane com 89.52
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 89.51
PRK06057255 short chain dehydrogenase; Provisional 89.48
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.48
PLN02858 1378 fructose-bisphosphate aldolase 89.46
PRK06153393 hypothetical protein; Provisional 89.46
PRK07060245 short chain dehydrogenase; Provisional 89.41
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.39
PRK07340304 ornithine cyclodeaminase; Validated 89.36
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 89.22
PRK05479330 ketol-acid reductoisomerase; Provisional 89.21
PRK06196315 oxidoreductase; Provisional 89.21
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 89.19
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 89.08
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 89.01
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 88.86
PRK12828239 short chain dehydrogenase; Provisional 88.77
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 88.76
PRK06407301 ornithine cyclodeaminase; Provisional 88.71
COG3268 382 Uncharacterized conserved protein [Function unknow 88.67
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 88.59
PLN02602350 lactate dehydrogenase 88.5
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 88.44
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.43
PTZ00082321 L-lactate dehydrogenase; Provisional 88.43
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 88.42
PRK07856252 short chain dehydrogenase; Provisional 88.38
PRK10538248 malonic semialdehyde reductase; Provisional 88.37
PRK06823315 ornithine cyclodeaminase; Validated 88.24
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 88.18
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 88.08
PRK07825273 short chain dehydrogenase; Provisional 88.03
PRK08263275 short chain dehydrogenase; Provisional 88.02
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 88.0
PRK12746254 short chain dehydrogenase; Provisional 87.98
PRK06181263 short chain dehydrogenase; Provisional 87.97
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 87.96
PRK06947248 glucose-1-dehydrogenase; Provisional 87.87
PLN00112444 malate dehydrogenase (NADP); Provisional 87.71
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 87.7
PLN02996 491 fatty acyl-CoA reductase 87.59
PRK06719157 precorrin-2 dehydrogenase; Validated 87.5
PRK09135249 pteridine reductase; Provisional 87.43
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 87.21
PRK12367245 short chain dehydrogenase; Provisional 87.16
PRK06924251 short chain dehydrogenase; Provisional 87.12
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.09
PRK08177225 short chain dehydrogenase; Provisional 87.07
PLN02503 605 fatty acyl-CoA reductase 2 87.06
PRK06398258 aldose dehydrogenase; Validated 87.04
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 87.01
PRK08017256 oxidoreductase; Provisional 86.77
PRK07102243 short chain dehydrogenase; Provisional 86.76
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 86.75
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 86.72
PRK07424406 bifunctional sterol desaturase/short chain dehydro 86.71
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 86.66
COG0743 385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 86.58
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.99
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 85.98
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 85.84
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 85.73
PLN02858 1378 fructose-bisphosphate aldolase 85.64
PRK07589346 ornithine cyclodeaminase; Validated 85.55
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 85.52
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 85.47
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 85.46
PRK09496453 trkA potassium transporter peripheral membrane com 85.35
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.29
PLN02306386 hydroxypyruvate reductase 85.23
PRK07024257 short chain dehydrogenase; Provisional 85.1
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 85.06
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 84.95
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 84.65
PRK06914280 short chain dehydrogenase; Provisional 84.6
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 84.56
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 84.55
PRK12827249 short chain dehydrogenase; Provisional 84.04
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.96
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.85
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 83.82
PRK09134258 short chain dehydrogenase; Provisional 83.81
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 83.74
COG3320 382 Putative dehydrogenase domain of multifunctional n 83.59
PRK08251248 short chain dehydrogenase; Provisional 83.53
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 83.44
PRK07814263 short chain dehydrogenase; Provisional 83.28
PRK07904253 short chain dehydrogenase; Provisional 83.2
PRK07074257 short chain dehydrogenase; Provisional 83.02
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 82.86
PRK09186256 flagellin modification protein A; Provisional 82.77
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.69
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 82.64
PRK06482276 short chain dehydrogenase; Provisional 82.55
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 82.34
PRK12742237 oxidoreductase; Provisional 82.32
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 82.29
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 82.28
PRK06101240 short chain dehydrogenase; Provisional 82.17
KOG2733 423 consensus Uncharacterized membrane protein [Functi 82.15
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.03
PRK07063260 short chain dehydrogenase; Provisional 81.95
PRK06949258 short chain dehydrogenase; Provisional 81.82
PRK05717255 oxidoreductase; Validated 81.77
PRK12549284 shikimate 5-dehydrogenase; Reviewed 81.6
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.59
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 81.57
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 81.4
PRK12548289 shikimate 5-dehydrogenase; Provisional 81.39
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 81.38
PRK08277278 D-mannonate oxidoreductase; Provisional 81.33
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 81.28
smart00822180 PKS_KR This enzymatic domain is part of bacterial 81.28
PRK08643256 acetoin reductase; Validated 81.17
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 81.16
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 81.01
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.95
PRK08328231 hypothetical protein; Provisional 80.89
PRK07775274 short chain dehydrogenase; Provisional 80.88
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 80.74
PRK12939250 short chain dehydrogenase; Provisional 80.74
PRK08265261 short chain dehydrogenase; Provisional 80.68
PRK06194287 hypothetical protein; Provisional 80.59
PRK12743256 oxidoreductase; Provisional 80.45
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.45
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 80.37
PRK09072263 short chain dehydrogenase; Provisional 80.14
PRK07577234 short chain dehydrogenase; Provisional 80.04
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 80.02
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=7.8e-79  Score=579.30  Aligned_cols=243  Identities=47%  Similarity=0.835  Sum_probs=226.0

Q ss_pred             CccEEEEEccccHHHHHHHHHHhcCCCceEEEEeccccCCcccccccCCccc-CCCccccccCccc--CCCCCEEEecCC
Q 021865           62 KQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLIS-QDLPTMVAVKDAD--FSNVDAVFCCLP  138 (306)
Q Consensus        62 ~~~kVaIiGATGyvG~ELlrlL~~HP~~el~~l~S~~~aGk~l~~~~p~l~~-~~~~~~~~~~~~~--~~~~DvVF~alp  138 (306)
                      +|+||+|+|||||+|.||+|+|.+||++|+...+|++.+|+++.+.||++++ .++ .++.++++.  .+++|+||+|||
T Consensus         1 ~~~kV~IvGasGYtG~EL~rlL~~Hp~ve~~~~ss~~~~g~~~~~~~p~l~g~~~l-~~~~~~~~~~~~~~~DvvFlalP   79 (349)
T COG0002           1 MMIKVGIVGASGYTGLELLRLLAGHPDVELILISSRERAGKPVSDVHPNLRGLVDL-PFQTIDPEKIELDECDVVFLALP   79 (349)
T ss_pred             CCceEEEEcCCCCcHHHHHHHHhcCCCeEEEEeechhhcCCchHHhCccccccccc-ccccCChhhhhcccCCEEEEecC
Confidence            5799999999999999999999999999988888888899999999999985 333 244444333  256999999999


Q ss_pred             ccchHHHHHhc-CCCCeEEECCcccccCCccchhhhcCCCCCCcchhhhhhhcccccchhcccCCcEEecCCChHHHHhh
Q 021865          139 HGTTQEIIKGL-PKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQL  217 (306)
Q Consensus       139 ~~~s~~~~~~l-~~g~~VIDlSadfRl~~~~~y~~wY~~~h~~Pel~~~avYGLpEl~r~~i~~a~lVAnPGCy~Ta~~L  217 (306)
                      |++|+++++.+ ++|++|||||+|||++|++.|++||+.+|..||++++++||||||+||+|+++++||||||||||++|
T Consensus        80 hg~s~~~v~~l~~~g~~VIDLSadfR~~d~~~ye~~Yg~~h~~~~~l~~avYGLpEl~~e~i~~A~lIAnPGCypTa~iL  159 (349)
T COG0002          80 HGVSAELVPELLEAGCKVIDLSADFRLKDPEVYEKWYGFTHAGPELLEDAVYGLPELHREKIRGAKLIANPGCYPTAAIL  159 (349)
T ss_pred             chhHHHHHHHHHhCCCeEEECCcccccCCHHHHHHhhCCCCCCchhhhcccccCcccCHHHHhcCCEeeCCCchHHHHHH
Confidence            99999999988 78999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHhccCCCCce-EEEEeeeecCccCccccccccHHHHhcCceeecCCCCCchhHHHHHhhcccCCcceEEEEeeee
Q 021865          218 PLVPLIQANLIQYRN-IIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLM  296 (306)
Q Consensus       218 aL~PL~~~~li~~~~-iiV~a~sgvSGAGr~~~~~~~~~e~~~n~~~Y~~~~HrH~pEI~q~L~~~~~~~~~v~Ftphlv  296 (306)
                      +|+||++.|+++.+. ++||++||+|||||+++..+||+|+++|++||+++.|||+|||+|+|+++++....++||||++
T Consensus       160 al~PL~~~~ll~~~~~~ivdakSG~SGaGrk~s~~~~~~e~~~~~~~Y~~~~HrH~pEi~q~l~~l~~~~~~v~FtPhl~  239 (349)
T COG0002         160 ALAPLVKAGLLDPDSPPIVDAKSGVSGAGRKASVKNHFPEVNDSLRPYGLTGHRHTPEIEQHLGRLAGRKVPVIFTPHLG  239 (349)
T ss_pred             HHHHHHHcCCcCCCCceEEEEeEecCcCCCCccccccchhhccccccccccccCchHHHHHHhhhcccCcCceEEecccc
Confidence            999999999998886 6999999999999999999999999999999999999999999999999988778899999999


Q ss_pred             ccccccccc
Q 021865          297 PMVTVSLRC  305 (306)
Q Consensus       297 P~~RGil~~  305 (306)
                      ||.|||+..
T Consensus       240 p~~RGIl~T  248 (349)
T COG0002         240 PFVRGILAT  248 (349)
T ss_pred             cccceEEEE
Confidence            999999863

>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>KOG4354 consensus N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF02774 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimerisation domain; InterPro: IPR012280 This domain contains N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
1xyg_A359 X-Ray Structure Of Gene Product From Arabidopsis Th 1e-120
2cvo_A366 Crystal Structure Of Putative N-Acetyl-Gamma-Glutam 1e-113
1vkn_A351 Crystal Structure Of N-Acetyl-Gamma-Glutamyl-Phosph 3e-54
3dr3_A337 Structure Of Idp00107, A Potential N-Acetyl-Gamma- 8e-36
2g17_A337 The Structure Of N-Acetyl-Gamma-Glutamyl-Phosphate 2e-35
2i3a_A352 Crystal Structure Of N-Acetyl-Gamma-Glutamyl-Phosph 2e-33
2nqt_A352 Crystal Structure Of N-Acetyl-Gamma-Glutamyl-Phosph 4e-32
2ozp_A 345 Crystal Structure Of N-Acetyl-Gamma-Glutamyl-Phosph 2e-28
2ep5_A 350 Structural Study Of Project Id St1242 From Sulfolob 6e-11
1ys4_A 354 Structure Of Aspartate-Semialdehyde Dehydrogenase F 7e-10
4dpk_A 359 Structure Of Malonyl-coenzyme A Reductase From Cren 2e-06
2yv3_A 331 Crystal Structure Of Aspartate Semialdehyde Dehydro 2e-05
>pdb|1XYG|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At2g19940 Length = 359 Back     alignment and structure 
Iteration: 1

 Score =  429 bits (1103), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/251 (81%), Positives = 225/251 (89%)
Query: 49  SLQVEDGKTQKSEKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVF 108
           S +V    + K EK +RIGLLGASGYTGAEIVRLLANHP+F + LMTADRKAGQS+ SVF
Sbjct: 2   SFRVSASSSVKPEKDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVF 61
Query: 109 PHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVS 168
           PHL +Q LPT+V+VKDADFS VDAVFCCLPHGTTQEIIK LP +LKIVDLSADFRLR+++
Sbjct: 62  PHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIA 121
Query: 169 EYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLI 228
           EYEEWYGQPH A +LQKE VYGLTEI REDIK ARLVANPGCYPT+IQLPLVPL++ANLI
Sbjct: 122 EYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLI 181
Query: 229 QYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVT 288
           ++ NIIIDAKSGVSGAGRGAKEANLYSEIAEGI SYGVTRHRHVPEIEQGL+  A SKVT
Sbjct: 182 KHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVT 241
Query: 289 VSFTPHLMPMV 299
           VSFTPHLMPM+
Sbjct: 242 VSFTPHLMPMI 252
>pdb|2CVO|A Chain A, Crystal Structure Of Putative N-Acetyl-Gamma-Glutamyl- Phosphate Reductase (Ak071544) From Rice (Oryza Sativa) Length = 366 Back     alignment and structure
>pdb|1VKN|A Chain A, Crystal Structure Of N-Acetyl-Gamma-Glutamyl-Phosphate Reductase (Tm1782) From Thermotoga Maritima At 1.80 A Resolution Length = 351 Back     alignment and structure
>pdb|3DR3|A Chain A, Structure Of Idp00107, A Potential N-Acetyl-Gamma- Glutamylphosphate Reductase From Shigella Flexneri Length = 337 Back     alignment and structure
>pdb|2G17|A Chain A, The Structure Of N-Acetyl-Gamma-Glutamyl-Phosphate Reductase From Salmonella Typhimurium Length = 337 Back     alignment and structure
>pdb|2I3A|A Chain A, Crystal Structure Of N-Acetyl-Gamma-Glutamyl-Phosphate Reductase (Rv1652) From Mycobacterium Tuberculosis Length = 352 Back     alignment and structure
>pdb|2NQT|A Chain A, Crystal Structure Of N-Acetyl-Gamma-Glutamyl-Phosphate Reductase (Rv1652) From Mycobacterium Tuberculosis At 1.58 A Resolution Length = 352 Back     alignment and structure
>pdb|2OZP|A Chain A, Crystal Structure Of N-Acetyl-Gamma-Glutamyl-Phosphate Reductase (Ttha1904) From Thermus Thermophilus Length = 345 Back     alignment and structure
>pdb|2EP5|A Chain A, Structural Study Of Project Id St1242 From Sulfolobus Tokodaii Strain7 Length = 350 Back     alignment and structure
>pdb|1YS4|A Chain A, Structure Of Aspartate-Semialdehyde Dehydrogenase From Methanococcus Jannaschii Length = 354 Back     alignment and structure
>pdb|4DPK|A Chain A, Structure Of Malonyl-coenzyme A Reductase From Crenarchaeota Length = 359 Back     alignment and structure
>pdb|2YV3|A Chain A, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 1e-149
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 1e-136
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 1e-130
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 1e-126
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 1e-123
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 1e-15
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 1e-15
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 3e-14
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 1e-06
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 5e-06
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 3e-05
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 8e-05
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 1e-04
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 3e-04
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 4e-04
2yv3_A 331 Aspartate-semialdehyde dehydrogenase; aspartate pa 6e-04
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 6e-04
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 7e-04
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 8e-04
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Length = 359 Back     alignment and structure
 Score =  420 bits (1083), Expect = e-149
 Identities = 204/251 (81%), Positives = 225/251 (89%)

Query: 49  SLQVEDGKTQKSEKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVF 108
           S +V    + K EK +RIGLLGASGYTGAEIVRLLANHP+F + LMTADRKAGQS+ SVF
Sbjct: 2   SFRVSASSSVKPEKDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVF 61

Query: 109 PHLISQDLPTMVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVS 168
           PHL +Q LPT+V+VKDADFS VDAVFCCLPHGTTQEIIK LP +LKIVDLSADFRLR+++
Sbjct: 62  PHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIA 121

Query: 169 EYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPLIQANLI 228
           EYEEWYGQPH A +LQKE VYGLTEI REDIK ARLVANPGCYPT+IQLPLVPL++ANLI
Sbjct: 122 EYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLI 181

Query: 229 QYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVT 288
           ++ NIIIDAKSGVSGAGRGAKEANLYSEIAEGI SYGVTRHRHVPEIEQGL+  A SKVT
Sbjct: 182 KHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVT 241

Query: 289 VSFTPHLMPMV 299
           VSFTPHLMPM+
Sbjct: 242 VSFTPHLMPMI 252
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 351 Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Length = 345 Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Length = 352 Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Length = 337 Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Length = 350 Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Length = 354 Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Length = 381 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Length = 336 Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Length = 366 Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Length = 370 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Length = 331 Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Length = 377 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Length = 367 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 100.0
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 100.0
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 100.0
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 100.0
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 100.0
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 100.0
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 100.0
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 100.0
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 100.0
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 100.0
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 100.0
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 100.0
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 100.0
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 100.0
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 100.0
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 99.98
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 99.97
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 99.97
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 99.96
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 99.95
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 99.95
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 99.94
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 99.88
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 99.85
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 99.78
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 99.78
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 99.75
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 99.72
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 99.63
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 99.6
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 99.58
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 99.57
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 99.56
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 99.54
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 99.53
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 99.49
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 99.18
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.68
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 98.45
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 98.18
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 98.18
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.15
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 98.15
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 98.12
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.02
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 98.0
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.0
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.88
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.87
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.81
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 97.77
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.74
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.74
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.72
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 97.7
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.69
3slg_A372 PBGP3 protein; structural genomics, seattle struct 97.68
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 97.67
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.64
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.64
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.63
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 97.63
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 97.62
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 97.6
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.6
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 97.6
4had_A350 Probable oxidoreductase protein; structural genomi 97.6
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.58
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.56
1ydw_A 362 AX110P-like protein; structural genomics, protein 97.55
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.55
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.54
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.54
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 97.54
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 97.53
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 97.53
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.52
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.51
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 97.49
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 97.49
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 97.49
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.47
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 97.47
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.44
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.44
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.43
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 97.42
1xq6_A253 Unknown protein; structural genomics, protein stru 97.42
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.41
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.41
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.39
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.38
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 97.37
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 97.37
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.37
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 97.36
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.34
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.34
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.33
2wm3_A299 NMRA-like family domain containing protein 1; unkn 97.32
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 97.32
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.3
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.3
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.29
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.25
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.24
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 97.24
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 97.23
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.23
4ezb_A317 Uncharacterized conserved protein; structural geno 97.22
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.21
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.21
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 97.21
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 97.21
3ius_A286 Uncharacterized conserved protein; APC63810, silic 97.19
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 97.19
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 97.13
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 97.12
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 97.11
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.11
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.1
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.1
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 97.08
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.07
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 97.07
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 97.07
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 97.07
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.05
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 97.04
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.04
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 97.03
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.02
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 97.02
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 97.02
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 97.01
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 96.99
1vpd_A299 Tartronate semialdehyde reductase; structural geno 96.99
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 96.97
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 96.96
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 96.96
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.96
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 96.96
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.96
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 96.95
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 96.95
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 96.95
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 96.94
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.94
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.94
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 96.93
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 96.92
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 96.9
4h3v_A 390 Oxidoreductase domain protein; structural genomics 96.89
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 96.89
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.88
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.86
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 96.86
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 96.86
1yb4_A295 Tartronic semialdehyde reductase; structural genom 96.86
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 96.85
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.84
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 96.82
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.81
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 96.79
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.78
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 96.78
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 96.78
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.77
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.77
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.77
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.76
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 96.76
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.76
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 96.75
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 96.75
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 96.74
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 96.73
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.73
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 96.73
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.72
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.7
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.7
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 96.69
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.68
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.68
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 96.68
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 96.67
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 96.67
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 96.66
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.66
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.66
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 96.65
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.65
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 96.64
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 96.63
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.61
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 96.6
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 96.6
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 96.59
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.58
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 96.57
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 96.56
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 96.56
4f6l_B 508 AUSA reductase domain protein; thioester reductase 96.54
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 96.54
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 96.54
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.52
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 96.52
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 96.51
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 96.49
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 96.49
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 96.47
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.46
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 96.46
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 96.42
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.39
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 96.39
4f6c_A 427 AUSA reductase domain protein; thioester reductase 96.38
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 96.37
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.37
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 96.34
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 96.29
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 96.27
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 96.27
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.26
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 96.23
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 96.21
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 96.19
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 96.18
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 96.16
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 96.14
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 96.14
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 96.11
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 96.1
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 96.1
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 96.09
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 96.06
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.05
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 96.05
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 96.03
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 96.03
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 96.02
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 95.98
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.98
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 95.95
3l6d_A306 Putative oxidoreductase; structural genomics, prot 95.95
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 95.94
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 95.92
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 95.89
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 95.88
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 95.88
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 95.88
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 95.88
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 95.87
2d59_A144 Hypothetical protein PH1109; COA binding, structur 95.85
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 95.85
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 95.85
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 95.84
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 95.83
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 95.83
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 95.81
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 95.79
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 95.78
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 95.77
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 95.77
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 95.75
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 95.73
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 95.72
2duw_A145 Putative COA-binding protein; ligand binding prote 95.71
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 95.7
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.7
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.67
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 95.67
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 95.67
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 95.62
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 95.6
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 95.59
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 95.59
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.58
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 95.55
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 95.54
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 95.54
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 95.5
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 95.5
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 95.48
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 95.47
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 95.41
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 95.38
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 95.38
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 95.35
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 95.34
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 95.33
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 95.28
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.28
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 95.21
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.2
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.18
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 95.17
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.16
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 95.15
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 95.15
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 95.13
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 95.11
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 95.09
1iuk_A140 Hypothetical protein TT1466; structural genomics, 95.05
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 95.01
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 95.0
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 95.0
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 95.0
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 94.97
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 94.92
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 94.89
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 94.89
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 94.88
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 94.87
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 94.83
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.79
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 94.79
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 94.76
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 94.7
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 94.7
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 94.64
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 94.64
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 94.62
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 94.62
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 94.6
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 94.6
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 94.57
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 94.56
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 94.56
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 94.54
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.53
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 94.51
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 94.43
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 94.4
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 94.39
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 94.39
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 94.35
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 94.31
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 94.29
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 94.27
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.26
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 94.25
2y1e_A 398 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 94.25
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 94.24
1q0q_A 406 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 94.23
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 94.2
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 94.16
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 94.15
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.05
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.05
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 94.03
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 94.03
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 94.02
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 93.99
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 93.95
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 93.91
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 93.86
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 93.82
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 93.8
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 93.72
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 93.67
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 93.58
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 93.57
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 93.55
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 93.55
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 93.46
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 92.54
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 93.38
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 93.36
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 93.33
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 93.27
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 93.21
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 93.17
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 93.16
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 93.15
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 93.05
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.0
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 92.96
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 92.96
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 92.93
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 92.92
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 92.85
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 92.85
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 92.8
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 92.79
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 92.79
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 92.77
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 92.74
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 92.7
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 92.7
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 92.68
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 92.67
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.66
3au8_A 488 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 92.66
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 92.66
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 92.61
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 92.6
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 92.52
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 92.51
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 92.49
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 92.49
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 92.37
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 92.35
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 92.34
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 92.18
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 91.97
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 91.95
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 91.93
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 91.9
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 91.84
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.84
3l07_A285 Bifunctional protein fold; structural genomics, ID 91.84
4e4y_A244 Short chain dehydrogenase family protein; structur 91.81
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 91.7
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 91.65
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 91.64
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 91.62
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 91.6
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 91.6
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 91.6
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 91.51
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 91.51
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 91.45
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 91.41
1lnq_A336 MTHK channels, potassium channel related protein; 91.39
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 91.39
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 91.32
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 91.31
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 91.22
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 91.17
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 91.05
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 90.95
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 90.94
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 90.91
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 90.9
3p2o_A285 Bifunctional protein fold; structural genomics, ce 90.74
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 90.6
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 90.59
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 90.55
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 90.53
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 90.32
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 90.3
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 90.28
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 90.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 89.86
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 89.81
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 89.74
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 89.55
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 89.53
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 89.4
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 89.22
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 89.13
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 89.03
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 88.86
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 88.79
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 88.72
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 88.68
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 88.64
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 88.62
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 88.59
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 88.59
2csu_A 457 457AA long hypothetical protein; structural genomi 88.46
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 88.45
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 88.39
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 88.38
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 88.25
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 88.2
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 88.07
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 87.99
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 87.75
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 87.74
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 87.67
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 87.62
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 87.58
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 87.43
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 87.36
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 87.29
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 87.29
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 87.22
1spx_A278 Short-chain reductase family member (5L265); paral 87.18
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 86.99
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 86.52
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 86.48
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 86.47
4g65_A 461 TRK system potassium uptake protein TRKA; structur 86.46
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 86.39
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 86.39
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 86.38
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 86.03
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 85.93
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
Probab=100.00  E-value=9.8e-73  Score=543.89  Aligned_cols=242  Identities=45%  Similarity=0.799  Sum_probs=226.2

Q ss_pred             ccCccEEEEEccccHHHHHHHHHHhcCCCceEEEEeccccCCcccccccCCcccCCCccccccCcccC-CCCCEEEecCC
Q 021865           60 SEKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADF-SNVDAVFCCLP  138 (306)
Q Consensus        60 ~~~~~kVaIiGATGyvG~ELlrlL~~HP~~el~~l~S~~~aGk~l~~~~p~l~~~~~~~~~~~~~~~~-~~~DvVF~alp  138 (306)
                      -+.|+||+|+|||||+|+||+|+|++||++++..++|++++|+++.++||+++ .++. +++.+.+++ .++|+||+|+|
T Consensus        10 ~~~~~~V~IvGAtG~vG~ellrlL~~hP~~el~~l~S~~~aG~~~~~~~p~~~-~~l~-~~~~~~~~~~~~~Dvvf~alp   87 (351)
T 1vkn_A           10 HHHMIRAGIIGATGYTGLELVRLLKNHPEAKITYLSSRTYAGKKLEEIFPSTL-ENSI-LSEFDPEKVSKNCDVLFTALP   87 (351)
T ss_dssp             --CCEEEEEESTTSHHHHHHHHHHHHCTTEEEEEEECSTTTTSBHHHHCGGGC-CCCB-CBCCCHHHHHHHCSEEEECCS
T ss_pred             ccceeEEEEECCCCHHHHHHHHHHHcCCCcEEEEEeCcccccCChHHhChhhc-cCce-EEeCCHHHhhcCCCEEEECCC
Confidence            45689999999999999999999999999999999999999999999999986 4442 444444454 67999999999


Q ss_pred             ccchHHHHHhcCCCCeEEECCcccccCCccchhhhcCCCCCCcchhhhhhhcccccchhcccCCcEEecCCChHHHHhhh
Q 021865          139 HGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLP  218 (306)
Q Consensus       139 ~~~s~~~~~~l~~g~~VIDlSadfRl~~~~~y~~wY~~~h~~Pel~~~avYGLpEl~r~~i~~a~lVAnPGCy~Ta~~La  218 (306)
                      |++|+++++.+ +|++|||||+|||++++++|++||+.+|.+|+++++ +|||||+||++|+++++|||||||+|+++|+
T Consensus        88 ~~~s~~~~~~~-~g~~VIDlSsdfRl~~~~~y~~~y~~~h~~p~~~~~-~yglPE~n~e~i~~a~iIANPgC~~t~~~la  165 (351)
T 1vkn_A           88 AGASYDLVREL-KGVKIIDLGADFRFDDPGVYREWYGKELSGYENIKR-VYGLPELHREEIKNAQVVGNPGCYPTSVILA  165 (351)
T ss_dssp             TTHHHHHHTTC-CSCEEEESSSTTTCSSHHHHHHHHCCCCTTGGGCCE-EECCHHHHHHHHTTCSEEECCCHHHHHHHHH
T ss_pred             cHHHHHHHHHh-CCCEEEECChhhhCCchhhhhhhcCCCCCchhhcCC-ceECCccCHHHhccCCEEeCCChHHHHHHHH
Confidence            99999999999 999999999999999999999999999999999999 9999999999999999999999999999999


Q ss_pred             hhHHHhccCCCCceEEEEeeeecCccCccccccccHHHHhcCceeecCCCCCchhHHHHHhhcccCCcceEEEEeeeecc
Q 021865          219 LVPLIQANLIQYRNIIIDAKSGVSGAGRGAKEANLYSEIAEGIYSYGVTRHRHVPEIEQGLTGFASSKVTVSFTPHLMPM  298 (306)
Q Consensus       219 L~PL~~~~li~~~~iiV~a~sgvSGAGr~~~~~~~~~e~~~n~~~Y~~~~HrH~pEI~q~L~~~~~~~~~v~FtphlvP~  298 (306)
                      |+||+++++|+.++|+|+|+||+|||||++++++||+|+++|++||+++.|||+|||+|+|+++.+.+++|+||||++||
T Consensus       166 L~PL~~~~~i~~~~iiv~t~sgvSGAG~~~~~~~~~~e~~~n~~~y~~~~h~h~pEi~~el~~i~~~~~~v~ftp~rvPv  245 (351)
T 1vkn_A          166 LAPALKHNLVDPETILVDAKSGVSGAGRKEKVDYLFSEVNESLRPYNVAKHRHVPEMEQELGKISGKKVNVVFTPHLVPM  245 (351)
T ss_dssp             HHHHHHTTCSCCSEEEEEEEEEGGGGCSCCSGGGBHHHHTTCCEECSCSCCTHHHHHHHHHHHHHTSCCEEEEEEEEESS
T ss_pred             HHHHHHcCCCCCCEEEEEEEeeccccCcccccccchhHHhcccccCCccccccHHHHHHHHHHhhCCCCCEEEEEEEecc
Confidence            99999999888789999999999999999999999999999999999999999999999999987778899999999999


Q ss_pred             ccccccc
Q 021865          299 VTVSLRC  305 (306)
Q Consensus       299 ~RGil~~  305 (306)
                      .|||+.+
T Consensus       246 ~rG~~~t  252 (351)
T 1vkn_A          246 TRGILST  252 (351)
T ss_dssp             SSCEEEE
T ss_pred             ccEEEEE
Confidence            9999875
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d2cvoa1183 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde 9e-42
d1vkna1176 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamy 3e-39
d2g17a1179 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamy 3e-30
d1vkna2163 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosp 2e-25
d2cvoa2165 d.81.1.1 (A:219-383) Putative semialdehyde dehydro 2e-24
d2hjsa1144 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog 3e-20
d2gz1a1154 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semiald 7e-19
d2g17a2155 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosp 9e-19
d1mb4a1147 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semiald 6e-13
d1t4ba1146 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semiald 3e-11
d1nvmb1157 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydroge 3e-05
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Putative semialdehyde dehydrogenase
species: Rice (Oryza sativa) [TaxId: 4530]

 Score =  140 bits (354), Expect = 9e-42
 Identities = 124/176 (70%), Positives = 144/176 (81%), Gaps = 1/176 (0%)

Query: 59  KSEKQVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPT 118
           KS ++VRI +LGASGYTGAEIVRLLANHP F IK+MTADRKAG+  GSVFPHLI+QDLP 
Sbjct: 1   KSGEEVRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHLITQDLPN 60

Query: 119 MVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPH 178
           +VAVKDADFSNVDAVFCCLPHGTTQEIIKGLP+ LKIVDLSADFRLRD++EY EWYG  H
Sbjct: 61  LVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYAEWYGHSH 120

Query: 179 IAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVPL-IQANLIQYRNI 233
            AP+LQ+EAVYGLTE+ R +I+NARLVANPG    +    +  L +   L +   +
Sbjct: 121 RAPELQQEAVYGLTEVLRNEIRNARLVANPGLVKGASGQAVQNLNLMMGLPENTGL 176
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Length = 176 Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Length = 179 Back     information, alignment and structure
>d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Length = 163 Back     information, alignment and structure
>d2cvoa2 d.81.1.1 (A:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Length = 165 Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Length = 144 Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Length = 154 Back     information, alignment and structure
>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Length = 147 Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Length = 157 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 100.0
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 100.0
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 100.0
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 100.0
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 100.0
d1vkna2163 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.97
d2cvoa2165 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.97
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.97
d2g17a2155 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.95
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.91
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 99.82
d1t4ba2221 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.13
d1mb4a2222 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.06
d2gz1a2202 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.01
d2hjsa2190 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 98.97
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.44
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.42
d1cf2o2165 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.37
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.31
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.26
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 98.16
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.09
d1b7go2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.04
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 97.87
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.87
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 97.82
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.67
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.65
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.57
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.56
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.52
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 97.49
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 97.45
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.39
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.36
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.33
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.3
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.3
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 97.29
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.24
d2czca1162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.23
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.12
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.07
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.05
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.04
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.04
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.95
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.93
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 96.91
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 96.87
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.78
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.7
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.68
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.65
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.63
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 96.62
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.62
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 96.61
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.54
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.48
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 96.47
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 96.46
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 96.42
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.42
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 96.35
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 96.32
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.27
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.21
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.17
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 96.16
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 96.16
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.04
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 95.99
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.97
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 95.95
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 95.91
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.88
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.85
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 95.81
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 95.73
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.65
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.57
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 95.56
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.55
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.48
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 95.48
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.46
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.45
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 95.42
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.41
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.22
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 95.21
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.17
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.16
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.08
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.04
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.01
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 95.01
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.91
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.8
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 94.78
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.61
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 94.6
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 94.47
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.46
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.45
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.44
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.37
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 94.32
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.3
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.29
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 94.19
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.16
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 94.11
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.07
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 94.05
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 93.97
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 93.95
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 93.88
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 93.64
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.6
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 93.33
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.27
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 92.9
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 92.68
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 92.2
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 91.56
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 91.52
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 91.15
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 90.73
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 90.72
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 90.66
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 90.37
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.18
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 90.0
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 90.0
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 89.22
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 88.9
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.46
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 88.36
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.24
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 86.84
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 86.8
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 86.33
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 86.24
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 85.8
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 85.71
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 85.7
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 85.3
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 85.17
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 84.68
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.64
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 84.33
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 84.32
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 84.17
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 83.49
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 83.08
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 82.61
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 80.59
d1id1a_153 Rck domain from putative potassium channel Kch {Es 80.57
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 80.07
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 80.01
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: N-acetyl-gamma-glutamyl-phosphate reductase ArgC
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=8.9e-53  Score=367.94  Aligned_cols=173  Identities=34%  Similarity=0.602  Sum_probs=153.8

Q ss_pred             ccEEEEEccccHHHHHHHHHHhcCCCceEEEEeccccCCcccccccCCcccCCCccccccCcccC-CCCCEEEecCCccc
Q 021865           63 QVRIGLLGASGYTGAEIVRLLANHPYFGIKLMTADRKAGQSIGSVFPHLISQDLPTMVAVKDADF-SNVDAVFCCLPHGT  141 (306)
Q Consensus        63 ~~kVaIiGATGyvG~ELlrlL~~HP~~el~~l~S~~~aGk~l~~~~p~l~~~~~~~~~~~~~~~~-~~~DvVF~alp~~~  141 (306)
                      |+||+|+|||||||+||+|+|.+||++++..++|++++|+++.+++|++...  ..+...+.+++ +++|+||+|+||++
T Consensus         1 MikVaIvGATGyvG~eLirlL~~HP~~ei~~l~s~~~aG~~i~~~~p~~~~~--~~~~~~~~~~~~~~~dvvf~a~p~~~   78 (176)
T d1vkna1           1 MIRAGIIGATGYTGLELVRLLKNHPEAKITYLSSRTYAGKKLEEIFPSTLEN--SILSEFDPEKVSKNCDVLFTALPAGA   78 (176)
T ss_dssp             CEEEEEESTTSHHHHHHHHHHHHCTTEEEEEEECSTTTTSBHHHHCGGGCCC--CBCBCCCHHHHHHHCSEEEECCSTTH
T ss_pred             CeEEEEECCCcHHHHHHHHHHHhCCCceEEEeeccccCCCcccccCchhhcc--ccccccCHhHhccccceEEEccccHH
Confidence            7999999999999999999999999999999999999999999999988542  12333333333 47999999999999


Q ss_pred             hHHHHHhcCCCCeEEECCcccccCCccchhhhcCCCCCCcchhhhhhhcccccchhcccCCcEEecCCChHHHHhhhhhH
Q 021865          142 TQEIIKGLPKSLKIVDLSADFRLRDVSEYEEWYGQPHIAPDLQKEAVYGLTEISREDIKNARLVANPGCYPTSIQLPLVP  221 (306)
Q Consensus       142 s~~~~~~l~~g~~VIDlSadfRl~~~~~y~~wY~~~h~~Pel~~~avYGLpEl~r~~i~~a~lVAnPGCy~Ta~~LaL~P  221 (306)
                      +++++++. ++++|||||+||||+|.+.|++||+.+|..|+++ +++|||||+||++|+++++|||||||+|+++|+|+|
T Consensus        79 s~~~~~~~-~~~~VIDlSadfRl~~~~~y~~~Y~~~h~~~~~~-~~~YGlpE~~r~~i~~~~~IanPgC~~t~~~laL~P  156 (176)
T d1vkna1          79 SYDLVREL-KGVKIIDLGADFRFDDPGVYREWYGKELSGYENI-KRVYGLPELHREEIKNAQVVGNPGLVKGASGQAVQN  156 (176)
T ss_dssp             HHHHHTTC-CSCEEEESSSTTTCSSHHHHHHHHCCCCTTGGGC-CEEECCHHHHHHHHTTCSEEECCCTTTTTHHHHHHH
T ss_pred             HHHHHHhh-ccceEEecCccccccchhhHHHhhcccccccccc-ceeecCcHHhHHHHhcCCEEEccCcHHHHHHHHHhh
Confidence            99999875 6899999999999999999999999999999998 589999999999999999999999999999999999


Q ss_pred             HHhccCCCCceEEEEeeeecCccCcccc
Q 021865          222 LIQANLIQYRNIIIDAKSGVSGAGRGAK  249 (306)
Q Consensus       222 L~~~~li~~~~iiV~a~sgvSGAGr~~~  249 (306)
                      |+....          .++.||+|++|+
T Consensus       157 L~~~~g----------i~~~~g~~~~p~  174 (176)
T d1vkna1         157 MNIMFG----------LDETKGLEFTPI  174 (176)
T ss_dssp             HHHHTT----------CCTTTTCCCCCC
T ss_pred             HHHhcC----------CccccccccCCC
Confidence            976531          247899999985
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvoa2 d.81.1.1 (A:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure