Citrus Sinensis ID: 022021

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MCDMASELQTSMMETMDAFELEKQRHNNTRMEALQLLAKLETANADLARALAAAQKKLEMETNQVAELRQQTELKEVAHEELSQRNSNTHQTGIYLKRLAASKGVEFEREILEAEYTFIADKIIQLEDKAKKLEGNIEMTRKEIEDPTEVEIELKRRLGQLTDHLIQKQAQVEALSSEKATLAFRIEAVSRLLDENKPVTGSSSRDLEFGAWDLSQSNLRPLFEEKIRSGKKHIGSLLKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHSQSSAEARSGAVFSLENINNTASL
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccccc
MCDMASELQTSMMETMDAFELEKQRHNNTRMEALQLLAKLETANADLARALAAAQKKLEMETNQVAELRQQTELKEVAHEELsqrnsnthqTGIYLKRLAASKGVEFEREILEAEYTFIADKIIQLEDKAKKLEGNIEMtrkeiedpTEVEIELKRRLGQLTDHLIQKQAQVEALSSEKATLAFRIEAVSRLLdenkpvtgsssrdlefgawdlsqsnlrpLFEEKIRSGKKHIGSLLKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHsqssaearsgavfsleninntasl
MCDMASELQTSMMETMDAFELEKQRHNNTRMEALQLLAKLETANADLARALAAAQKKLEMETNQVAELRQQTELKEVAheelsqrnsnthqtgiyLKRLAASKGVEFEREILEAEYTFIADKIIQLEDKAKKLEgniemtrkeiedptevEIELKRRLGQLTDHLIQKQAQVEALSSEKATLAFRIEAVsrlldenkpvtgsssrdlefgawdlsqsnLRPLFEEKIRSGKKHIGSLLKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHSQSSAEArsgavfsleninntasl
MCDMASELQTSMMETMDAFELEKQRHNNTRMEALQLLAKLETanadlaralaaaQKKLEMETNQVAELRQQTELKEVAHEELSQRNSNTHQTGIYLKRLAASKGVEFEREILEAEYTFIADKIIQLEDKAKKLEGNIEMTRKEIEDPTEVEIELKRRLGQLTDHLIQKQAQVEALSSEKATLAFRIEAVSRLLDENKPVTGSSSRDLEFGAWDLSQSNLRPLFEEKIRSGKKHIGSLLKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHSQSSAEARSGAVFSLENINNTASL
************************************L******************************************************TGIYLKRLAASKGVEFEREILEAEYTFIADKIIQLEDK************************LKRRLGQLTDHLIQK***********ATLAFRIEAVSRL***************EFGAWDLSQSNLRPLFEEKIRSGKKHIGSLLKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLS*************************
*********************************************************************************************************************************************************************************************************************************************LKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSH*****************IN*****
********QTSMMETMDAFELEKQRHNNTRMEALQLLAKLETANADLARALAAAQKKLEMETNQVAELRQQTELKEVAHEELSQRNSNTHQTGIYLKRLAASKGVEFEREILEAEYTFIADKIIQLEDKAKKLEGNIEMTRKEIEDPTEVEIELKRRLGQLTDHLIQKQAQVEALSSEKATLAFRIEAVSRLLDENKPVTGSSSRDLEFGAWDLSQSNLRPLFEEKIRSGKKHIGSLLKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHS********GAVFSLENINNTASL
MCDMASELQTSMMETMDAFELEKQRHNNTRMEALQLLAKLETANADLARALAAAQKKLEMETNQVAELRQQTELKEVAHEELSQRNSNTHQTGIYLKRLAASKGVEFEREILEAEYTFIADKIIQLEDKAKKLEGNIEMTRKEIEDPTEVEIELKRRLGQLTDHLIQKQAQVEALSSEKATLAFRIEAVSRLLDE*K*********************LRPLFEEKIRSGKKHIGSLLKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHSQS******GAVF****IN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDMASELQTSMMETMDAFELExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNSNTHQTGIYLKRLAASKGVEFExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIEDPTEVEIELKRRLGQLTDHLIQKQAQVEALSSEKATLAFRIEAVSRLLDENKPVTGSSSRDLEFGAWDLSQSNLRPLFEEKIRSGKKHIGSLLKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHSQSSAEARSGAVFSLENINNTASL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query304 2.2.26 [Sep-21-2011]
B0F9L7668 Golgin candidate 2 OS=Ara yes no 0.980 0.446 0.642 1e-106
Q3ZU82728 Golgin subfamily A member yes no 0.598 0.25 0.298 4e-14
Q6GNT7722 Golgin subfamily A member N/A no 0.796 0.335 0.284 4e-14
Q9QYE6729 Golgin subfamily A member yes no 0.598 0.249 0.288 2e-13
Q7SXE4760 Golgin subfamily A member yes no 0.605 0.242 0.297 3e-13
Q8TBA6731 Golgin subfamily A member yes no 0.598 0.248 0.297 2e-12
Q8S8N9707 Golgin candidate 1 OS=Ara no no 0.888 0.381 0.273 3e-11
Q5JLY8709 Golgin-84 OS=Oryza sativa no no 0.809 0.346 0.268 3e-10
Q8SZ63516 Golgin-84 OS=Drosophila m yes no 0.391 0.230 0.291 2e-07
>sp|B0F9L7|GOGC2_ARATH Golgin candidate 2 OS=Arabidopsis thaliana GN=GC2 PE=1 SV=1 Back     alignment and function desciption
 Score =  384 bits (985), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 242/302 (80%), Gaps = 4/302 (1%)

Query: 5   ASELQTSMMETMDAFELEKQRHNNTRMEALQLLAKLETANADLARALAAAQKKLEMETNQ 64
           A+ELQT+MMET++A +LEKQ+HNNTRME L  LA LE  NA+L R+LAA QKKLE + +Q
Sbjct: 365 AAELQTNMMETLEAADLEKQKHNNTRMEVLTRLAGLEAENAELTRSLAAGQKKLETQIDQ 424

Query: 65  VAELRQQTELKEVAHEELSQRNSNTHQTGIYLKRLAASKGVEFEREILEAEYTFIADKII 124
           VA L+QQ ELKE   EEL +   N    G  LK+L  S+G +FE ++LEAE + + DKI 
Sbjct: 425 VAVLKQQVELKESTLEELKRNTFNIGGRGTTLKQLDTSRGDKFEHQMLEAEISLLTDKIG 484

Query: 125 QLEDKAKKLEGNIEMTRKEIEDPTEVEIELKRRLGQLTDHLIQKQAQVEALSSEKATLAF 184
           +L+DKA KLE +IEM RKE+E+PTEVEIELKRRL QLTDHLIQKQ+QVEALSSEKAT+ F
Sbjct: 485 RLQDKATKLEADIEMMRKELEEPTEVEIELKRRLNQLTDHLIQKQSQVEALSSEKATILF 544

Query: 185 RIEAVSRLLDENKPV--TGSSSRDLEFGAWDLSQSNLRPLFEEKIRSGKKHIGSLLKQLD 242
           RIEAVSRL++ENK +  T +SS+DLE G W+LS S  +P F++KIRSGKKH+G L+ QL+
Sbjct: 545 RIEAVSRLIEENKGMSATEASSQDLEAGDWELSGSKFKPAFQDKIRSGKKHLGWLVMQLN 604

Query: 243 SIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHSQ--SSAEARSGAVFSLENINN 300
           +IF++G VFLRRNP AK+W++VYLVCLHLWV+YILLSHS   SS E RSGAV SLEN +N
Sbjct: 605 AIFISGTVFLRRNPTAKIWAVVYLVCLHLWVLYILLSHSDASSSGELRSGAVISLENFSN 664

Query: 301 TA 302
           ++
Sbjct: 665 SS 666
Golgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.
Arabidopsis thaliana (taxid: 3702)
>sp|Q3ZU82|GOGA5_RAT Golgin subfamily A member 5 OS=Rattus norvegicus GN=Golga5 PE=1 SV=1 Back     alignment and function description
>sp|Q6GNT7|GOGA5_XENLA Golgin subfamily A member 5 OS=Xenopus laevis GN=golga5 PE=2 SV=1 Back     alignment and function description
>sp|Q9QYE6|GOGA5_MOUSE Golgin subfamily A member 5 OS=Mus musculus GN=Golga5 PE=1 SV=2 Back     alignment and function description
>sp|Q7SXE4|GOGA5_DANRE Golgin subfamily A member 5 OS=Danio rerio GN=golga5 PE=2 SV=1 Back     alignment and function description
>sp|Q8TBA6|GOGA5_HUMAN Golgin subfamily A member 5 OS=Homo sapiens GN=GOLGA5 PE=1 SV=3 Back     alignment and function description
>sp|Q8S8N9|GOGC1_ARATH Golgin candidate 1 OS=Arabidopsis thaliana GN=GC1 PE=2 SV=2 Back     alignment and function description
>sp|Q5JLY8|GOGA5_ORYSJ Golgin-84 OS=Oryza sativa subsp. japonica GN=Os01g0744400 PE=2 SV=1 Back     alignment and function description
>sp|Q8SZ63|GOGA5_DROME Golgin-84 OS=Drosophila melanogaster GN=Golgin84 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
224135521 567 predicted protein [Populus trichocarpa] 0.980 0.525 0.714 1e-122
255583467 691 Golgin-84, putative [Ricinus communis] g 0.907 0.399 0.733 1e-117
357521611 667 Golgin candidate [Medicago truncatula] g 0.976 0.445 0.681 1e-112
225456134 682 PREDICTED: golgin candidate 2-like [Viti 0.983 0.438 0.71 1e-110
356511261 689 PREDICTED: golgin candidate 2-like [Glyc 0.983 0.433 0.664 1e-109
356527890 689 PREDICTED: golgin candidate 2-like [Glyc 0.983 0.433 0.648 1e-106
449497585 662 PREDICTED: golgin candidate 2-like [Cucu 0.986 0.453 0.641 1e-105
30685736 668 golgin candidate 2 [Arabidopsis thaliana 0.980 0.446 0.642 1e-104
449439557 716 PREDICTED: golgin candidate 2-like [Cucu 0.990 0.420 0.601 1e-102
9719733 654 EST gb|AI997943 comes from this gene [Ar 0.917 0.426 0.612 3e-97
>gi|224135521|ref|XP_002322094.1| predicted protein [Populus trichocarpa] gi|222869090|gb|EEF06221.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 260/319 (81%), Gaps = 21/319 (6%)

Query: 5   ASELQTSMMETMDAFELEKQRHNNTRMEALQLLAKLETANADLARALAAAQKKLEMETNQ 64
           ASELQT+ METM+A +LEKQ+HNNTRME L  LAKLET NADLAR+LA AQK LE+E NQ
Sbjct: 251 ASELQTTTMETMEAVDLEKQKHNNTRMEVLSRLAKLETTNADLARSLATAQKNLELEINQ 310

Query: 65  VAELRQQTELKEVAHEELSQRNSNTHQTGIYLKRLAASKGVEFEREILEAEYTFIADKII 124
           VAELRQQ ELKEVA E+L +R S THQT  YL + AASKGV+FEREILE EY F+ DKI 
Sbjct: 311 VAELRQQFELKEVALEDLRRRISKTHQTETYLNQAAASKGVQFEREILETEYLFLIDKIQ 370

Query: 125 QLEDK-------------------AKKLEGNIEMTRKEIEDPTEVEIELKRRLGQLTDHL 165
           +LEDK                   AKKLE +IEMTRKE+EDPTEVEIELKRRLGQLTDHL
Sbjct: 371 RLEDKLIHSHARLLTCISFTCLFQAKKLETDIEMTRKEMEDPTEVEIELKRRLGQLTDHL 430

Query: 166 IQKQAQVEALSSEKATLAFRIEAVSRLLDENKPVTGSSSRDLEFGAWDLSQSNLRPLFEE 225
           IQKQAQVEALSSEKAT+AFRIEAVSRLL+ENK V  SS  +LE G W +S S LRP+FE+
Sbjct: 431 IQKQAQVEALSSEKATIAFRIEAVSRLLEENKSVVNSS--NLESGKWAISDSKLRPMFED 488

Query: 226 KIRSGKKHIGSLLKQLDSIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHSQSSA 285
           KIR+G+KH+GSL++QLD+IFLAGVVFLRRNP AKLW LVYL+CLH+WVIYIL++ SQSS 
Sbjct: 489 KIRAGRKHLGSLVQQLDAIFLAGVVFLRRNPTAKLWCLVYLLCLHVWVIYILMAPSQSSN 548

Query: 286 EARSGAVFSLENINNTASL 304
           E RSGAVFSLEN+N TA +
Sbjct: 549 EGRSGAVFSLENLNKTAGV 567

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255583467|ref|XP_002532492.1| Golgin-84, putative [Ricinus communis] gi|223527791|gb|EEF29891.1| Golgin-84, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357521611|ref|XP_003631094.1| Golgin candidate [Medicago truncatula] gi|355525116|gb|AET05570.1| Golgin candidate [Medicago truncatula] Back     alignment and taxonomy information
>gi|225456134|ref|XP_002278278.1| PREDICTED: golgin candidate 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511261|ref|XP_003524345.1| PREDICTED: golgin candidate 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356527890|ref|XP_003532539.1| PREDICTED: golgin candidate 2-like [Glycine max] Back     alignment and taxonomy information
>gi|449497585|ref|XP_004160442.1| PREDICTED: golgin candidate 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30685736|ref|NP_173257.2| golgin candidate 2 [Arabidopsis thaliana] gi|205779900|sp|B0F9L7.1|GOGC2_ARATH RecName: Full=Golgin candidate 2; Short=AtGC2 gi|164708706|gb|ABY67250.1| putative golgin-84-like protein [Arabidopsis thaliana] gi|332191564|gb|AEE29685.1| golgin candidate 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449439557|ref|XP_004137552.1| PREDICTED: golgin candidate 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|9719733|gb|AAF97835.1|AC034107_18 EST gb|AI997943 comes from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
TAIR|locus:2194075668 GC2 "AT1G18190" [Arabidopsis t 0.980 0.446 0.619 1e-91
RGD|1308163728 Golga5 "golgin A5" [Rattus nor 0.733 0.306 0.286 5e-18
UNIPROTKB|A5D7A5732 GOLGA5 "GOLGA5 protein" [Bos t 0.815 0.338 0.276 5e-18
UNIPROTKB|E1C947735 GOLGA5 "Uncharacterized protei 0.819 0.338 0.272 5.1e-18
UNIPROTKB|Q8TBA6731 GOLGA5 "Golgin subfamily A mem 0.815 0.339 0.269 8.3e-18
UNIPROTKB|F1SD67729 GOLGA5 "Uncharacterized protei 0.815 0.340 0.269 1.1e-17
UNIPROTKB|E2QWJ2731 GOLGA5 "Uncharacterized protei 0.730 0.303 0.289 1.1e-17
UNIPROTKB|Q6GNT7722 golga5 "Golgin subfamily A mem 0.703 0.296 0.288 2.8e-17
MGI|MGI:1351475729 Golga5 "golgi autoantigen, gol 0.713 0.297 0.270 3.6e-17
ZFIN|ZDB-GENE-040426-2749760 golga5 "golgi autoantigen, gol 0.736 0.294 0.281 1.7e-16
TAIR|locus:2194075 GC2 "AT1G18190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 914 (326.8 bits), Expect = 1.0e-91, P = 1.0e-91
 Identities = 187/302 (61%), Positives = 233/302 (77%)

Query:     5 ASELQTSMMETMDAFELEKQRHNNTRMEALQLLAKLETXXXXXXXXXXXXQKKLEMETNQ 64
             A+ELQT+MMET++A +LEKQ+HNNTRME L  LA LE             QKKLE + +Q
Sbjct:   365 AAELQTNMMETLEAADLEKQKHNNTRMEVLTRLAGLEAENAELTRSLAAGQKKLETQIDQ 424

Query:    65 VAELRQQTELKEVAHEELSQRNSNTHQTGIYLKRLAASKGVEFEREILEAEYTFIADKII 124
             VA L+QQ ELKE   EEL +   N    G  LK+L  S+G +FE ++LEAE + + DKI 
Sbjct:   425 VAVLKQQVELKESTLEELKRNTFNIGGRGTTLKQLDTSRGDKFEHQMLEAEISLLTDKIG 484

Query:   125 QLEDKAKKLEGNIEMTRKEIEDPTEVEIELKRRLGQLTDHLIQKQAQVEALSSEKATLAF 184
             +L+DKA KLE +IEM RKE+E+PTEVEIELKRRL QLTDHLIQKQ+QVEALSSEKAT+ F
Sbjct:   485 RLQDKATKLEADIEMMRKELEEPTEVEIELKRRLNQLTDHLIQKQSQVEALSSEKATILF 544

Query:   185 RIEAVSRLLDENKPV--TGSSSRDLEFGAWDLSQSNLRPLFEEKIRSGKKHIGSLLKQLD 242
             RIEAVSRL++ENK +  T +SS+DLE G W+LS S  +P F++KIRSGKKH+G L+ QL+
Sbjct:   545 RIEAVSRLIEENKGMSATEASSQDLEAGDWELSGSKFKPAFQDKIRSGKKHLGWLVMQLN 604

Query:   243 SIFLAGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHSQ--SSAEARSGAVFSLENINN 300
             +IF++G VFLRRNP AK+W++VYLVCLHLWV+YILLSHS   SS E RSGAV SLEN +N
Sbjct:   605 AIFISGTVFLRRNPTAKIWAVVYLVCLHLWVLYILLSHSDASSSGELRSGAVISLENFSN 664

Query:   301 TA 302
             ++
Sbjct:   665 SS 666
GO:0003674 "molecular_function" evidence=ND
GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0008150 "biological_process" evidence=ND
GO:0009630 "gravitropism" evidence=RCA
RGD|1308163 Golga5 "golgin A5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7A5 GOLGA5 "GOLGA5 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C947 GOLGA5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TBA6 GOLGA5 "Golgin subfamily A member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SD67 GOLGA5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWJ2 GOLGA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GNT7 golga5 "Golgin subfamily A member 5" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:1351475 Golga5 "golgi autoantigen, golgin subfamily a, 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2749 golga5 "golgi autoantigen, golgin subfamily a, 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
pfam09787509 pfam09787, Golgin_A5, Golgin subfamily A member 5 0.001
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information 
 Score = 45.8 bits (109), Expect = 2e-05
 Identities = 39/159 (24%), Positives = 74/159 (46%), Gaps = 2/159 (1%)

Query: 37  LAKLETANADLARALAAAQKKLEMETNQVAELRQQTELKEVAHEELSQRNSNTHQTGIYL 96
           + +LE    +L   +A  +K L     ++ EL ++ E      EELS++ S   +     
Sbjct: 679 IEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKD--LA 736

Query: 97  KRLAASKGVEFEREILEAEYTFIADKIIQLEDKAKKLEGNIEMTRKEIEDPTEVEIELKR 156
           +  A  + +E     L  E T +  +I +LE++ ++ E  +     EIE+      +LK 
Sbjct: 737 RLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKE 796

Query: 157 RLGQLTDHLIQKQAQVEALSSEKATLAFRIEAVSRLLDE 195
            L  L + L + +A++  L+ E A L  R+E++ R +  
Sbjct: 797 ELKALREALDELRAELTLLNEEAANLRERLESLERRIAA 835

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|220402 pfam09787, Golgin_A5, Golgin subfamily A member 5 Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 304
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 99.97
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 99.96
KOG4677554 consensus Golgi integral membrane protein [Intrace 99.96
KOG0963629 consensus Transcription factor/CCAAT displacement 99.64
KOG1937521 consensus Uncharacterized conserved protein [Funct 97.25
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.19
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.1
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.08
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.0
PRK11637428 AmiB activator; Provisional 97.0
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.92
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.85
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 96.65
PF13851201 GAS: Growth-arrest specific micro-tubule binding 96.64
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.6
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 96.53
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.33
KOG0971 1243 consensus Microtubule-associated protein dynactin 96.3
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 96.27
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 96.24
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.15
PRK02224 880 chromosome segregation protein; Provisional 96.14
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.13
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.11
PRK11637428 AmiB activator; Provisional 95.95
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 95.94
PHA02562562 46 endonuclease subunit; Provisional 95.91
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 95.88
PRK02224 880 chromosome segregation protein; Provisional 95.88
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 95.87
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 95.73
PRK09039343 hypothetical protein; Validated 95.68
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 95.55
PRK04863 1486 mukB cell division protein MukB; Provisional 95.55
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.52
PF00038312 Filament: Intermediate filament protein; InterPro: 95.39
PRK04863 1486 mukB cell division protein MukB; Provisional 95.22
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.17
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.16
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 95.09
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 94.76
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 94.71
KOG0996 1293 consensus Structural maintenance of chromosome pro 94.69
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.64
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 94.58
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 94.57
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 94.52
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.49
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 94.39
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.28
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 94.26
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 94.25
PRK10884206 SH3 domain-containing protein; Provisional 93.98
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 93.94
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 93.86
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 93.75
PRK09039343 hypothetical protein; Validated 93.7
PRK03918 880 chromosome segregation protein; Provisional 93.42
PF05911769 DUF869: Plant protein of unknown function (DUF869) 93.36
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 93.01
KOG0996 1293 consensus Structural maintenance of chromosome pro 92.98
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 92.9
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 92.87
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 92.83
PRK11281 1113 hypothetical protein; Provisional 92.79
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 92.67
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 92.66
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 92.63
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 92.48
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 92.4
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 92.13
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 92.03
PF14662193 CCDC155: Coiled-coil region of CCDC155 91.9
PRK03918880 chromosome segregation protein; Provisional 91.74
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 91.6
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 91.42
PLN02939 977 transferase, transferring glycosyl groups 91.39
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 91.33
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 91.21
KOG1003205 consensus Actin filament-coating protein tropomyos 91.19
PF00038312 Filament: Intermediate filament protein; InterPro: 91.07
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 91.02
KOG0979 1072 consensus Structural maintenance of chromosome pro 90.77
KOG0964 1200 consensus Structural maintenance of chromosome pro 90.76
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 90.71
PF10186302 Atg14: UV radiation resistance protein and autopha 90.69
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 90.68
COG2433652 Uncharacterized conserved protein [Function unknow 90.62
PRK0211973 hypothetical protein; Provisional 90.6
PF04582326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 90.57
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 90.39
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 90.32
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 89.76
COG4942420 Membrane-bound metallopeptidase [Cell division and 89.74
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 89.66
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 89.64
KOG4673961 consensus Transcription factor TMF, TATA element m 89.54
COG4026290 Uncharacterized protein containing TOPRIM domain, 89.43
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 88.86
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 88.8
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 88.76
PRK10929 1109 putative mechanosensitive channel protein; Provisi 88.7
PRK0073668 hypothetical protein; Provisional 88.53
PRK10929 1109 putative mechanosensitive channel protein; Provisi 88.5
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 88.28
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 88.09
PRK0432574 hypothetical protein; Provisional 87.89
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 87.87
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 87.47
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 87.44
PRK0029568 hypothetical protein; Provisional 87.3
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 87.15
KOG3647338 consensus Predicted coiled-coil protein [General f 87.01
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 86.87
PF09486158 HrpB7: Bacterial type III secretion protein (HrpB7 86.74
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 86.7
PRK0440675 hypothetical protein; Provisional 86.69
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 86.65
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 86.32
PRK11281 1113 hypothetical protein; Provisional 86.29
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 86.15
PF15066527 CAGE1: Cancer-associated gene protein 1 family 86.13
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 86.03
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 85.96
PRK0279372 phi X174 lysis protein; Provisional 85.92
KOG0963 629 consensus Transcription factor/CCAAT displacement 85.87
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 85.7
PF12761195 End3: Actin cytoskeleton-regulatory complex protei 85.39
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 85.35
KOG1962216 consensus B-cell receptor-associated protein and r 85.21
PF05701522 WEMBL: Weak chloroplast movement under blue light; 84.87
PRK10884206 SH3 domain-containing protein; Provisional 84.61
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 84.6
KOG0933 1174 consensus Structural maintenance of chromosome pro 84.43
COG2433652 Uncharacterized conserved protein [Function unknow 84.29
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 84.25
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 84.24
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 84.13
PF09311181 Rab5-bind: Rabaptin-like protein; InterPro: IPR015 84.08
KOG1962216 consensus B-cell receptor-associated protein and r 83.92
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 83.59
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 83.39
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 83.26
PF14662193 CCDC155: Coiled-coil region of CCDC155 83.1
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 82.94
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 82.5
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 82.48
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 82.35
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 82.25
TIGR02231 525 conserved hypothetical protein. This family consis 80.99
PF06120301 Phage_HK97_TLTM: Tail length tape measure protein; 80.84
PRK0084677 hypothetical protein; Provisional 80.53
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 80.44
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 80.31
PF15397258 DUF4618: Domain of unknown function (DUF4618) 80.05
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information 
Probab=99.97  E-value=1e-31  Score=248.78  Aligned_cols=202  Identities=19%  Similarity=0.299  Sum_probs=162.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhc--------------------------ccCCC--------cchhh
Q 022021           51 LAAAQKKLEMETNQVAELRQQTELKEVAHEELSQRN--------------------------SNTHQ--------TGIYL   96 (304)
Q Consensus        51 la~~q~~l~~~~~~~~~l~q~v~~lE~~l~~l~~~~--------------------------~~~~~--------~~~~~   96 (304)
                      |..+|.+++..++++++++++|++||+|+..++...                          +...|        ..++|
T Consensus         1 l~~lq~~l~~l~~~~~~~~~L~~kLE~DL~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~g~~sp~ss~~~~~~~~si   80 (248)
T PF08172_consen    1 LEELQKELSELEAKLEEQKELNAKLENDLAKVQASSSASRSFNDGASMASGATRQIPNSGRSGSLSPTSSIIGGGGDSSI   80 (248)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccCCCCcccccccchhhccCccccCCCCCCccCCCCCCcccH
Confidence            467899999999999999999999999999998420                          01111        12347


Q ss_pred             hHHHhhhchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC-CChhHHHHHH-HHHHHHHHHHHHHHHHHH
Q 022021           97 KRLAASKGVEFEREILEAEYTFIADKIIQLEDKAKKLEGNIEMTRKEIED-PTEVEIELKR-RLGQLTDHLIQKQAQVEA  174 (304)
Q Consensus        97 ~~i~t~~~~e~E~e~~r~El~~l~~~~~~Le~~l~~~e~eI~~lr~~l~~-~s~~~~elEk-Rl~~LTe~Li~KQtqlEs  174 (304)
                      +|||++|     |||||       +++.+||+++++.+++|..|+.+++. ++||.++||| ||             |.+
T Consensus        81 LpIVtsQ-----RDRFR-------~Rn~ELE~elr~~~~~~~~L~~Ev~~L~~DN~kLYEKiRy-------------lqS  135 (248)
T PF08172_consen   81 LPIVTSQ-----RDRFR-------QRNAELEEELRKQQQTISSLRREVESLRADNVKLYEKIRY-------------LQS  135 (248)
T ss_pred             HHHHHHH-----HHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------------Hhh
Confidence            9999999     99999       99999999999999999999999998 9999999999 99             999


Q ss_pred             hhhhhHHHHHHHHHHHhhHhhcCCC----C-CCCCCCCCCCcccc-CCCccCCc--chhhhhccchhhhhhhhhHHHHHH
Q 022021          175 LSSEKATLAFRIEAVSRLLDENKPV----T-GSSSRDLEFGAWDL-SQSNLRPL--FEEKIRSGKKHIGSLLKQLDSIFL  246 (304)
Q Consensus       175 l~sEk~al~~qLErl~~~~~~~~~~----~-~~~~~~~~~~~~~~-~~~~l~p~--f~~~~~~~~r~~~~al~~lD~~~l  246 (304)
                      |....+.      .-..........    + .....|.+.++|.. |+.++.||  |+.++.  .|++++ |+|+|++++
T Consensus       136 Y~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~d~e~~rY~~~YE~~l~PF~~F~~~E~--~R~~~~-L~~~eR~~l  206 (248)
T PF08172_consen  136 YNNKGSG------SSSSAVSNSPGRSSVSPEPGGSSDVESNRYSSAYEESLNPFAAFRKRER--QRRYKR-LSPPERIFL  206 (248)
T ss_pred             CcccccC------CCcccccCCCCcccCCCCCCCCCchhHHHHHHHHHhccChHHHHhHhhH--HHHHhc-CChHHHHHH
Confidence            9864211      000000000000    0 11133556668876 99999998  999998  888888 999999999


Q ss_pred             HHHHHHhhchhHHHHHHHHHHHHHHHHHHHHHhccCCCcc
Q 022021          247 AGVVFLRRNPIAKLWSLVYLVCLHLWVIYILLSHSQSSAE  286 (304)
Q Consensus       247 ~~~r~lrr~p~aR~~~~~Y~v~LHl~V~~~L~~~s~~~~~  286 (304)
                      .+||++.+++++|++|||||++||+|||++||+++.++++
T Consensus       207 s~~r~vL~nr~~R~~f~~Y~l~LH~lvf~~l~~~~~~~~~  246 (248)
T PF08172_consen  207 SLTRFVLSNRTTRMLFFFYCLGLHLLVFFVLYYMSHSTSM  246 (248)
T ss_pred             HHHHHHhcChhhHHHHHHHHHHHHHHHHHHHHHHHhhhhc
Confidence            9999999999999999999999999999999997766544

These are Golgi membrane proteins which are thought to have a role in vesicle transport [].; GO: 0006891 intra-Golgi vesicle-mediated transport, 0030173 integral to Golgi membrane
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>KOG3647 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF09311 Rab5-bind: Rabaptin-like protein; InterPro: IPR015390 This domain is predominantly found in Rabaptin and allows for binding to the GTPase Rab5 Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 2e-05
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 8e-04
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
 Score = 53.2 bits (128), Expect = 5e-08
 Identities = 26/178 (14%), Positives = 69/178 (38%), Gaps = 5/178 (2%)

Query: 4    MASELQTSMMETMDAFELEKQRHNNTRMEAL--QLLAKLETAN-ADLARALAAAQKKLEM 60
             +  +Q  +   +      +       ++    +++AK E       AR++   +K    
Sbjct: 866  KSIIIQKHVRGWLARVHYHRTLKAIVYLQCCYRRMMAKRELKKLKIEARSVERYKKLHIG 925

Query: 61   ETNQVAELRQQTELKEVAHEELSQRNSNTHQTGIYLKRLAASKGVEFEREILEAEYTFIA 120
              N++ +L+++ + +   ++ L ++ +N   T  Y       +       + E E     
Sbjct: 926  LENKIMQLQRKIDEQNKEYKSLLEKMNNLEIT--YSTETEKLRSDVERLRMSEEEAKNAT 983

Query: 121  DKIIQLEDKAKKLEGNIEMTRKEIEDPTEVEIELKRRLGQLTDHLIQKQAQVEALSSE 178
            ++++ L+++  KL   +  T+ E +   E   + K    QL   L ++   ++    E
Sbjct: 984  NRVLSLQEEIAKLRKELHQTQTEKKTIEEWADKYKHETEQLVSELKEQNTLLKTEKEE 1041
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.46
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.32
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.32
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.23
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 96.57
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 96.51
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.93
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.54
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 95.5
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.25
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 95.11
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 94.07
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 92.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.57
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 92.42
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 92.32
2v4h_A110 NF-kappa-B essential modulator; transcription, met 92.22
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 91.62
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.61
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 90.18
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 89.97
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 89.03
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 88.73
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 88.32
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 88.1
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 87.42
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 87.31
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 86.4
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 86.28
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 85.63
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 85.5
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 85.04
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 84.96
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 84.65
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 84.15
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 82.75
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 82.63
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 82.26
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 81.44
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 81.01
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 80.78
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 80.44
3cve_A72 Homer protein homolog 1; coiled coil, alternative 80.29
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 80.15
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=97.46  E-value=0.043  Score=47.17  Aligned_cols=65  Identities=18%  Similarity=0.200  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHHhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 022021           14 ETMDAFELEKQRHNNTRMEALQLLAKLETANADLARALAAAQKKLEMETNQVAELRQQTELKEVA   78 (304)
Q Consensus        14 ~~~~a~~~E~~~H~~Tr~~a~~R~~~Le~~n~~la~ala~~q~~l~~~~~~~~~l~q~v~~lE~~   78 (304)
                      .-|.+++.+.........+....+..++....++...+..++..+......+..+...+..+...
T Consensus         6 ~~~~~l~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   70 (284)
T 1c1g_A            6 KKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEK   70 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34455555555544444444444444444444444444444444444444444444443333333
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00