Citrus Sinensis ID: 022183
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 301 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FKS0 | 486 | Uridine kinase-like prote | yes | no | 1.0 | 0.619 | 0.940 | 1e-168 | |
| Q9LK34 | 483 | Uridine kinase-like prote | no | no | 1.0 | 0.623 | 0.930 | 1e-166 | |
| Q8VYB2 | 466 | Uridine kinase-like prote | no | no | 1.0 | 0.645 | 0.857 | 1e-157 | |
| O65583 | 469 | Uridine kinase-like prote | no | no | 1.0 | 0.641 | 0.850 | 1e-154 | |
| Q9LTY6 | 465 | Uridine kinase-like prote | no | no | 1.0 | 0.647 | 0.787 | 1e-144 | |
| Q91YL3 | 548 | Uridine-cytidine kinase-l | yes | no | 0.996 | 0.547 | 0.493 | 1e-86 | |
| Q9NWZ5 | 548 | Uridine-cytidine kinase-l | yes | no | 0.996 | 0.547 | 0.490 | 4e-86 | |
| Q55EL3 | 499 | Uridine-cytidine kinase A | yes | no | 0.990 | 0.597 | 0.485 | 1e-82 | |
| Q55GQ6 | 216 | Uracil phosphoribosyltran | no | no | 0.704 | 0.981 | 0.560 | 2e-66 | |
| Q26998 | 244 | Uracil phosphoribosyltran | N/A | no | 0.717 | 0.885 | 0.520 | 1e-64 |
| >sp|Q9FKS0|UKL1_ARATH Uridine kinase-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=UKL1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 589 bits (1518), Expect = e-168, Method: Compositional matrix adjust.
Identities = 283/301 (94%), Positives = 297/301 (98%)
Query: 1 MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVII 60
MNMKIFVDTDADVRLARRIRRDTVERGRDV+SVLEQYAKFVKPAFDDFVLPSKKYADVII
Sbjct: 183 MNMKIFVDTDADVRLARRIRRDTVERGRDVNSVLEQYAKFVKPAFDDFVLPSKKYADVII 242
Query: 61 PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFV 120
PRGGDNHVA+DLI QHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIR++ ISKHDFV
Sbjct: 243 PRGGDNHVAVDLITQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIREKDISKHDFV 302
Query: 121 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSGESMENALRA 180
FYSDRLIRLVVEHGLGHLPFTEKQVVTPTG++YTGVDFCKKLCGVSI+RSGESMENALRA
Sbjct: 303 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGAVYTGVDFCKKLCGVSIIRSGESMENALRA 362
Query: 181 CCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKG 240
CCKGIKIGKILIHRDGDNGKQLIYEKLP+DISERHVLLLDPVLATGNSANQAI+LLI+KG
Sbjct: 363 CCKGIKIGKILIHRDGDNGKQLIYEKLPHDISERHVLLLDPVLATGNSANQAIELLIQKG 422
Query: 241 VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTD 300
VPE+HIIFLNLISAPEGIHCVCKRFP+LKIVTSEID LN+EFRVIPGLGEFGDRYFGTD
Sbjct: 423 VPEAHIIFLNLISAPEGIHCVCKRFPALKIVTSEIDQCLNQEFRVIPGLGEFGDRYFGTD 482
Query: 301 D 301
+
Sbjct: 483 E 483
|
Involved in the pyrimidine salvage pathway. The uracil phosphoribosyltransferase (UPRT) activity, that catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate, is unsure. Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 9 |
| >sp|Q9LK34|UKL2_ARATH Uridine kinase-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=UKL2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8VYB2|UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana GN=UKL3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O65583|UKL4_ARATH Uridine kinase-like protein 4 OS=Arabidopsis thaliana GN=UKL4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9LTY6|UKL5_ARATH Uridine kinase-like protein 5 OS=Arabidopsis thaliana GN=UKL5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q55EL3|UCKA_DICDI Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q55GQ6|UPP_DICDI Uracil phosphoribosyltransferase OS=Dictyostelium discoideum GN=uprt PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q26998|UPP_TOXGO Uracil phosphoribosyltransferase OS=Toxoplasma gondii GN=uprt PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 301 | ||||||
| 224055715 | 481 | predicted protein [Populus trichocarpa] | 1.0 | 0.625 | 0.966 | 1e-169 | |
| 356558725 | 474 | PREDICTED: uridine kinase-like protein 1 | 1.0 | 0.635 | 0.956 | 1e-168 | |
| 224129080 | 477 | predicted protein [Populus trichocarpa] | 1.0 | 0.631 | 0.956 | 1e-168 | |
| 359488603 | 482 | PREDICTED: uridine kinase-like protein 1 | 1.0 | 0.624 | 0.960 | 1e-167 | |
| 356571511 | 476 | PREDICTED: uridine kinase-like protein 1 | 1.0 | 0.632 | 0.953 | 1e-167 | |
| 359488605 | 481 | PREDICTED: uridine kinase-like protein 1 | 1.0 | 0.625 | 0.960 | 1e-167 | |
| 297805570 | 489 | ATUK/UPRT1 [Arabidopsis lyrata subsp. ly | 1.0 | 0.615 | 0.943 | 1e-166 | |
| 15237512 | 486 | putative uracil phosphoribosyltransferas | 1.0 | 0.619 | 0.940 | 1e-166 | |
| 255536937 | 481 | Uracil phosphoribosyltransferase, putati | 1.0 | 0.625 | 0.943 | 1e-165 | |
| 15232108 | 483 | putative uracil phosphoribosyltransferas | 1.0 | 0.623 | 0.930 | 1e-164 |
| >gi|224055715|ref|XP_002298617.1| predicted protein [Populus trichocarpa] gi|222845875|gb|EEE83422.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 599 bits (1544), Expect = e-169, Method: Compositional matrix adjust.
Identities = 291/301 (96%), Positives = 299/301 (99%)
Query: 1 MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVII 60
MNMKIFVDTDADVRLARRIRRDTVERGRD++SVLEQYAKFVKPAFDDFVLPSKKYADVII
Sbjct: 181 MNMKIFVDTDADVRLARRIRRDTVERGRDINSVLEQYAKFVKPAFDDFVLPSKKYADVII 240
Query: 61 PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFV 120
PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNV+VIQSTFQIRGMHTLIRD+ ISKHDFV
Sbjct: 241 PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVHVIQSTFQIRGMHTLIRDKEISKHDFV 300
Query: 121 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSGESMENALRA 180
FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGS+YTGVDFCKKLCGVSIVRSGESMENALRA
Sbjct: 301 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSVYTGVDFCKKLCGVSIVRSGESMENALRA 360
Query: 181 CCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKG 240
CCKGIKIGKILIHRDGDNGKQLIYEKLP DISERHVLLLDPVLATGNSANQAI+LLI+KG
Sbjct: 361 CCKGIKIGKILIHRDGDNGKQLIYEKLPKDISERHVLLLDPVLATGNSANQAIELLIQKG 420
Query: 241 VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTD 300
VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPG+GEFGDRYFGTD
Sbjct: 421 VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGTD 480
Query: 301 D 301
D
Sbjct: 481 D 481
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356558725|ref|XP_003547653.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224129080|ref|XP_002328885.1| predicted protein [Populus trichocarpa] gi|222839315|gb|EEE77652.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359488603|ref|XP_003633787.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356571511|ref|XP_003553920.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359488605|ref|XP_003633788.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297805570|ref|XP_002870669.1| ATUK/UPRT1 [Arabidopsis lyrata subsp. lyrata] gi|297316505|gb|EFH46928.1| ATUK/UPRT1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15237512|ref|NP_198903.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|75333998|sp|Q9FKS0.1|UKL1_ARATH RecName: Full=Uridine kinase-like protein 1, chloroplastic; Includes: RecName: Full=Uridine kinase; Short=UK; Includes: RecName: Full=Putative uracil phosphoribosyltransferase; Short=UPRTase; AltName: Full=UMP pyrophosphorylase; Flags: Precursor gi|10177966|dbj|BAB11349.1| uridine kinase-like protein [Arabidopsis thaliana] gi|26983834|gb|AAN86169.1| putative uridine kinase [Arabidopsis thaliana] gi|29465725|gb|AAM10488.1| uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|332007227|gb|AED94610.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255536937|ref|XP_002509535.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] gi|223549434|gb|EEF50922.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|15232108|ref|NP_189355.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|75335099|sp|Q9LK34.1|UKL2_ARATH RecName: Full=Uridine kinase-like protein 2, chloroplastic; Includes: RecName: Full=Uridine kinase; Short=UK; Includes: RecName: Full=Putative uracil phosphoribosyltransferase; Short=UPRTase; AltName: Full=UMP pyrophosphorylase; Flags: Precursor gi|9294212|dbj|BAB02114.1| uridine kinase-like protein [Arabidopsis thaliana] gi|38564268|gb|AAR23713.1| At3g27190 [Arabidopsis thaliana] gi|51969226|dbj|BAD43305.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|332643756|gb|AEE77277.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 301 | ||||||
| TAIR|locus:2164516 | 486 | UK/UPRT1 "AT5G40870" [Arabidop | 1.0 | 0.619 | 0.906 | 8.1e-147 | |
| TAIR|locus:2086523 | 483 | UKL2 "AT3G27190" [Arabidopsis | 1.0 | 0.623 | 0.897 | 1.2e-145 | |
| TAIR|locus:2012125 | 466 | UKL3 "AT1G55810" [Arabidopsis | 1.0 | 0.645 | 0.823 | 1.2e-136 | |
| TAIR|locus:2131498 | 469 | UKL4 "AT4G26510" [Arabidopsis | 1.0 | 0.641 | 0.817 | 2e-134 | |
| TAIR|locus:2086691 | 465 | UKL5 "AT3G27440" [Arabidopsis | 1.0 | 0.647 | 0.757 | 3.9e-124 | |
| UNIPROTKB|E1BP85 | 548 | UCKL1 "Uridine kinase" [Bos ta | 0.996 | 0.547 | 0.480 | 3.9e-76 | |
| MGI|MGI:1915806 | 548 | Uckl1 "uridine-cytidine kinase | 0.996 | 0.547 | 0.477 | 1.7e-75 | |
| UNIPROTKB|Q9NWZ5 | 548 | UCKL1 "Uridine-cytidine kinase | 0.996 | 0.547 | 0.474 | 4.5e-75 | |
| UNIPROTKB|F1NB19 | 511 | UCKL1 "Uridine kinase" [Gallus | 0.996 | 0.587 | 0.474 | 5.7e-75 | |
| UNIPROTKB|F1P819 | 554 | UCKL1 "Uridine kinase" [Canis | 0.996 | 0.541 | 0.476 | 1.9e-74 |
| TAIR|locus:2164516 UK/UPRT1 "AT5G40870" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1434 (509.9 bits), Expect = 8.1e-147, P = 8.1e-147
Identities = 273/301 (90%), Positives = 287/301 (95%)
Query: 1 MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVII 60
MNMKIFVDTDADVRLARRIRRDTVERGRDV+SVLEQYAKFVKPAFDDFVLPSKKYADVII
Sbjct: 183 MNMKIFVDTDADVRLARRIRRDTVERGRDVNSVLEQYAKFVKPAFDDFVLPSKKYADVII 242
Query: 61 PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFV 120
PRGGDNHVA+DLI QHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIR++ ISKHDFV
Sbjct: 243 PRGGDNHVAVDLITQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIREKDISKHDFV 302
Query: 121 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSGESMENALRA 180
FYSDRLIRLVVEHGLGHLPFTEKQVVTPTG++YTGVDFCKKLCGVSI+RSGESMENALRA
Sbjct: 303 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGAVYTGVDFCKKLCGVSIIRSGESMENALRA 362
Query: 181 XXXXXXXXXXLIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKG 240
LIHRDGDNGKQLIYEKLP+DISERHVLLLDPVLATGNSANQAI+LLI+KG
Sbjct: 363 CCKGIKIGKILIHRDGDNGKQLIYEKLPHDISERHVLLLDPVLATGNSANQAIELLIQKG 422
Query: 241 VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTD 300
VPE+HIIFLNLISAPEGIHCVCKRFP+LKIVTSEID LN+EFRVIPGLGEFGDRYFGTD
Sbjct: 423 VPEAHIIFLNLISAPEGIHCVCKRFPALKIVTSEIDQCLNQEFRVIPGLGEFGDRYFGTD 482
Query: 301 D 301
+
Sbjct: 483 E 483
|
|
| TAIR|locus:2086523 UKL2 "AT3G27190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012125 UKL3 "AT1G55810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2131498 UKL4 "AT4G26510" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086691 UKL5 "AT3G27440" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BP85 UCKL1 "Uridine kinase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915806 Uckl1 "uridine-cytidine kinase 1-like 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NWZ5 UCKL1 "Uridine-cytidine kinase-like 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NB19 UCKL1 "Uridine kinase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P819 UCKL1 "Uridine kinase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9FKS0 | UKL1_ARATH | 2, ., 4, ., 2, ., 9 | 0.9401 | 1.0 | 0.6193 | yes | no |
| O13867 | UPP1_SCHPO | 2, ., 4, ., 2, ., 9 | 0.5215 | 0.6910 | 0.9497 | yes | no |
| P18562 | UPP_YEAST | 2, ., 4, ., 2, ., 9 | 0.5263 | 0.6910 | 0.9629 | yes | no |
| Q9LK34 | UKL2_ARATH | 2, ., 4, ., 2, ., 9 | 0.9302 | 1.0 | 0.6231 | no | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 4th Layer | 2.4.2.9 | 0.824 |
| 3rd Layer | 2.4.2 | 0.766 |
| 4th Layer | 2.7.1.48 | 0.824 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 301 | |||
| COG0035 | 210 | COG0035, Upp, Uracil phosphoribosyltransferase [Nu | 1e-63 | |
| cd02023 | 198 | cd02023, UMPK, Uridine monophosphate kinase (UMPK, | 2e-47 | |
| PRK05480 | 209 | PRK05480, PRK05480, uridine/cytidine kinase; Provi | 9e-41 | |
| TIGR01091 | 207 | TIGR01091, upp, uracil phosphoribosyltransferase | 3e-38 | |
| PRK00129 | 209 | PRK00129, upp, uracil phosphoribosyltransferase; R | 3e-35 | |
| TIGR00235 | 207 | TIGR00235, udk, uridine kinase | 2e-34 | |
| COG0572 | 218 | COG0572, Udk, Uridine kinase [Nucleotide transport | 2e-32 | |
| pfam00485 | 197 | pfam00485, PRK, Phosphoribulokinase / Uridine kina | 4e-21 | |
| PLN02541 | 244 | PLN02541, PLN02541, uracil phosphoribosyltransfera | 3e-20 | |
| PTZ00301 | 210 | PTZ00301, PTZ00301, uridine kinase; Provisional | 4e-14 | |
| cd06223 | 130 | cd06223, PRTases_typeI, Phosphoribosyl transferase | 7e-11 | |
| PLN02348 | 395 | PLN02348, PLN02348, phosphoribulokinase | 2e-08 | |
| cd02026 | 273 | cd02026, PRK, Phosphoribulokinase (PRK) is an enzy | 6e-08 | |
| PRK07429 | 327 | PRK07429, PRK07429, phosphoribulokinase; Provision | 6e-07 | |
| PRK08233 | 182 | PRK08233, PRK08233, hypothetical protein; Provisio | 3e-06 |
| >gnl|CDD|223113 COG0035, Upp, Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Score = 198 bits (507), Expect = 1e-63
Identities = 85/211 (40%), Positives = 122/211 (57%), Gaps = 5/211 (2%)
Query: 92 NVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGS 151
NVYVI ++ T++RD+ +F D + RL+ LP + ++ TP G
Sbjct: 3 NVYVIDHP-LVKHKLTILRDKNTGTKEFRELLDEIGRLLAYEATRDLPLEKVEIETPLGP 61
Query: 152 MYTGVDFC-KKLCGVSIVRSGESMENALRACCKGIKIGKILIHRDGDNGK-QLIYEKLPN 209
GV KK+ V I+R+G M L ++G I I+RD + + L YEKLP
Sbjct: 62 T-EGVQIAGKKIVIVPILRAGLGMVEGLLKLIPSARVGHIGIYRDEETLEPVLYYEKLPE 120
Query: 210 DISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLK 269
DI ER V++LDP+LATG SA AI LL ++G P+ +I ++L++APEGI V K P ++
Sbjct: 121 DIDERTVIVLDPMLATGGSAIAAIDLLKKRGGPK-NIKVVSLVAAPEGIKAVEKAHPDVE 179
Query: 270 IVTSEIDVALNEEFRVIPGLGEFGDRYFGTD 300
I T+ ID LNE+ ++PGLG+ GDR FGT
Sbjct: 180 IYTAAIDEGLNEKGYIVPGLGDAGDRLFGTK 210
|
Length = 210 |
| >gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130163 TIGR01091, upp, uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234653 PRK00129, upp, uracil phosphoribosyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|232890 TIGR00235, udk, uridine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family | Back alignment and domain information |
|---|
| >gnl|CDD|215297 PLN02541, PLN02541, uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|140322 PTZ00301, PTZ00301, uridine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain | Back alignment and domain information |
|---|
| >gnl|CDD|215198 PLN02348, PLN02348, phosphoribulokinase | Back alignment and domain information |
|---|
| >gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181310 PRK08233, PRK08233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 301 | |||
| COG0035 | 210 | Upp Uracil phosphoribosyltransferase [Nucleotide t | 100.0 | |
| PF14681 | 207 | UPRTase: Uracil phosphoribosyltransferase; PDB: 1V | 100.0 | |
| PLN02541 | 244 | uracil phosphoribosyltransferase | 100.0 | |
| TIGR01091 | 207 | upp uracil phosphoribosyltransferase. that include | 100.0 | |
| PRK00129 | 209 | upp uracil phosphoribosyltransferase; Reviewed | 100.0 | |
| KOG4203 | 473 | consensus Armadillo/beta-Catenin/plakoglobin [Sign | 100.0 | |
| KOG1017 | 267 | consensus Predicted uracil phosphoribosyltransfera | 100.0 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 99.85 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 99.74 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 99.63 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 99.61 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 99.6 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 99.55 | |
| PLN02369 | 302 | ribose-phosphate pyrophosphokinase | 99.46 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 99.41 | |
| TIGR01203 | 166 | HGPRTase hypoxanthine phosphoribosyltransferase. S | 99.36 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 99.33 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 99.33 | |
| PRK03092 | 304 | ribose-phosphate pyrophosphokinase; Provisional | 99.29 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 99.27 | |
| PRK05205 | 176 | bifunctional pyrimidine regulatory protein PyrR ur | 99.27 | |
| PLN02348 | 395 | phosphoribulokinase | 99.19 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 99.18 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 99.06 | |
| COG2065 | 179 | PyrR Pyrimidine operon attenuation protein/uracil | 99.01 | |
| PRK01259 | 309 | ribose-phosphate pyrophosphokinase; Provisional | 99.0 | |
| PRK15423 | 178 | hypoxanthine phosphoribosyltransferase; Provisiona | 98.99 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 98.98 | |
| PRK02812 | 330 | ribose-phosphate pyrophosphokinase; Provisional | 98.97 | |
| PTZ00271 | 211 | hypoxanthine-guanine phosphoribosyltransferase; Pr | 98.93 | |
| PRK06827 | 382 | phosphoribosylpyrophosphate synthetase; Provisiona | 98.93 | |
| PRK09162 | 181 | hypoxanthine-guanine phosphoribosyltransferase; Pr | 98.9 | |
| TIGR01251 | 308 | ribP_PPkin ribose-phosphate pyrophosphokinase. In | 98.89 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 98.86 | |
| PF00156 | 125 | Pribosyltran: Phosphoribosyl transferase domain; I | 98.85 | |
| PTZ00149 | 241 | hypoxanthine phosphoribosyltransferase; Provisiona | 98.82 | |
| PLN02238 | 189 | hypoxanthine phosphoribosyltransferase | 98.81 | |
| PRK00934 | 285 | ribose-phosphate pyrophosphokinase; Provisional | 98.81 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 98.74 | |
| COG0634 | 178 | Hpt Hypoxanthine-guanine phosphoribosyltransferase | 98.72 | |
| PRK04923 | 319 | ribose-phosphate pyrophosphokinase; Provisional | 98.66 | |
| COG1926 | 220 | Predicted phosphoribosyltransferases [General func | 98.66 | |
| PRK02269 | 320 | ribose-phosphate pyrophosphokinase; Provisional | 98.64 | |
| PRK02458 | 323 | ribose-phosphate pyrophosphokinase; Provisional | 98.62 | |
| TIGR01090 | 169 | apt adenine phosphoribosyltransferase. A phylogene | 98.62 | |
| PRK07199 | 301 | phosphoribosylpyrophosphate synthetase; Provisiona | 98.54 | |
| PRK02304 | 175 | adenine phosphoribosyltransferase; Provisional | 98.52 | |
| COG0462 | 314 | PrsA Phosphoribosylpyrophosphate synthetase [Nucle | 98.52 | |
| PRK06696 | 223 | uridine kinase; Validated | 98.48 | |
| PRK00553 | 332 | ribose-phosphate pyrophosphokinase; Provisional | 98.46 | |
| PRK00455 | 202 | pyrE orotate phosphoribosyltransferase; Validated | 98.39 | |
| PRK02277 | 200 | orotate phosphoribosyltransferase-like protein; Pr | 98.34 | |
| PLN02293 | 187 | adenine phosphoribosyltransferase | 98.33 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 98.31 | |
| TIGR00336 | 173 | pyrE orotate phosphoribosyltransferase. The conser | 98.3 | |
| TIGR01367 | 187 | pyrE_Therm orotate phosphoribosyltransferase, Ther | 98.27 | |
| PF14572 | 184 | Pribosyl_synth: Phosphoribosyl synthetase-associat | 98.24 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 98.23 | |
| PTZ00145 | 439 | phosphoribosylpyrophosphate synthetase; Provisiona | 98.2 | |
| PRK09177 | 156 | xanthine-guanine phosphoribosyltransferase; Valida | 98.17 | |
| PRK13811 | 170 | orotate phosphoribosyltransferase; Provisional | 98.12 | |
| PRK07322 | 178 | adenine phosphoribosyltransferase; Provisional | 98.1 | |
| PRK13812 | 176 | orotate phosphoribosyltransferase; Provisional | 98.1 | |
| PRK08558 | 238 | adenine phosphoribosyltransferase; Provisional | 98.03 | |
| PRK06031 | 233 | phosphoribosyltransferase; Provisional | 97.97 | |
| PLN02297 | 326 | ribose-phosphate pyrophosphokinase | 97.94 | |
| COG2236 | 192 | Predicted phosphoribosyltransferases [General func | 97.89 | |
| COG0856 | 203 | Orotate phosphoribosyltransferase homologs [Nucleo | 97.88 | |
| PRK12560 | 187 | adenine phosphoribosyltransferase; Provisional | 97.87 | |
| PRK13810 | 187 | orotate phosphoribosyltransferase; Provisional | 97.82 | |
| PRK05793 | 469 | amidophosphoribosyltransferase; Provisional | 97.82 | |
| PRK13809 | 206 | orotate phosphoribosyltransferase; Provisional | 97.8 | |
| PRK08525 | 445 | amidophosphoribosyltransferase; Provisional | 97.75 | |
| PLN02440 | 479 | amidophosphoribosyltransferase | 97.73 | |
| TIGR00201 | 190 | comF comF family protein. This protein is found in | 97.68 | |
| PRK09123 | 479 | amidophosphoribosyltransferase; Provisional | 97.66 | |
| KOG1448 | 316 | consensus Ribose-phosphate pyrophosphokinase [Nucl | 97.66 | |
| TIGR01744 | 191 | XPRTase xanthine phosphoribosyltransferase. This m | 97.62 | |
| COG0503 | 179 | Apt Adenine/guanine phosphoribosyltransferases and | 97.62 | |
| KOG3367 | 216 | consensus Hypoxanthine-guanine phosphoribosyltrans | 97.62 | |
| PRK11595 | 227 | DNA utilization protein GntX; Provisional | 97.59 | |
| PRK09219 | 189 | xanthine phosphoribosyltransferase; Validated | 97.58 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 97.54 | |
| COG0461 | 201 | PyrE Orotate phosphoribosyltransferase [Nucleotide | 97.54 | |
| COG1040 | 225 | ComFC Predicted amidophosphoribosyltransferases [G | 97.51 | |
| PRK08341 | 442 | amidophosphoribosyltransferase; Provisional | 97.5 | |
| PRK09246 | 501 | amidophosphoribosyltransferase; Provisional | 97.47 | |
| TIGR01743 | 268 | purR_Bsub pur operon repressor, Bacillus subtilis | 97.43 | |
| PRK09213 | 271 | pur operon repressor; Provisional | 97.28 | |
| KOG1712 | 183 | consensus Adenine phosphoribosyl transferases [Nuc | 97.24 | |
| PRK07349 | 500 | amidophosphoribosyltransferase; Provisional | 97.22 | |
| PRK07272 | 484 | amidophosphoribosyltransferase; Provisional | 97.09 | |
| TIGR01134 | 442 | purF amidophosphoribosyltransferase. Alternate nam | 97.01 | |
| PRK05500 | 477 | bifunctional orotidine 5'-phosphate decarboxylase/ | 96.99 | |
| PRK06781 | 471 | amidophosphoribosyltransferase; Provisional | 96.94 | |
| PRK07847 | 510 | amidophosphoribosyltransferase; Provisional | 96.94 | |
| PRK07631 | 475 | amidophosphoribosyltransferase; Provisional | 96.93 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 96.93 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 96.81 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 96.79 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 96.57 | |
| PF15609 | 191 | PRTase_2: Phosphoribosyl transferase | 96.54 | |
| PRK06388 | 474 | amidophosphoribosyltransferase; Provisional | 96.49 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 96.41 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 96.05 | |
| COG3954 | 289 | PrkB Phosphoribulokinase [Energy production and co | 95.73 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 95.65 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 95.54 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 95.46 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 95.37 | |
| KOG0572 | 474 | consensus Glutamine phosphoribosylpyrophosphate am | 95.15 | |
| PLN02422 | 232 | dephospho-CoA kinase | 94.97 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 94.64 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 94.58 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 94.39 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 94.2 | |
| cd02030 | 219 | NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO | 94.16 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 94.1 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 93.88 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 93.69 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 93.24 | |
| COG0034 | 470 | PurF Glutamine phosphoribosylpyrophosphate amidotr | 92.45 | |
| PF01712 | 146 | dNK: Deoxynucleoside kinase; InterPro: IPR002624 T | 92.35 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 91.75 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 91.54 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 91.45 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 91.23 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 90.85 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 90.68 | |
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 90.63 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 89.53 | |
| PRK13974 | 212 | thymidylate kinase; Provisional | 89.15 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 88.99 | |
| PF02224 | 157 | Cytidylate_kin: Cytidylate kinase; InterPro: IPR01 | 88.93 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 88.82 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 88.53 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 88.51 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 88.44 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 88.14 | |
| KOG1503 | 354 | consensus Phosphoribosylpyrophosphate synthetase-a | 87.72 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 87.55 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 87.26 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 87.09 | |
| PRK06217 | 183 | hypothetical protein; Validated | 87.03 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 86.74 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 86.44 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 85.59 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 85.36 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 84.2 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 84.17 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 83.75 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 82.8 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 82.75 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 81.9 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 81.37 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 81.34 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 81.2 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 81.19 | |
| PRK13976 | 209 | thymidylate kinase; Provisional | 80.66 |
| >COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.5e-69 Score=472.71 Aligned_cols=207 Identities=41% Similarity=0.625 Sum_probs=200.1
Q ss_pred CceeeccchHHHHHHhhhhhcCCCChhhhHhhHHHHHHHHHHHHhCCCCCeeeEeeCCCCceeeeeeec-cceeEEEecc
Q 022183 91 PNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFC-KKLCGVSIVR 169 (301)
Q Consensus 91 ~~v~vl~~~~~~~~~lt~LRd~~T~~~~Fr~~~~rl~~lL~~eal~~lp~~~~~V~tp~g~~~~g~~~~-~~i~~V~IlR 169 (301)
.++++++|| +++|++|+|||++|++.+||++++||++||+|||++++|+++++|+||++ +++|..+. +++|+|||||
T Consensus 2 ~~v~vi~hp-li~~~lt~lRdk~t~~~~Fr~~~~ei~~lL~yEa~~~l~~e~~~ieTP~~-~~~~~~~~~~~i~~V~ILR 79 (210)
T COG0035 2 MNVYVIDHP-LVKHKLTILRDKNTGTKEFRELLDEIGRLLAYEATRDLPLEKVEIETPLG-PTEGVQIAGKKIVIVPILR 79 (210)
T ss_pred CceEEeCcH-HHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHhCcCceeEEEEECCCc-ceeeeeecCCcEEEEEEee
Confidence 579999997 79999999999999999999999999999999999999999999999999 57888886 4599999999
Q ss_pred cchHHHHHHHHhccCCeeeeEEEEecCCCC-ceeEeecCCCCCCCcEEEEEcccccchHHHHHHHHHHHHcCCCCccEEE
Q 022183 170 SGESMENALRACCKGIKIGKILIHRDGDNG-KQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIF 248 (301)
Q Consensus 170 aG~~m~~~l~~~~p~a~~G~i~i~Rd~~~~-~~~~y~~lP~~i~~~~Vil~Dp~laTG~t~~~ai~~L~~~g~~~~~I~~ 248 (301)
||++|.+|+.+++|+|++|||+++||++|+ +..||.|||++++++.|+|+|||+|||+|+++|++.|+++| .+++|++
T Consensus 80 AGl~m~~gl~~~~P~a~vG~ig~~Rdeet~~p~~yy~KLP~~~~~~~viv~DPMLATG~s~i~ai~~L~~~G-~~~~I~~ 158 (210)
T COG0035 80 AGLGMVEGLLKLIPSARVGHIGIYRDEETLEPVLYYEKLPEDIDERTVIVLDPMLATGGSAIAAIDLLKKRG-GPKNIKV 158 (210)
T ss_pred ccccHHHHHHHhCCcceEEEEEEEecCccCceehhHHhCCCcccCCeEEEECchhhccHhHHHHHHHHHHhC-CCceEEE
Confidence 999999999999999999999999999998 88999999999999999999999999999999999999997 6699999
Q ss_pred EEEEeCHHHHHHHHHhCCCcEEEEEeecCCCCCCCeeecCCCchhhhccCCC
Q 022183 249 LNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTD 300 (301)
Q Consensus 249 ~~~vas~~gl~~l~~~~p~v~i~t~~iD~~l~~~~~ivPGlGd~GdR~fgt~ 300 (301)
+|++|+|+|++++.++||+|+||||+||++||++|||+|||||||||+|||+
T Consensus 159 v~~vAapeGi~~v~~~~p~v~I~ta~iD~~Lne~gYIvPGLGDaGDR~fGt~ 210 (210)
T COG0035 159 VSLVAAPEGIKAVEKAHPDVEIYTAAIDEGLNEKGYIVPGLGDAGDRLFGTK 210 (210)
T ss_pred EEEEecHHHHHHHHHhCCCCeEEEEEeccccccCCCCccCCCcccccccCCC
Confidence 9999999999999999999999999999999999999999999999999995
|
|
| >PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C | Back alignment and domain information |
|---|
| >PLN02541 uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >TIGR01091 upp uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK00129 upp uracil phosphoribosyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1017 consensus Predicted uracil phosphoribosyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02369 ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK03092 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01259 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK15423 hypoxanthine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK02812 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06827 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate | Back alignment and domain information |
|---|
| >PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02238 hypoxanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK00934 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04923 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >COG1926 Predicted phosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02269 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK02458 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01090 apt adenine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK07199 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK02304 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK00553 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK00455 pyrE orotate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK02277 orotate phosphoribosyltransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02293 adenine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00336 pyrE orotate phosphoribosyltransferase | Back alignment and domain information |
|---|
| >TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family | Back alignment and domain information |
|---|
| >PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09177 xanthine-guanine phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13811 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07322 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13812 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08558 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06031 phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02297 ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >COG2236 Predicted phosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12560 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13810 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05793 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13809 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08525 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02440 amidophosphoribosyltransferase | Back alignment and domain information |
|---|
| >TIGR00201 comF comF family protein | Back alignment and domain information |
|---|
| >PRK09123 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1448 consensus Ribose-phosphate pyrophosphokinase [Nucleotide transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01744 XPRTase xanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3367 consensus Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11595 DNA utilization protein GntX; Provisional | Back alignment and domain information |
|---|
| >PRK09219 xanthine phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08341 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09246 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type | Back alignment and domain information |
|---|
| >PRK09213 pur operon repressor; Provisional | Back alignment and domain information |
|---|
| >KOG1712 consensus Adenine phosphoribosyl transferases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07349 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07272 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01134 purF amidophosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated | Back alignment and domain information |
|---|
| >PRK06781 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07847 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07631 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF15609 PRTase_2: Phosphoribosyl transferase | Back alignment and domain information |
|---|
| >PRK06388 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >COG3954 PrkB Phosphoribulokinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0572 consensus Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF01712 dNK: Deoxynucleoside kinase; InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2 | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK13974 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF02224 Cytidylate_kin: Cytidylate kinase; InterPro: IPR011994 Cytidylate kinase (2 | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >KOG1503 consensus Phosphoribosylpyrophosphate synthetase-associated protein [Amino acid transport and metabolism; Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 301 | ||||
| 1bd3_D | 243 | Structure Of The Apo Uracil Phosphoribosyltransfera | 1e-60 | ||
| 1upu_D | 224 | Structure Of The Uracil Phosphoribosyltransferase, | 1e-60 | ||
| 1xrj_A | 261 | Rapid Structure Determination Of Human Uridine-Cyti | 2e-27 | ||
| 1udw_A | 252 | Crystal Structure Of Human Uridine-cytidine Kinase | 3e-27 | ||
| 2jeo_A | 245 | Crystal Structure Of Human Uridine-Cytidine Kinase | 8e-26 | ||
| 3dmp_A | 217 | 2.6 A Crystal Structure Of Uracil Phosphoribosyltra | 1e-22 | ||
| 1i5e_A | 209 | Crystal Structure Of Bacillus Caldolyticus Uracil P | 2e-22 | ||
| 1v9s_A | 208 | Crystal Structure Of Tt0130 Protein From Thermus Th | 2e-21 | ||
| 1o5o_A | 221 | Crystal Structure Of Uracil Phosphoribosyltransfera | 7e-19 | ||
| 3asy_A | 211 | Ligand-Free Structure Of Uridine Kinase From Thermu | 8e-18 | ||
| 2ehj_A | 208 | Structure Of Uracil Phosphoribosyl Transferase Leng | 3e-17 | ||
| 2e55_A | 208 | Structure Of Aq2163 Protein From Aquifex Aeolicus L | 3e-10 | ||
| 1xtt_A | 216 | Sulfolobus Solfataricus Uracil Phosphoribosyltransf | 3e-09 |
| >pdb|1BD3|D Chain D, Structure Of The Apo Uracil Phosphoribosyltransferase, 2 Mutant C128v Length = 243 | Back alignment and structure |
|
| >pdb|1UPU|D Chain D, Structure Of The Uracil Phosphoribosyltransferase, Mutant C128v, Bound To Product Uridine-1-Monophosphate (Ump) Length = 224 | Back alignment and structure |
| >pdb|1XRJ|A Chain A, Rapid Structure Determination Of Human Uridine-Cytidine Kinase 2 Using A Conventional Laboratory X-Ray Source And A Single Samarium Derivative Length = 261 | Back alignment and structure |
| >pdb|1UDW|A Chain A, Crystal Structure Of Human Uridine-cytidine Kinase 2 Complexed With A Feedback-inhibitor, Ctp Length = 252 | Back alignment and structure |
| >pdb|2JEO|A Chain A, Crystal Structure Of Human Uridine-Cytidine Kinase 1 Length = 245 | Back alignment and structure |
| >pdb|3DMP|A Chain A, 2.6 A Crystal Structure Of Uracil Phosphoribosyltransferase From Burkholderia Pseudomallei Length = 217 | Back alignment and structure |
| >pdb|1I5E|A Chain A, Crystal Structure Of Bacillus Caldolyticus Uracil Phosphoribosyltransferase With Bound Ump Length = 209 | Back alignment and structure |
| >pdb|1V9S|A Chain A, Crystal Structure Of Tt0130 Protein From Thermus Thermophilus Hb8 Length = 208 | Back alignment and structure |
| >pdb|1O5O|A Chain A, Crystal Structure Of Uracil Phosphoribosyltransferase (Tm0721) From Thermotoga Maritima At 2.30 A Resolution Length = 221 | Back alignment and structure |
| >pdb|3ASY|A Chain A, Ligand-Free Structure Of Uridine Kinase From Thermus Thermophilus Hb8 Length = 211 | Back alignment and structure |
| >pdb|2EHJ|A Chain A, Structure Of Uracil Phosphoribosyl Transferase Length = 208 | Back alignment and structure |
| >pdb|2E55|A Chain A, Structure Of Aq2163 Protein From Aquifex Aeolicus Length = 208 | Back alignment and structure |
| >pdb|1XTT|A Chain A, Sulfolobus Solfataricus Uracil Phosphoribosyltransferase In Complex With Uridine 5'-Monophosphate (Ump) Length = 216 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Length = 243 | Back alignment and structure |
|---|
Score = 258 bits (661), Expect = 1e-86
Identities = 117/244 (47%), Positives = 166/244 (68%), Gaps = 11/244 (4%)
Query: 57 DVIIPRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISK 116
++ PR N ++ D+ +PNV +++ T Q+R M T+IRD+ K
Sbjct: 9 LLVDPRYSTNDQEESIL----------QDIITRFPNVVLMKQTAQLRAMMTIIRDKETPK 58
Query: 117 HDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSGESMEN 176
+FVFY+DRLIRL++E L LPF +K+V TP Y GV F K+CGVSIVR+GESME+
Sbjct: 59 EEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICGVSIVRAGESMES 118
Query: 177 ALRACCKGIKIGKILIHRDGDNGK-QLIYEKLPNDISERHVLLLDPVLATGNSANQAIQL 235
LRA C+G++IGKILI RD + +LIYEKLP DI ER V+LLDP+ AT S +AI++
Sbjct: 119 GLRAVCRGVRIGKILIQRDETTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEV 178
Query: 236 LIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDR 295
L+ GV E IIF+N+++AP+GI V K +P +++VT+ +D+ LN + ++PG+G+FGDR
Sbjct: 179 LLRLGVKEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDR 238
Query: 296 YFGT 299
YFGT
Sbjct: 239 YFGT 242
|
| >3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} Length = 217 | Back alignment and structure |
|---|
| >1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Length = 221 | Back alignment and structure |
|---|
| >1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Length = 209 | Back alignment and structure |
|---|
| >1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 | Back alignment and structure |
|---|
| >2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Length = 208 | Back alignment and structure |
|---|
| >2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Length = 208 | Back alignment and structure |
|---|
| >1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Length = 216 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 301 | |||
| 3dmp_A | 217 | Uracil phosphoribosyltransferase; structural genom | 100.0 | |
| 1bd3_D | 243 | Uprtase, uracil phosphoribosyltransferase; glycosy | 100.0 | |
| 1xtt_A | 216 | Probable uracil phosphoribosyltransferase; tetrame | 100.0 | |
| 2ehj_A | 208 | Uracil phosphoribosyltransferase; structural genom | 100.0 | |
| 1v9s_A | 208 | Uracil phosphoribosyltransferase; pyrimidine salva | 100.0 | |
| 1o5o_A | 221 | Uracil phosphoribosyltransferase; TM0721, structur | 100.0 | |
| 2e55_A | 208 | Uracil phosphoribosyltransferase; structural genom | 100.0 | |
| 1i5e_A | 209 | Uracil phosphoribosyltransferase; salvage pathway; | 100.0 | |
| 3ohp_A | 177 | Hypoxanthine phosphoribosyltransferase; structural | 99.26 | |
| 2ywu_A | 181 | Hypoxanthine-guanine phosphoribosyltransferase; ro | 99.25 | |
| 3o7m_A | 186 | Hypoxanthine phosphoribosyltransferase; hypoxanthi | 99.21 | |
| 3hvu_A | 204 | Hypoxanthine phosphoribosyltransferase; hypoxanthi | 99.2 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 99.18 | |
| 2geb_A | 185 | Hypoxanthine-guanine phosphoribosyltransferase; HG | 99.16 | |
| 1wd5_A | 208 | Hypothetical protein TT1426; structural genomics, | 99.15 | |
| 3ozf_A | 250 | Hypoxanthine-guanine-xanthine phosphoribosyltrans; | 99.14 | |
| 1z7g_A | 217 | HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos | 99.13 | |
| 1yfz_A | 205 | Hypoxanthine-guanine phosphoribosyltransferase; pr | 99.06 | |
| 1tc1_A | 220 | Protein (hypoxanthine phosphoribosyltransferase); | 99.05 | |
| 2jbh_A | 225 | Phosphoribosyltransferase domain-containing prote; | 99.04 | |
| 1hgx_A | 183 | HGXPRTASE, hypoxanthine-guanine-xanthine phosphori | 99.04 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 99.04 | |
| 1vdm_A | 153 | Purine phosphoribosyltransferase; structural genom | 99.02 | |
| 1dku_A | 317 | Protein (phosphoribosyl pyrophosphate synthetase); | 99.01 | |
| 1pzm_A | 211 | HGPRT, hypoxanthine-guanine phosphoribosyltransfer | 99.0 | |
| 1fsg_A | 233 | HGPRTASE, hypoxanthine-guanine phosphoribosyltrans | 98.96 | |
| 1w30_A | 201 | PYRR bifunctional protein; transferase, glycosyltr | 98.93 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 98.93 | |
| 1u9y_A | 284 | RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy | 98.92 | |
| 3acd_A | 181 | Hypoxanthine-guanine phosphoribosyltransferase; ro | 98.91 | |
| 2aee_A | 211 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.9 | |
| 3s5j_B | 326 | Ribose-phosphate pyrophosphokinase 1; nucleotide s | 98.9 | |
| 1ufr_A | 181 | TT1027, PYR mRNA-binding attenuation protein; pyri | 98.87 | |
| 1a3c_A | 181 | PYRR, pyrimidine operon regulatory protein PYRR; t | 98.86 | |
| 3dah_A | 319 | Ribose-phosphate pyrophosphokinase; pyrophosphoki | 98.86 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 98.85 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 98.78 | |
| 2ji4_A | 379 | Phosphoribosyl pyrophosphate synthetase-associated | 98.74 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 98.7 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 98.7 | |
| 2xbu_A | 221 | Hypoxanthine-guanine phosphoribosyltransferase; gl | 98.69 | |
| 3lrt_A | 286 | Ribose-phosphate pyrophosphokinase; phosphoribosyl | 98.66 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 98.6 | |
| 1y0b_A | 197 | Xanthine phosphoribosyltransferase; purine metabol | 98.52 | |
| 1zn8_A | 180 | APRT, adenine phosphoribosyltransferase; glycosylt | 98.5 | |
| 2dy0_A | 190 | APRT, adenine phosphoribosyltransferase; structura | 98.45 | |
| 2p1z_A | 180 | Phosphoribosyltransferase; STRU genomics, PSI-2, p | 98.4 | |
| 1l1q_A | 186 | Adenine phosphoribosyltransferase; aprtase, giardi | 98.4 | |
| 2yzk_A | 178 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.39 | |
| 1qb7_A | 236 | APRT, adenine phosphoribosyltransferase; dinucleot | 98.39 | |
| 1g2q_A | 187 | Adenine phosphoribosyltransferase 1; dimer, single | 98.39 | |
| 1dqn_A | 230 | Guanine phosphoribosyltransferase; protein-inhibit | 98.36 | |
| 1vch_A | 175 | Phosphoribosyltransferase-related protein; structu | 98.26 | |
| 2wns_A | 205 | Orotate phosphoribosyltransferase; alternative spl | 98.24 | |
| 3dez_A | 243 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.23 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 98.23 | |
| 2ps1_A | 226 | Orotate phosphoribosyltransferase 1; alpha beta, o | 98.22 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 98.21 | |
| 1nul_A | 152 | XPRT, xanthine-guanine phosphoribosyltransferase; | 98.19 | |
| 3m3h_A | 234 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.17 | |
| 3mjd_A | 232 | Orotate phosphoribosyltransferase; IDP02311, csgid | 98.12 | |
| 3n2l_A | 238 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.11 | |
| 1lh0_A | 213 | OMP synthase; loop closure, monomer closure, orota | 97.95 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 97.88 | |
| 1o57_A | 291 | PUR operon repressor; purine operon repressor, hel | 97.86 | |
| 1ecf_A | 504 | Glutamine phosphoribosylpyrophosphate amidotransf; | 97.75 | |
| 1ao0_A | 459 | Glutamine phosphoribosylpyrophosphate amidotransfe | 97.64 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 97.57 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.54 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 97.45 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 97.45 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 97.41 | |
| 3qw4_B | 453 | UMP synthase; N-terminal orotidine monophosphate d | 97.34 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 97.31 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 97.24 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 97.1 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 97.01 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 96.93 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 96.6 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 96.59 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 96.56 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 96.49 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 96.42 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 96.35 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 95.56 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 95.33 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 95.08 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 95.06 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 94.55 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 94.46 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 94.42 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 94.22 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 94.2 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 94.06 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 94.06 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 94.02 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 93.59 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.51 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.48 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 93.46 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 93.36 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 93.34 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 93.16 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 93.06 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 92.83 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 92.69 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 92.47 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 92.29 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 92.28 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 92.21 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 92.08 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 92.03 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 91.93 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 91.73 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 91.43 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 91.09 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 91.07 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 90.96 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 90.82 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 90.7 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 90.56 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 90.53 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 90.45 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 90.29 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 90.02 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 89.98 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 89.96 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 89.51 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 89.45 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 88.82 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 88.8 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 88.66 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 88.64 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 86.9 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 86.82 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 85.77 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 85.51 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 85.22 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 82.65 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 81.96 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 81.29 |
| >3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=2.5e-66 Score=462.03 Aligned_cols=210 Identities=32% Similarity=0.542 Sum_probs=200.8
Q ss_pred CCCceeeccchHHHHHHhhhhhcCCCChhhhHhhHHHHHHHHHHHHhCCCCCeeeEeeCCCCceeeeeeec-cceeEEEe
Q 022183 89 IYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFC-KKLCGVSI 167 (301)
Q Consensus 89 ~~~~v~vl~~~~~~~~~lt~LRd~~T~~~~Fr~~~~rl~~lL~~eal~~lp~~~~~V~tp~g~~~~g~~~~-~~i~~V~I 167 (301)
.++|||+++|| +++|++|+|||++|++.+||++++||++||+|||++++|+++++|+||+| .+.|..+. +++|+|||
T Consensus 7 ~~~~v~v~~hp-~i~~~lt~lRd~~t~~~~Fr~~~~rl~~lL~yEa~~~lp~~~~~V~TP~g-~~~g~~~~~~~i~~V~I 84 (217)
T 3dmp_A 7 RFPNLFILDHP-LIQHKLTHMRDKDTSTRTFRELLREITLLMGYEITRNLPITTKRVETPLV-EIDAPVIAGKKLAIVPV 84 (217)
T ss_dssp TCTTEEEECCH-HHHHHHHHHHCTTSCHHHHHHHHHHHHHHHHHHHTTTCCEEEEEEECSSC-EEEEEEECGGGEEEEEE
T ss_pred CCCCeEecCCH-HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHhcCCceeEEEECCCe-EEEEEEecCCcEEEEEe
Confidence 46899999995 79999999999999999999999999999999999999999999999999 58899886 89999999
Q ss_pred cccchHHHHHHHHhccCCeeeeEEEEecCCCCceeEeecCCCCCCCcEEEEEcccccchHHHHHHHHHHHHcCCCCccEE
Q 022183 168 VRSGESMENALRACCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHII 247 (301)
Q Consensus 168 lRaG~~m~~~l~~~~p~a~~G~i~i~Rd~~~~~~~~y~~lP~~i~~~~Vil~Dp~laTG~t~~~ai~~L~~~g~~~~~I~ 247 (301)
+|+|++|++++.+++|++++|+|+++||+.|.+..||.++| ++++++|||+|||+|||+|+.+|++.|+++|+|+++|+
T Consensus 85 lRaG~~m~~~l~~~ip~a~vg~i~~~Rd~~t~p~~~~~~lP-~i~~~~VilvD~~laTG~T~~~ai~~L~~~G~pe~~I~ 163 (217)
T 3dmp_A 85 LRAGVGMSDGLLELIPSARVGHIGVYRADDHRPVEYLVRLP-DLEDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLM 163 (217)
T ss_dssp ETTTHHHHHHHHHHCTTSEECEEECSCCCSSSCCCSEEECC-CCTTCEEEEECSEESSSHHHHHHHHHHHTTTCCGGGEE
T ss_pred cccchHHHHHHHHhCcCCceeEEEEEECCCCCcEEEeecCC-CCCCCEEEEEcCcccccHHHHHHHHHHHHcCCCcCeEE
Confidence 99999999999999999999999999999887778899999 99999999999999999999999999999999889999
Q ss_pred EEEEEeCHHHHHHHHHhCCCcEEEEEeecCCCCCCCeeecCCCchhhhccCCCC
Q 022183 248 FLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 301 (301)
Q Consensus 248 ~~~~vas~~gl~~l~~~~p~v~i~t~~iD~~l~~~~~ivPGlGd~GdR~fgt~~ 301 (301)
++|++++++|++++.++||+|+||||+||++||++|||+|||||||||||||+.
T Consensus 164 ~~~~vaa~egl~~l~~~~P~v~i~ta~iD~~Lne~~yIvPGlGDaGDR~fgt~~ 217 (217)
T 3dmp_A 164 FLALVAAPEGVQVFQDAHPDVKLYVASLDSHLDDHAYIVPGLGDAGDRLFGTKN 217 (217)
T ss_dssp EECSEECHHHHHHHHHHCTTCEEEESEECCEECTTSCEESSCSCHHHHHHC---
T ss_pred EEEEEeCHHHHHHHHHHCCCCEEEEEEecCCcCCCCCccCCCCCHHHhhcCCCC
Confidence 999999999999999999999999999999999999999999999999999973
|
| >1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* | Back alignment and structure |
|---|
| >1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* | Back alignment and structure |
|---|
| >2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A | Back alignment and structure |
|---|
| >3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 | Back alignment and structure |
|---|
| >3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* | Back alignment and structure |
|---|
| >1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* | Back alignment and structure |
|---|
| >1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* | Back alignment and structure |
|---|
| >1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* | Back alignment and structure |
|---|
| >2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* | Back alignment and structure |
|---|
| >1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A | Back alignment and structure |
|---|
| >1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* | Back alignment and structure |
|---|
| >3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* | Back alignment and structure |
|---|
| >2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A | Back alignment and structure |
|---|
| >1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* | Back alignment and structure |
|---|
| >3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* | Back alignment and structure |
|---|
| >3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* | Back alignment and structure |
|---|
| >1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* | Back alignment and structure |
|---|
| >2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* | Back alignment and structure |
|---|
| >2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* | Back alignment and structure |
|---|
| >1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A | Back alignment and structure |
|---|
| >1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* | Back alignment and structure |
|---|
| >1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* | Back alignment and structure |
|---|
| >3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* | Back alignment and structure |
|---|
| >3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} | Back alignment and structure |
|---|
| >3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* | Back alignment and structure |
|---|
| >1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* | Back alignment and structure |
|---|
| >1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 301 | ||||
| d1bd3a_ | 224 | c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondi | 3e-75 | |
| d1i5ea_ | 208 | c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldoly | 2e-61 | |
| d1v9sa1 | 208 | c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus the | 3e-61 | |
| d1o5oa_ | 210 | c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga marit | 6e-58 | |
| d1xtta1 | 215 | c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus | 7e-54 | |
| d1a7ja_ | 288 | c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph | 1e-25 | |
| d1uj2a_ | 213 | c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho | 4e-22 | |
| d1sq5a_ | 308 | c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi | 5e-14 | |
| d1rz3a_ | 198 | c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci | 7e-07 | |
| d1wd5a_ | 208 | c.61.1.1 (A:) Putative phosphoribosyltransferase T | 0.002 |
| >d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Length = 224 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PRTase-like superfamily: PRTase-like family: Phosphoribosyltransferases (PRTases) domain: Uracil PRTase, Upp species: Toxoplasma gondii [TaxId: 5811]
Score = 227 bits (581), Expect = 3e-75
Identities = 114/217 (52%), Positives = 159/217 (73%), Gaps = 1/217 (0%)
Query: 84 HDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEK 143
D+ +PNV +++ T Q+R M T+IRD+ K +FVFY+DRLIRL++E L LPF +K
Sbjct: 7 QDIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKK 66
Query: 144 QVVTPTGSMYTGVDFCKKLCGVSIVRSGESMENALRACCKGIKIGKILIHRDGDNGK-QL 202
+V TP Y GV F K+CGVSIVR+GESME+ LRA C+G++IGKILI RD + +L
Sbjct: 67 EVTTPLDVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKL 126
Query: 203 IYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVC 262
IYEKLP DI ER V+LLDP+ AT S +AI++L+ GV E IIF+N+++AP+GI V
Sbjct: 127 IYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILAAPQGIERVF 186
Query: 263 KRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGT 299
K +P +++VT+ +D+ LN + ++PG+G+FGDRYFGT
Sbjct: 187 KEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT 223
|
| >d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Length = 208 | Back information, alignment and structure |
|---|
| >d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Length = 208 | Back information, alignment and structure |
|---|
| >d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Length = 210 | Back information, alignment and structure |
|---|
| >d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Length = 215 | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 | Back information, alignment and structure |
|---|
| >d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Length = 208 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 301 | |||
| d1bd3a_ | 224 | Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 | 100.0 | |
| d1i5ea_ | 208 | Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: | 100.0 | |
| d1o5oa_ | 210 | Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 | 100.0 | |
| d1v9sa1 | 208 | Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 | 100.0 | |
| d1xtta1 | 215 | Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId | 100.0 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 99.66 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 99.63 | |
| d1wd5a_ | 208 | Putative phosphoribosyltransferase TT1426 (TTHA146 | 99.15 | |
| d1vdma1 | 153 | Pprobable purine phosphoribosyltransferase PH0095 | 99.12 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 99.06 | |
| d1u9ya2 | 129 | Phosphoribosylpyrophosphate synthetase {Methanocal | 99.01 | |
| d1tc1a_ | 184 | Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 | 98.95 | |
| d1yfza1 | 178 | Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac | 98.94 | |
| d1hgxa_ | 173 | Hypoxanthine-guanine-xanthine PRTase {Tritrichomon | 98.92 | |
| d1pzma_ | 183 | Hypoxanthine-guanine-xanthine PRTase {Leishmania t | 98.86 | |
| d1w30a_ | 182 | Pyrimidine operon regulator PyrR {Mycobacterium tu | 98.85 | |
| d1j7ja_ | 172 | Hypoxanthine PRTase {Salmonella typhimurium [TaxId | 98.82 | |
| d1a3ca_ | 178 | Pyrimidine operon regulator PyrR {Bacillus subtili | 98.81 | |
| d1z7ga1 | 214 | Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom | 98.79 | |
| d1ufra_ | 178 | Pyrimidine operon regulator PyrR {Thermus thermoph | 98.78 | |
| d1fsga_ | 233 | Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g | 98.76 | |
| d1qb7a_ | 236 | Adenine PRTase {Leishmania donovani [TaxId: 5661]} | 98.75 | |
| d2c4ka2 | 184 | PRPP synthetase-associated protein 1 {Human (Homo | 98.7 | |
| d1cjba_ | 228 | Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium | 98.68 | |
| d1dkua2 | 149 | Phosphoribosylpyrophosphate synthetase {Bacillus s | 98.56 | |
| d1nula_ | 150 | Xanthine-guanine PRTase (XPRTase) {Escherichia col | 98.45 | |
| d1dqna_ | 230 | Guanine PRTase {Giardia lamblia [TaxId: 5741]} | 98.3 | |
| d1l1qa_ | 181 | Adenine PRTase {Giardia lamblia [TaxId: 5741]} | 98.05 | |
| d1o57a2 | 202 | Pur operon repressor (PurR), C-terminal domain {Ba | 97.96 | |
| d1vcha1 | 174 | Putative phosphoribosyltransferase TTHA1613 {Therm | 97.93 | |
| d1g2qa_ | 178 | Adenine PRTase {Baker's yeast (Saccharomyces cerev | 97.93 | |
| d1zn7a1 | 178 | Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] | 97.87 | |
| d1y0ba1 | 191 | Xanthine phosphoribosyltransferase {Bacillus subti | 97.86 | |
| d2aeea1 | 208 | Orotate PRTase {Streptococcus pyogenes [TaxId: 131 | 97.55 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 97.45 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 97.09 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 97.08 | |
| d1lh0a_ | 213 | Orotate PRTase {Salmonella typhimurium [TaxId: 903 | 96.89 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 96.39 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.24 | |
| d1ecfa1 | 243 | Glutamine PRPP amidotransferase, C-terminal domain | 95.79 | |
| d1gph11 | 231 | Glutamine PRPP amidotransferase, C-terminal domain | 95.56 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.08 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 93.51 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 92.88 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 92.7 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 90.8 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 90.67 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 88.74 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 88.49 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 87.95 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 87.35 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 86.36 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 83.66 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 83.39 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 82.31 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 82.11 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 81.28 |
| >d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PRTase-like superfamily: PRTase-like family: Phosphoribosyltransferases (PRTases) domain: Uracil PRTase, Upp species: Toxoplasma gondii [TaxId: 5811]
Probab=100.00 E-value=1.5e-71 Score=495.69 Aligned_cols=215 Identities=53% Similarity=0.978 Sum_probs=208.2
Q ss_pred ccccCCCceeeccchHHHHHHhhhhhcCCCChhhhHhhHHHHHHHHHHHHhCCCCCeeeEeeCCCCceeeeeeeccceeE
Q 022183 85 DLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCG 164 (301)
Q Consensus 85 ~l~~~~~~v~vl~~~~~~~~~lt~LRd~~T~~~~Fr~~~~rl~~lL~~eal~~lp~~~~~V~tp~g~~~~g~~~~~~i~~ 164 (301)
++++.+||+++++++|++++|+|+|||++|++.+||++++||++||+|||++++|+++++|+||+|.++.|..+.+++|+
T Consensus 8 ~~~~r~pnv~vl~~~p~i~~~lTiLRd~~T~~~~Fr~~~~ri~~lL~yEa~~~l~~~~~~V~TPlg~~~~~~~~~~~v~~ 87 (224)
T d1bd3a_ 8 DIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICG 87 (224)
T ss_dssp HHHHHCTTEEECCCCHHHHHHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHTTSCBCCEEEECTTSCEEEECCBCCCEEE
T ss_pred HHHhhCCCeEEeCCCHHHHHHHHHhHCCCCChHHHHHHHHHHHHHHHHHHHhccCceEEEEECCCcccccceecCCceEE
Confidence 34556799999987789999999999999999999999999999999999999999999999999988888888899999
Q ss_pred EEecccchHHHHHHHHhccCCeeeeEEEEecCCCC-ceeEeecCCCCCCCcEEEEEcccccchHHHHHHHHHHHHcCCCC
Q 022183 165 VSIVRSGESMENALRACCKGIKIGKILIHRDGDNG-KQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPE 243 (301)
Q Consensus 165 V~IlRaG~~m~~~l~~~~p~a~~G~i~i~Rd~~~~-~~~~y~~lP~~i~~~~Vil~Dp~laTG~t~~~ai~~L~~~g~~~ 243 (301)
|||||||++|++|+++++|+|++|||+++||++|. +.+||.++|++++++.|||+|||+|||+|+.+|++.|+++|+++
T Consensus 88 V~ILRAGl~m~~g~~~~~p~a~~g~i~~~Rde~t~~p~~~y~klP~~i~~~~vil~DPmLATG~S~~~ai~~L~~~g~~~ 167 (224)
T d1bd3a_ 88 VSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKE 167 (224)
T ss_dssp EEEETGGGGGHHHHHHHSTTCCEEEEEEEECTTTCCEEEEEEECCTTGGGSEEEEECSEESSCHHHHHHHHHHHHTTCCG
T ss_pred EeeecccchhhhhHHhhCCCccceeeeeccccCCCCceeeHhhCCCccccceEEEeChHHhcchHHHHHHHHHHHcCCCc
Confidence 99999999999999999999999999999999998 88999999999999999999999999999999999999999999
Q ss_pred ccEEEEEEEeCHHHHHHHHHhCCCcEEEEEeecCCCCCCCeeecCCCchhhhccCC
Q 022183 244 SHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGT 299 (301)
Q Consensus 244 ~~I~~~~~vas~~gl~~l~~~~p~v~i~t~~iD~~l~~~~~ivPGlGd~GdR~fgt 299 (301)
++|+++|++||++|++++.++||+++||||+||++||+++||+|||||||||||||
T Consensus 168 ~~I~~v~~iaa~~Gi~~l~~~~P~v~i~ta~ID~~Ln~~~yIvPGlGDaGDR~fGT 223 (224)
T d1bd3a_ 168 ERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT 223 (224)
T ss_dssp GGEEEEEEEECHHHHHHHHHHCTTCEEEEEEECSEECTTSCEESCCSCHHHHHHTC
T ss_pred ceEEEEEEEecHHHHHHHHHHCcCCEEEEEEECcccCCCCccCCCCCcHHHhhcCC
Confidence 99999999999999999999999999999999999999999999999999999998
|
| >d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} | Back information, alignment and structure |
|---|
| >d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} | Back information, alignment and structure |
|---|
| >d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} | Back information, alignment and structure |
|---|
| >d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} | Back information, alignment and structure |
|---|
| >d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} | Back information, alignment and structure |
|---|
| >d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|