Citrus Sinensis ID: 022560

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----

MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVGKFRADGDQKEYAKQKLQLGSFPTILFFPKHSSKPIKYPSERRDVDSLMAFVDALR

ccccHHHHHHHHHHccccccccccHHHHccccccHHHHHHHccccEEEEccccccccccccccccEEEcccccccccccccEEEEEccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccHHHHHHHcccccccccHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHcccccccEEEEEccccccccccccccccHHHHHHHHHHHc

ccccHHHHHHHHHHccccHHHHHHHHHHHcccEccHHHHHHccccEEEEccccccccccHccccEEEEcccccccccccccEEEEcccccccHHHHHHHHHHccccccHHHHcccccccccccccccccccccccccEEEccccccccccccccccHHHHHccccccccccccccHHHHcccccEEEccHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcccccccEEEEEcccccccEEcccccccHHHHHHHHHHHc

MFPDAVEVQALVRSKglfsfyedghqeccrvrkvRPLRRALKGLRAWitgqrkdqspgtrseipvvqvdpvfegleggvgslvkwnpvanvkgndiwnflrtmdvpinslhsqgyisigcepctrpvlpgqheregrwwwedakakecglhkgnikqedaavngngngagnaSEAVADIFNSQNLVTLNRTGMENLarldhrqepwLVVLYAPWCQFCQAMEGSYVELADKlagngvkvgkfradgdQKEYAKQklqlgsfptilffpkhsskpikypserrdvDSLMAFVDALR

MFPDAVEVQALVRSkglfsfyedghqeccrvrkvrplrralkglrawitgqrkdqspgtrseipvvQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVGKFRADGDQKEYAKQklqlgsfptilffpkhsskpikypserrdvDSLMAFVDALR

MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDaavngngngagnaSEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVGKFRADGDQKEYAKQKLQLGSFPTILFFPKHSSKPIKYPSERRDVDSLMAFVDALR

******EVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITG************IPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNI*******************AVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVGKFRADGDQKEYAKQKLQLGSFPTILFFP***************************

MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHK***************************FNSQNLVTLNRTGME*LARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVGKFRADGDQKEYAKQKLQLGSFPTILFFPKH************DVDSLMAFVDALR

MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITG***********EIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVGKFRADGDQKEYAKQKLQLGSFPTILFFPKHSSKPIKYPSERRDVDSLMAFVDALR

MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKG*IK*E****************AVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVGKFRADGDQKEYAKQKLQLGSFPTILFFPKHSSKPIKYPSERRDVDSLMAFVDALR

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		295	2.2.26 [Sep-21-2011]
P92980		458	5'-adenylylsulfate reduct	yes	no	0.989	0.637	0.796	1e-146
P92979		465	5'-adenylylsulfate reduct	no	no	0.979	0.621	0.804	1e-145
P92981		454	5'-adenylylsulfate reduct	no	no	0.976	0.634	0.793	1e-142
Q6Z4A7		475	Probable 5'-adenylylsulfa	yes	no	1.0	0.621	0.747	1e-127
O05927		267	Phosphoadenosine phosphos	yes	no	0.515	0.569	0.580	1e-53
Q02KP7		267	Phosphoadenosine phosphos	yes	no	0.515	0.569	0.580	1e-53
B7VBC3		267	Phosphoadenosine phosphos	yes	no	0.515	0.569	0.580	1e-53
Q9JUD5		244	Phosphoadenosine phosphos	yes	no	0.447	0.540	0.489	1e-34
Q9JRT1		246	Phosphoadenosine phosphos	yes	no	0.447	0.536	0.482	1e-33
P56891		265	Phosphoadenosine phosphos	yes	no	0.477	0.532	0.447	4e-31

>sp\|P92980\|APR3_ARATH 5'-adenylylsulfate reductase 3, chloroplastic OS=Arabidopsis thaliana GN=APR3 PE=2 SV=2	Back alignment and function desciption

 Score =  516 bits (1329), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 235/295 (79%), Positives = 269/295 (91%), Gaps = 3/295 (1%)

Query: 1   MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTR 60
           MFPDAVEVQALVR+KGLFSFYEDGHQECCR+RKVRPLRRALKGLRAWITGQRKDQSPGTR
Sbjct: 167 MFPDAVEVQALVRNKGLFSFYEDGHQECCRIRKVRPLRRALKGLRAWITGQRKDQSPGTR 226

Query: 61  SEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGC 120
           SEIPVVQVDPVFEGL+GGVGSLVKWNPVANV+GND+WNFLRTMDVP+N+LH+ GY+SIGC
Sbjct: 227 SEIPVVQVDPVFEGLDGGVGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYVSIGC 286

Query: 121 EPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIF 180
           EPCTR VLPGQHEREGRWWWEDAKAKECGLHKGNIK+     NGN     N + +VADIF
Sbjct: 287 EPCTRAVLPGQHEREGRWWWEDAKAKECGLHKGNIKEN---TNGNATANVNGTASVADIF 343

Query: 181 NSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVG 240
           NS+N+V L+R G+ENL +L++R+E W+VVLYAPWC FCQAME S+ ELADKL G+GVKV 
Sbjct: 344 NSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADKLGGSGVKVA 403

Query: 241 KFRADGDQKEYAKQKLQLGSFPTILFFPKHSSKPIKYPSERRDVDSLMAFVDALR 295
           KFRADGDQK++AK++LQLGSFPTIL FPK+SS+PIKYPSE+RDVDSL +F++ +R
Sbjct: 404 KFRADGDQKDFAKKELQLGSFPTILVFPKNSSRPIKYPSEKRDVDSLTSFLNLVR 458

Reduces sulfate for Cys biosynthesis. Substrate preference is adenosine-5'-phosphosulfate (APS) >> 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Uses glutathione or DTT as source of protons.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 8EC: .EC: 4EC: .EC: 9

>sp\|P92979\|APR1_ARATH 5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=APR1 PE=1 SV=2	Back alignment and function description

>sp\|P92981\|APR2_ARATH 5'-adenylylsulfate reductase 2, chloroplastic OS=Arabidopsis thaliana GN=APR2 PE=1 SV=2	Back alignment and function description

>sp\|Q6Z4A7\|APR1_ORYSJ Probable 5'-adenylylsulfate reductase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=APR1 PE=2 SV=1	Back alignment and function description

>sp\|O05927\|CYSH_PSEAE Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysH PE=1 SV=2	Back alignment and function description

>sp\|Q02KP7\|CYSH_PSEAB Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysH PE=3 SV=1	Back alignment and function description

>sp\|B7VBC3\|CYSH_PSEA8 Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysH PE=3 SV=1	Back alignment and function description

>sp\|Q9JUD5\|CYSH_NEIMA Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysH PE=3 SV=1	Back alignment and function description

>sp\|Q9JRT1\|CYSH_NEIMB Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysH1 PE=3 SV=1	Back alignment and function description

>sp\|P56891\|CYSH_RHIME Phosphoadenosine phosphosulfate reductase OS=Rhizobium meliloti (strain 1021) GN=cysH PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		295
351727060		470	adenosine 5'-phosphosulfate reductase [G	1.0	0.627	0.858	1e-153
359483358		460	PREDICTED: 5'-adenylylsulfate reductase	0.993	0.636	0.850	1e-153
359483360		454	PREDICTED: 5'-adenylylsulfate reductase	0.993	0.645	0.850	1e-153
255554863		471	5'-adenylylsulfate reductase 1, chloropl	1.0	0.626	0.838	1e-151
356555676		472	PREDICTED: 5'-adenylylsulfate reductase	1.0	0.625	0.847	1e-151
449488336		461	PREDICTED: 5'-adenylylsulfate reductase	0.989	0.633	0.847	1e-149
449454750		461	PREDICTED: 5'-adenylylsulfate reductase	0.989	0.633	0.844	1e-149
12831474		464	PAPS-reductase-like protein [Catharanthu	1.0	0.635	0.840	1e-148
449479487		463	PREDICTED: 5'-adenylylsulfate reductase	0.986	0.628	0.837	1e-148
350538397		461	adenylyl-sulfate reductase [Solanum lyco	0.986	0.631	0.823	1e-147

>gi\|351727060\|ref\|NP_001235612.1\| adenosine 5'-phosphosulfate reductase [Glycine max] gi\|18252504\|gb\|AAL66290.1\|AF452450_1 adenosine 5'-phosphosulfate reductase [Glycine max]	Back alignment and taxonomy information

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 254/296 (85%), Positives = 280/296 (94%), Gaps = 1/296 (0%)

Query: 1   MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTR 60
           MFPDAVEVQALVR+KGLFSFYEDGHQECCRVRKVRPLRRALKGL+AWITGQRKDQSPGTR
Sbjct: 175 MFPDAVEVQALVRTKGLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTR 234

Query: 61  SEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGC 120
           SEIPVVQVDPVFEGL+GG+GSLVKWNPVANV G DIW+FLRTMDVP+NSLHSQGY+SIGC
Sbjct: 235 SEIPVVQVDPVFEGLDGGIGSLVKWNPVANVNGLDIWSFLRTMDVPVNSLHSQGYVSIGC 294

Query: 121 EPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAA-VNGNGNGAGNASEAVADI 179
           EPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIK EDAA +NGNG    N S  VADI
Sbjct: 295 EPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKHEDAAQLNGNGASQANGSATVADI 354

Query: 180 FNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKV 239
           FNSQ++V+L+R+G+ENLA+L++R+EPWLVVLYAPWC+FCQAME SYV+LA+KLAG+GVKV
Sbjct: 355 FNSQDVVSLSRSGIENLAKLENRKEPWLVVLYAPWCRFCQAMEESYVDLAEKLAGSGVKV 414

Query: 240 GKFRADGDQKEYAKQKLQLGSFPTILFFPKHSSKPIKYPSERRDVDSLMAFVDALR 295
            KFRADGDQKEYAK +LQLGSFPTIL FPKHSS+PIKYPSE+RDVDSL AFV+ALR
Sbjct: 415 AKFRADGDQKEYAKTELQLGSFPTILLFPKHSSQPIKYPSEKRDVDSLTAFVNALR 470

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359483358\|ref\|XP_003632943.1\| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like isoform 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359483360\|ref\|XP_003632944.1\| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255554863\|ref\|XP_002518469.1\| 5'-adenylylsulfate reductase 1, chloroplast precursor, putative [Ricinus communis] gi\|223542314\|gb\|EEF43856.1\| 5'-adenylylsulfate reductase 1, chloroplast precursor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356555676\|ref\|XP_003546156.1\| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|449488336\|ref\|XP_004158005.1\| PREDICTED: 5'-adenylylsulfate reductase 1, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449454750\|ref\|XP_004145117.1\| PREDICTED: 5'-adenylylsulfate reductase 1, chloroplastic-like [Cucumis sativus] gi\|449471157\|ref\|XP_004153225.1\| PREDICTED: 5'-adenylylsulfate reductase 1, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|12831474\|gb\|AAB05871.2\| PAPS-reductase-like protein [Catharanthus roseus]	Back alignment and taxonomy information

>gi\|449479487\|ref\|XP_004155612.1\| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|350538397\|ref\|NP_001233829.1\| adenylyl-sulfate reductase [Solanum lycopersicum] gi\|51457940\|gb\|AAU03359.1\| adenylyl-sulfate reductase [Solanum lycopersicum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		295
TAIR\|locus:2125786		465	APR1 "APS reductase 1" [Arabid	0.986	0.625	0.793	7.1e-132
TAIR\|locus:2120628		458	APR3 "APS reductase 3" [Arabid	0.989	0.637	0.783	1.3e-130
TAIR\|locus:2018097		454	APR2 "5'adenylylphosphosulfate	0.976	0.634	0.786	4.5e-130
TIGR_CMR\|GSU_1716		235	GSU_1716 "phosphoadenosine pho	0.484	0.608	0.464	1.5e-33
UNIPROTKB\|P65668		254	cysH "Probable phosphoadenosin	0.406	0.472	0.416	1e-20
TIGR_CMR\|SPO_2635		253	SPO_2635 "phosophoadenylyl-sul	0.383	0.446	0.411	4.4e-20
TIGR_CMR\|BA_1440		226	BA_1440 "phosphoadenosine phos	0.403	0.526	0.386	1.5e-19
POMBASE\|SPAC13G7.06		266	met16 "phosphoadenosine phosph	0.359	0.398	0.388	1.6e-13
SGD\|S000006371		261	MET16 "3'-phosphoadenylsulfate	0.471	0.532	0.358	3.6e-13
CGD\|CAL0002221		252	MET16 [Candida albicans (taxid	0.362	0.424	0.401	4.5e-11

TAIR\|locus:2125786 APR1 "APS reductase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1293 (460.2 bits), Expect = 7.1e-132, P = 7.1e-132
 Identities = 234/295 (79%), Positives = 265/295 (89%)

Query:     1 MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTR 60
             MFPD+VEVQ LVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGL+AWITGQRKDQSPGTR
Sbjct:   175 MFPDSVEVQGLVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTR 234

Query:    61 SEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGC 120
             SEIPVVQVDPVFEGL+GGVGSLVKWNPVANV+GND+WNFLRTMDVP+N+LH+ GYISIGC
Sbjct:   235 SEIPVVQVDPVFEGLDGGVGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYISIGC 294

Query:   121 EPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDXXXXXXXXXXXXXSEAVADIF 180
             EPCT+ VLPGQHEREGRWWWEDAKAKECGLHKGN+K+                 AVADIF
Sbjct:   295 EPCTKAVLPGQHEREGRWWWEDAKAKECGLHKGNVKENSDDAKVNGES----KSAVADIF 350

Query:   181 NSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVG 240
              S+NLVTL+R G+ENL +L++R+EPW+VVLYAPWC FCQAME SY ELADKLAG+G+KV 
Sbjct:   351 KSENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLAGSGIKVA 410

Query:   241 KFRADGDQKEYAKQKLQLGSFPTILFFPKHSSKPIKYPSERRDVDSLMAFVDALR 295
             KFRADGDQKE+AKQ+LQLGSFPTIL FPK+SS+PIKYPSE+RDV+SL +F++ +R
Sbjct:   411 KFRADGDQKEFAKQELQLGSFPTILVFPKNSSRPIKYPSEKRDVESLTSFLNLVR 465

GO:0003824 "catalytic activity" evidence=IEA

GO:0008152 "metabolic process" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM;ISS

GO:0016671 "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor" evidence=IEA

GO:0019419 "sulfate reduction" evidence=IEA;IDA

GO:0045454 "cell redox homeostasis" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009973 "adenylyl-sulfate reductase activity" evidence=IDA

GO:0009536 "plastid" evidence=TAS

GO:0009534 "chloroplast thylakoid" evidence=IDA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA

GO:0019344 "cysteine biosynthetic process" evidence=RCA

GO:0019761 "glucosinolate biosynthetic process" evidence=RCA

GO:0000103 "sulfate assimilation" evidence=IGI;IDA

TAIR\|locus:2120628 APR3 "APS reductase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2018097 APR2 "5'adenylylphosphosulfate reductase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_1716 GSU_1716 "phosphoadenosine phosphosulfate reductase, putative" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

UNIPROTKB\|P65668 cysH "Probable phosphoadenosine phosphosulfate reductase" [Mycobacterium tuberculosis (taxid:1773)]	Back alignment and assigned GO terms

TIGR_CMR\|SPO_2635 SPO_2635 "phosophoadenylyl-sulfate reductase" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_1440 BA_1440 "phosphoadenosine phosphosulfate reductase" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

POMBASE\|SPAC13G7.06 met16 "phosphoadenosine phosphosulfate reductase" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

SGD\|S000006371 MET16 "3'-phosphoadenylsulfate reductase" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

CGD\|CAL0002221 MET16 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P92980	APR3_ARATH	1, ., 8, ., 4, ., 9	0.7966	0.9898	0.6375	yes	no
Q6Z4A7	APR1_ORYSJ	1, ., 8, ., 4, ., 9	0.7475	1.0	0.6210	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.8.4	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00025889001	SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (435 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00024596001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (668 aa)	•		•	•	•	•	0.971
	GSVIVG00036600001	SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (595 aa)	•		•		•	•	0.933
	GSVIVG00008868001	SubName- Full=Chromosome chr13 scaffold_210, whole genome shotgun sequence; (278 aa)	•					•	0.908
	GSVIVG00014451001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (483 aa)	•				•	•	0.856
	GSVIVG00019663001	RecName- Full=Adenylyl-sulfate kinase; EC=2.7.1.25;; Catalyzes the synthesis of activated sulfa [...] (202 aa)	•	•			•	•	0.849
	GSVIVG00020070001	SubName- Full=Putative uncharacterized protein (Chromosome chr5 scaffold_2, whole genome shotgu [...] (467 aa)	•				•	•	0.846
	GSVIVG00012057001	RecName- Full=Adenylyl-sulfate kinase; EC=2.7.1.25;; Catalyzes the synthesis of activated sulfa [...] (161 aa)	•	•			•	•	0.817
	GSVIVG00025471001	RecName- Full=Adenylyl-sulfate kinase; EC=2.7.1.25;; Catalyzes the synthesis of activated sulfa [...] (214 aa)	•	•			•	•	0.784
	GSVIVG00024496001	RecName- Full=Elongation factor 1-alpha;; This protein promotes the GTP-dependent binding of am [...] (447 aa)	•				•	•	0.674
	GSVIVG00024491001	RecName- Full=Elongation factor 1-alpha; (447 aa)	•				•	•	0.674

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		295
PLN02309		457	PLN02309, PLN02309, 5'-adenylylsulfate reductase	0.0
TIGR00424		463	TIGR00424, APS_reduc, 5'-adenylylsulfate reductase	0.0
TIGR02055		191	TIGR02055, APS_reductase, thioredoxin-dependent ad	1e-64
PRK02090		241	PRK02090, PRK02090, phosphoadenosine phosphosulfat	3e-64
cd02993		109	cd02993, PDI_a_APS_reductase, PDIa family, 5'-Aden	4e-62
COG0175		261	COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfa	7e-44
pfam01507		173	pfam01507, PAPS_reduct, Phosphoadenosine phosphosu	2e-38
TIGR00434		212	TIGR00434, cysH, phosophoadenylyl-sulfate reductas	1e-35
cd01713		173	cd01713, PAPS_reductase, This domain is found in p	2e-30
TIGR02057		226	TIGR02057, PAPS_reductase, phosphoadenosine phosph	7e-28
cd02961		101	cd02961, PDI_a_family, Protein Disulfide Isomerase	9e-22
cd02998		105	cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret	2e-18
cd02995		104	cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal T	4e-16
cd03004		104	cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER	1e-15
TIGR01126		102	TIGR01126, pdi_dom, protein disulfide-isomerase do	4e-15
TIGR01130		462	TIGR01130, ER_PDI_fam, protein disulfide isomerase	2e-13
pfam00085		104	pfam00085, Thioredoxin, Thioredoxin	3e-12
cd03001		103	cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp	7e-12
PTZ00102		477	PTZ00102, PTZ00102, disulphide isomerase; Provisio	3e-11
PTZ00443		224	PTZ00443, PTZ00443, Thioredoxin domain-containing	3e-08
cd03005		102	cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret	1e-07
PTZ00102		477	PTZ00102, PTZ00102, disulphide isomerase; Provisio	2e-07
cd03000		104	cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily;	2e-07
cd02997		104	cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily;	3e-06
TIGR01130		462	TIGR01130, ER_PDI_fam, protein disulfide isomerase	4e-06
cd03002		109	cd03002, PDI_a_MPD1_like, PDI family, MPD1-like su	4e-06
cd02947		93	cd02947, TRX_family, TRX family; composed of two g	3e-05
cd01659		69	cd01659, TRX_superfamily, Thioredoxin (TRX) superf	7e-05
cd03003		101	cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ER	1e-04
TIGR01068		101	TIGR01068, thioredoxin, thioredoxin	1e-04
cd02994		101	cd02994, PDI_a_TMX, PDIa family, TMX subfamily; co	2e-04
COG0526		127	COG0526, TrxA, Thiol-disulfide isomerase and thior	0.001

>gnl\|CDD\|215175 PLN02309, PLN02309, 5'-adenylylsulfate reductase	Back alignment and domain information

 Score =  612 bits (1580), Expect = 0.0
 Identities = 244/295 (82%), Positives = 274/295 (92%), Gaps = 5/295 (1%)

Query: 1   MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTR 60
           MFPDAVEVQALVR+KGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTR
Sbjct: 168 MFPDAVEVQALVRNKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTR 227

Query: 61  SEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGC 120
           +E+PVVQVDPVFEGL+GG GSLVKWNP+ANV GN++WNFLRTMDVP+NSLH+QGY+SIGC
Sbjct: 228 AEVPVVQVDPVFEGLDGGPGSLVKWNPLANVTGNEVWNFLRTMDVPVNSLHAQGYVSIGC 287

Query: 121 EPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIF 180
           EPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIK+ED     NG    N + AVADIF
Sbjct: 288 EPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKEED-----NGAANDNGNAAVADIF 342

Query: 181 NSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVG 240
           NSQN+V L+R G+ENL +L++R+EPWLVVLYAPWC FCQAME SY ELA+KLAG+GVKV 
Sbjct: 343 NSQNVVALSRAGIENLLKLENRKEPWLVVLYAPWCPFCQAMEASYEELAEKLAGSGVKVA 402

Query: 241 KFRADGDQKEYAKQKLQLGSFPTILFFPKHSSKPIKYPSERRDVDSLMAFVDALR 295
           KFRADGDQKE+AKQ+LQLGSFPTIL FPK+SS+PIKYPSE+RDVDSL++FV++LR
Sbjct: 403 KFRADGDQKEFAKQELQLGSFPTILLFPKNSSRPIKYPSEKRDVDSLLSFVNSLR 457

Length = 457

>gnl\|CDD\|232970 TIGR00424, APS_reduc, 5'-adenylylsulfate reductase, thioredoxin-independent	Back alignment and domain information

>gnl\|CDD\|233701 TIGR02055, APS_reductase, thioredoxin-dependent adenylylsulfate APS reductase	Back alignment and domain information

>gnl\|CDD\|234997 PRK02090, PRK02090, phosphoadenosine phosphosulfate reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|239291 cd02993, PDI_a_APS_reductase, PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases	Back alignment and domain information

>gnl\|CDD\|223253 COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|201832 pfam01507, PAPS_reduct, Phosphoadenosine phosphosulfate reductase family	Back alignment and domain information

>gnl\|CDD\|129526 TIGR00434, cysH, phosophoadenylyl-sulfate reductase (thioredoxin)	Back alignment and domain information

>gnl\|CDD\|238846 cd01713, PAPS_reductase, This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase	Back alignment and domain information

>gnl\|CDD\|131112 TIGR02057, PAPS_reductase, phosphoadenosine phosphosulfate reductase, thioredoxin dependent	Back alignment and domain information

>gnl\|CDD\|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>gnl\|CDD\|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5	Back alignment and domain information

>gnl\|CDD\|239293 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1	Back alignment and domain information

>gnl\|CDD\|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>gnl\|CDD\|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain	Back alignment and domain information

>gnl\|CDD\|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic	Back alignment and domain information

>gnl\|CDD\|215704 pfam00085, Thioredoxin, Thioredoxin	Back alignment and domain information

>gnl\|CDD\|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain)	Back alignment and domain information

>gnl\|CDD\|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional	Back alignment and domain information

>gnl\|CDD\|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional	Back alignment and domain information

>gnl\|CDD\|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains	Back alignment and domain information

>gnl\|CDD\|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional	Back alignment and domain information

>gnl\|CDD\|239298 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus	Back alignment and domain information

>gnl\|CDD\|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related)	Back alignment and domain information

>gnl\|CDD\|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic	Back alignment and domain information

>gnl\|CDD\|239300 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein	Back alignment and domain information

>gnl\|CDD\|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains	Back alignment and domain information

>gnl\|CDD\|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold	Back alignment and domain information

>gnl\|CDD\|239301 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>gnl\|CDD\|200072 TIGR01068, thioredoxin, thioredoxin	Back alignment and domain information

>gnl\|CDD\|239292 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX	Back alignment and domain information

>gnl\|CDD\|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		295
PLN02309		457	5'-adenylylsulfate reductase	100.0
TIGR00424		463	APS_reduc 5'-adenylylsulfate reductase, thioredoxi	100.0
KOG0189		261	consensus Phosphoadenosine phosphosulfate reductas	100.0
TIGR02057		226	PAPS_reductase phosphoadenosine phosphosulfate red	100.0
TIGR02055		191	APS_reductase thioredoxin-dependent adenylylsulfat	100.0
TIGR00434		212	cysH phosophoadenylyl-sulfate reductase (thioredox	100.0
COG0175		261	CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotr	100.0
PRK02090		241	phosphoadenosine phosphosulfate reductase; Provisi	100.0
PRK12563		312	sulfate adenylyltransferase subunit 2; Provisional	99.96
TIGR02039		294	CysD sulfate adenylyltransferase, small subunit. I	99.94
PRK05253		301	sulfate adenylyltransferase subunit 2; Provisional	99.92
PRK08557		417	hypothetical protein; Provisional	99.91
PF01507		174	PAPS_reduct: Phosphoadenosine phosphosulfate reduc	99.91
PRK13794		479	hypothetical protein; Provisional	99.9
cd03006		113	PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil	99.89
PRK13795		636	hypothetical protein; Provisional	99.87
cd03003		101	PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam	99.87
cd03004		104	PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam	99.86
cd02996		108	PDI_a_ERp44 PDIa family, endoplasmic reticulum pro	99.86
KOG0910		150	consensus Thioredoxin-like protein [Posttranslatio	99.85
cd02993		109	PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat	99.85
PF00085		103	Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio	99.85
PRK08576		438	hypothetical protein; Provisional	99.85
cd03065		120	PDI_b_Calsequestrin_N PDIb family, Calsequestrin s	99.84
cd02994		101	PDI_a_TMX PDIa family, TMX subfamily; composed of	99.84
cd02963		111	TRX_DnaJ TRX domain, DnaJ domain containing protei	99.83
cd03002		109	PDI_a_MPD1_like PDI family, MPD1-like subfamily; c	99.82
COG3118		304	Thioredoxin domain-containing protein [Posttransla	99.82
cd03001		103	PDI_a_P5 PDIa family, P5 subfamily; composed of eu	99.81
cd02999		100	PDI_a_ERp44_like PDIa family, endoplasmic reticulu	99.81
cd03005		102	PDI_a_ERp46 PDIa family, endoplasmic reticulum pro	99.81
PRK10996		139	thioredoxin 2; Provisional	99.8
cd02954		114	DIM1 Dim1 family; Dim1 is also referred to as U5 s	99.8
PHA02278		103	thioredoxin-like protein	99.8
cd02956		96	ybbN ybbN protein family; ybbN is a hypothetical p	99.8
PRK09381		109	trxA thioredoxin; Provisional	99.8
PTZ00443		224	Thioredoxin domain-containing protein; Provisional	99.8
cd02948		102	TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus	99.79
cd02995		104	PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain	99.78
cd02985		103	TRX_CDSP32 TRX family, chloroplastic drought-induc	99.78
cd02998		105	PDI_a_ERp38 PDIa family, endoplasmic reticulum pro	99.78
cd02997		104	PDI_a_PDIR PDIa family, PDIR subfamily; composed o	99.78
KOG0907		106	consensus Thioredoxin [Posttranslational modificat	99.78
cd02962		152	TMX2 TMX2 family; composed of proteins similar to	99.78
TIGR01126		102	pdi_dom protein disulfide-isomerase domain. This m	99.77
KOG0190		493	consensus Protein disulfide isomerase (prolyl 4-hy	99.76
cd03000		104	PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o	99.76
cd03007		116	PDI_a_ERp29_N PDIa family, endoplasmic reticulum p	99.75
cd02965		111	HyaE HyaE family; HyaE is also called HupG and Hox	99.75
cd02957		113	Phd_like Phosducin (Phd)-like family; composed of	99.75
cd02961		101	PDI_a_family Protein Disulfide Isomerase (PDIa) fa	99.74
cd02989		113	Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior	99.74
PLN00410		142	U5 snRNP protein, DIM1 family; Provisional	99.73
cd02986		114	DLP Dim1 family, Dim1-like protein (DLP) subfamily	99.73
TIGR01068		101	thioredoxin thioredoxin. Several proteins, such as	99.72
cd02953		104	DsbDgamma DsbD gamma family; DsbD gamma is the C-t	99.72
KOG0190		493	consensus Protein disulfide isomerase (prolyl 4-hy	99.72
cd02950		142	TxlA TRX-like protein A (TxlA) family; TxlA was or	99.71
cd01713		173	PAPS_reductase This domain is found in phosphoaden	99.71
cd02992		114	PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas	99.71
cd02984		97	TRX_PICOT TRX domain, PICOT (for PKC-interacting c	99.7
cd02987		175	Phd_like_Phd Phosducin (Phd)-like family, Phd subf	99.69
PTZ00051		98	thioredoxin; Provisional	99.68
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	99.67
PTZ00102		477	disulphide isomerase; Provisional	99.67
PTZ00102		477	disulphide isomerase; Provisional	99.66
cd02949		97	TRX_NTR TRX domain, novel NADPH thioredoxin reduct	99.66
cd02951		125	SoxW SoxW family; SoxW is a bacterial periplasmic	99.64
cd02975		113	PfPDO_like_N Pyrococcus furiosus protein disulfide	99.64
TIGR01295		122	PedC_BrcD bacteriocin transport accessory protein,	99.63
cd02988		192	Phd_like_VIAF Phosducin (Phd)-like family, Viral i	99.62
KOG0908		288	consensus Thioredoxin-like protein [Posttranslatio	99.62
KOG4277		468	consensus Uncharacterized conserved protein, conta	99.6
cd02947		93	TRX_family TRX family; composed of two groups: Gro	99.59
KOG0912		375	consensus Thiol-disulfide isomerase and thioredoxi	99.58
cd02952		119	TRP14_like Human TRX-related protein 14 (TRP14)-li	99.57
cd02982		103	PDI_b'_family Protein Disulfide Isomerase (PDIb')	99.56
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	99.54
TIGR00411		82	redox_disulf_1 small redox-active disulfide protei	99.48
cd02959		117	ERp19 Endoplasmic reticulum protein 19 (ERp19) fam	99.46
TIGR03183		447	DNA_S_dndC putative sulfurtransferase DndC. Member	99.46
PRK06850		507	hypothetical protein; Provisional	99.42
PTZ00062		204	glutaredoxin; Provisional	99.41
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	99.41
PRK00293		571	dipZ thiol:disulfide interchange protein precursor	99.4
KOG0191		383	consensus Thioredoxin/protein disulfide isomerase	99.39
PRK03147		173	thiol-disulfide oxidoreductase; Provisional	99.38
cd02955		124	SSP411 TRX domain, SSP411 protein family; members	99.38
PRK14018		521	trifunctional thioredoxin/methionine sulfoxide red	99.35
KOG0191		383	consensus Thioredoxin/protein disulfide isomerase	99.32
PHA02125		75	thioredoxin-like protein	99.31
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	99.31
TIGR02738		153	TrbB type-F conjugative transfer system pilin asse	99.31
TIGR00412		76	redox_disulf_2 small redox-active disulfide protei	99.3
PF13098		112	Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_	99.3
TIGR02740		271	TraF-like TraF-like protein. This protein is relat	99.29
KOG1731		606	consensus FAD-dependent sulfhydryl oxidase/quiesci	99.29
cd03008		146	TryX_like_RdCVF Tryparedoxin (TryX)-like family, R	99.27
PRK15412		185	thiol:disulfide interchange protein DsbE; Provisio	99.25
cd02964		132	TryX_like_family Tryparedoxin (TryX)-like family;	99.24
PF13905		95	Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_	99.24
cd03009		131	TryX_like_TryX_NRX Tryparedoxin (TryX)-like family	99.23
cd03010		127	TlpA_like_DsbE TlpA-like family, DsbE (also known	99.22
TIGR00385		173	dsbE periplasmic protein thiol:disulfide oxidoredu	99.2
KOG2644		282	consensus 3'-phosphoadenosine 5'-phosphosulfate su	99.18
cd02973		67	TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-	99.17
cd02958		114	UAS UAS family; UAS is a domain of unknown functio	99.16
cd03011		123	TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso	99.16
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	99.13
cd02966		116	TlpA_like_family TlpA-like family; composed of Tlp	99.12
cd03012		126	TlpA_like_DipZ_like TlpA-like family, DipZ-like su	99.07
cd02967		114	mauD Methylamine utilization (mau) D family; mauD	99.06
COG4232		569	Thiol:disulfide interchange protein [Posttranslati	99.05
cd03026		89	AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid	99.04
PRK11509		132	hydrogenase-1 operon protein HyaE; Provisional	99.03
PRK13728		181	conjugal transfer protein TrbB; Provisional	99.02
cd02960		130	AGR Anterior Gradient (AGR) family; members of thi	99.02
PF08534		146	Redoxin: Redoxin; InterPro: IPR013740 This redoxin	99.02
PF13899		82	Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_	99.0
TIGR02661		189	MauD methylamine dehydrogenase accessory protein M	99.0
smart00594		122	UAS UAS domain.	98.99
PTZ00056		199	glutathione peroxidase; Provisional	98.97
PLN02399		236	phospholipid hydroperoxide glutathione peroxidase	98.96
KOG0913		248	consensus Thiol-disulfide isomerase and thioredoxi	98.95
PLN02412		167	probable glutathione peroxidase	98.89
COG3969		407	Predicted phosphoadenosine phosphosulfate sulfotra	98.87
TIGR02540		153	gpx7 putative glutathione peroxidase Gpx7. This mo	98.87
KOG0914		265	consensus Thioredoxin-like protein [Posttranslatio	98.83
cd02969		171	PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot	98.8
PF02114		265	Phosducin: Phosducin; InterPro: IPR024253 The oute	98.8
TIGR01626		184	ytfJ_HI0045 conserved hypothetical protein YtfJ-fa	98.77
cd00340		152	GSH_Peroxidase Glutathione (GSH) peroxidase family	98.77
COG0526		127	TrxA Thiol-disulfide isomerase and thioredoxins [P	98.7
cd03017		140	PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit	98.65
TIGR02196		74	GlrX_YruB Glutaredoxin-like protein, YruB-family.	98.63
PTZ00256		183	glutathione peroxidase; Provisional	98.57
TIGR03137		187	AhpC peroxiredoxin. This gene contains two invaria	98.56
PF00578		124	AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per	98.55
PF13728		215	TraF: F plasmid transfer operon protein	98.55
cd01659		69	TRX_superfamily Thioredoxin (TRX) superfamily; a l	98.55
cd03015		173	PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-	98.55
PF01216		383	Calsequestrin: Calsequestrin; InterPro: IPR001393	98.54
COG2143		182	Thioredoxin-related protein [Posttranslational mod	98.51
KOG2501		157	consensus Thioredoxin, nucleoredoxin and related p	98.5
PRK09437		154	bcp thioredoxin-dependent thiol peroxidase; Review	98.49
TIGR02200		77	GlrX_actino Glutaredoxin-like protein. This family	98.47
PRK10382		187	alkyl hydroperoxide reductase subunit C; Provision	98.43
cd02970		149	PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot	98.41
KOG1672		211	consensus ATP binding protein [Posttranslational m	98.4
PRK00522		167	tpx lipid hydroperoxide peroxidase; Provisional	98.39
PF13848		184	Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_	98.38
PRK13190		202	putative peroxiredoxin; Provisional	98.37
cd03018		149	PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik	98.36
PF06110		119	DUF953: Eukaryotic protein of unknown function (DU	98.35
PRK15000		200	peroxidase; Provisional	98.35
KOG3425		128	consensus Uncharacterized conserved protein [Funct	98.34
PF03190		163	Thioredox_DsbH: Protein of unknown function, DUF25	98.29
cd02991		116	UAS_ETEA UAS family, ETEA subfamily; composed of p	98.28
TIGR02739		256	TraF type-F conjugative transfer system pilin asse	98.26
PF14595		129	Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A.	98.26
cd03014		143	PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical	98.24
PTZ00137		261	2-Cys peroxiredoxin; Provisional	98.2
TIGR02180		84	GRX_euk Glutaredoxin. This model represents eukary	98.2
PRK13703		248	conjugal pilus assembly protein TraF; Provisional	98.18
PF07912		126	ERp29_N: ERp29, N-terminal domain; InterPro: IPR01	98.17
KOG2603		331	consensus Oligosaccharyltransferase, gamma subunit	98.17
cd02971		140	PRX_family Peroxiredoxin (PRX) family; composed of	98.16
cd03016		203	PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub	98.16
PRK13191		215	putative peroxiredoxin; Provisional	98.09
PRK13189		222	peroxiredoxin; Provisional	98.08
cd03072		111	PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second	98.08
cd02968		142	SCO SCO (an acronym for Synthesis of Cytochrome c	98.06
PRK13599		215	putative peroxiredoxin; Provisional	98.06
KOG3414		142	consensus Component of the U4/U6.U5 snRNP/mitosis	98.05
PF13192		76	Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY	98.04
cd02981		97	PDI_b_family Protein Disulfide Isomerase (PDIb) fa	97.96
cd02983		130	P5_C P5 family, C-terminal redox inactive TRX-like	97.95
PTZ00253		199	tryparedoxin peroxidase; Provisional	97.92
KOG0911		227	consensus Glutaredoxin-related protein [Posttransl	97.88
cd02976		73	NrdH NrdH-redoxin (NrdH) family; NrdH is a small m	97.87
PRK11200		85	grxA glutaredoxin 1; Provisional	97.86
PRK10606		183	btuE putative glutathione peroxidase; Provisional	97.85
cd03073		111	PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s	97.84
PRK10877		232	protein disulfide isomerase II DsbC; Provisional	97.79
KOG3170		240	consensus Conserved phosducin-like protein [Signal	97.71
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	97.71
PF02966		133	DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th	97.67
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	97.67
KOG3171		273	consensus Conserved phosducin-like protein [Signal	97.59
PF00462		60	Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl	97.54
TIGR02183		86	GRXA Glutaredoxin, GrxA family. This model include	97.51
cd03419		82	GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h	97.48
cd03020		197	DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil	97.37
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	97.34
PF11009		105	DUF2847: Protein of unknown function (DUF2847); In	97.27
cd02066		72	GRX_family Glutaredoxin (GRX) family; composed of	97.21
PF13462		162	Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV	97.19
PRK10329		81	glutaredoxin-like protein; Provisional	97.16
TIGR02194		72	GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red	97.15
PF05768		81	DUF836: Glutaredoxin-like domain (DUF836); InterPr	97.14
TIGR02190		79	GlrX-dom Glutaredoxin-family domain. This C-termin	97.1
cd03067		112	PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin	97.08
cd01992		185	PP-ATPase N-terminal domain of predicted ATPase of	97.05
PRK11657		251	dsbG disulfide isomerase/thiol-disulfide oxidase;	97.03
TIGR02181		79	GRX_bact Glutaredoxin, GrxC family. This family of	96.99
PF00837		237	T4_deiodinase: Iodothyronine deiodinase; InterPro:	96.94
cd03418		75	GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b	96.93
PF13848		184	Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_	96.91
cd03027		73	GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg	96.87
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	96.83
TIGR02189		99	GlrX-like_plant Glutaredoxin-like family. This fam	96.81
PF07449		107	HyaE: Hydrogenase-1 expression protein HyaE; Inter	96.81
PHA03050		108	glutaredoxin; Provisional	96.74
cd02972		98	DsbA_family DsbA family; consists of DsbA and DsbA	96.68
cd03029		72	GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb	96.62
TIGR00365		97	monothiol glutaredoxin, Grx4 family. The gene for	96.56
cd03028		90	GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte	96.46
TIGR02432		189	lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t	96.4
COG0695		80	GrxC Glutaredoxin and related proteins [Posttransl	96.34
cd03069		104	PDI_b_ERp57 PDIb family, ERp57 subfamily, first re	96.32
COG1225		157	Bcp Peroxiredoxin [Posttranslational modification,	96.17
cd03066		102	PDI_b_Calsequestrin_middle PDIb family, Calsequest	96.17
PRK10638		83	glutaredoxin 3; Provisional	96.09
KOG2640		319	consensus Thioredoxin [Function unknown]	96.08
cd03023		154	DsbA_Com1_like DsbA family, Com1-like subfamily; c	95.86
PRK10824		115	glutaredoxin-4; Provisional	95.42
cd01993		185	Alpha_ANH_like_II This is a subfamily of Adenine n	95.13
cd03013		155	PRX5_like Peroxiredoxin (PRX) family, PRX5-like su	94.84
KOG1752		104	consensus Glutaredoxin and related proteins [Postt	94.82
COG1331		667	Highly conserved protein containing a thioredoxin	94.61
PRK12759		410	bifunctional gluaredoxin/ribonucleoside-diphosphat	94.55
PTZ00062		204	glutaredoxin; Provisional	94.35
cd03019		178	DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m	94.17
cd03068		107	PDI_b_ERp72 PDIb family, ERp72 subfamily, first re	92.78
PRK10954		207	periplasmic protein disulfide isomerase I; Provisi	91.58
cd03031		147	GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d	91.11
cd02978		72	KaiB_like KaiB-like family; composed of the circad	90.04
cd03060		71	GST_N_Omega_like GST_N family, Omega-like subfamil	88.09
cd02974		94	AhpF_NTD_N Alkyl hydroperoxide reductase F subunit	87.9
PRK10696		258	tRNA 2-thiocytidine biosynthesis protein TtcA; Pro	87.86
cd02977		105	ArsC_family Arsenate Reductase (ArsC) family; comp	87.62
COG0386		162	BtuE Glutathione peroxidase [Posttranslational mod	87.58
KOG2507		506	consensus Ubiquitin regulatory protein UBXD2, cont	87.2
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	85.39
PRK09301		103	circadian clock protein KaiB; Provisional	84.62
PHA03075		123	glutaredoxin-like protein; Provisional	84.29
TIGR02654		87	circ_KaiB circadian clock protein KaiB. Members of	84.09
cd03041		77	GST_N_2GST_N GST_N family, 2 repeats of the N-term	83.32
PF10281		38	Ish1: Putative stress-responsive nuclear envelope	82.49
cd03036		111	ArsC_like Arsenate Reductase (ArsC) family, unknow	82.33
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	81.88
cd03040		77	GST_N_mPGES2 GST_N family; microsomal Prostaglandi	81.29

>PLN02309 5'-adenylylsulfate reductase	Back alignment and domain information

Probab=100.00  E-value=5.3e-75  Score=548.20  Aligned_cols=289  Identities=83%  Similarity=1.442  Sum_probs=259.2

Q ss_pred             CCCCHHHHHHHHHhcCCCCccccChhhhcchhchHHHHHHHhcCCEEEEeeeccCCCcccCCCCceecCCccccccCCCC
Q 022560            1 MFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVG   80 (295)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~K~~pl~~~l~~~~~~~~G~R~~es~~~R~~~~~~~~~~~~~~~~~~~~   80 (295)
                      ++|+..+++++++.+|+..||+++++.||.+||++||++||+++++||+|+||+||+++|++++++++|+.+...+.|++
T Consensus       168 ~~P~~~~~~~~~~~~g~~~~~~~~~~~Cc~irKVePL~raL~~~~awitG~Rr~Qs~~~Ra~l~~ve~d~~~~~~~~~~~  247 (457)
T PLN02309        168 MFPDAVEVQALVRNKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRAEVPVVQVDPVFEGLDGGPG  247 (457)
T ss_pred             ECCCcchHHHHHHhcCccccccCChHHhhhhHhHHHHHHHHhhCCEEEEeeccccCccccccCCeeeecccccccccCCC
Confidence            46899999999999999989998999999999999999999999999999999998448999999999987655555667


Q ss_pred             CEEEEeeCCCCCHHHHHHHHHHCCCCCCccccCCccccCCCCCCCCCCCCccccccccccccCCccccCCCCCCCcchhh
Q 022560           81 SLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDA  160 (295)
Q Consensus        81 ~~~~~~Pi~~W~~~dvw~y~~~~~~p~~~ly~~g~~sigc~~ct~~~~~~~~~r~gr~~w~~~~~~ecglh~~~i~~~~~  160 (295)
                      +++|||||++||..|||.||++|+|||||||++||+||||.+||+|+.+++++|+|||||++..|+|||||..++.... 
T Consensus       248 ~~lKvnPl~~Wt~~dVw~Yi~~~~lP~npL~~~GY~SIGC~pCT~pv~~g~~~RaGRw~w~~~~k~ECGlH~~~~~~~~-  326 (457)
T PLN02309        248 SLVKWNPLANVTGNEVWNFLRTMDVPVNSLHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKEED-  326 (457)
T ss_pred             CeeEEcccccCCHHHHHHHHHHcCCCCCcchhcCCCCCCCCCCCCCCCCCCCcccccccCCCCCcccccCCCCCccccc-
Confidence            8999999999999999999999999999999999999999999999999999999999999999999999987555443 


Q ss_pred             hhcCCCCCCCCCCcccccccCCCCceecCcccHHHHHhhcCCCCcEEEEEECCCChhHHHHHHHHHHHHHHhcCCCeEEE
Q 022560          161 AVNGNGNGAGNASEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQAMEGSYVELADKLAGNGVKVG  240 (295)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~v~~lt~~~f~~~i~~~~~~k~vvV~Fya~wC~~C~~~~p~~~~la~~~~~~~v~~~  240 (295)
                          +......+.+..++++.+..|++|+.++|++++...+.+++|||+||||||++|+.|.|.|.++++.+.+.++.|+
T Consensus       327 ----~~~~~~~~~~~~~dl~~~~~Vv~Lt~~nfe~ll~~~~~~k~vlV~FyApWC~~Cq~m~p~~e~LA~~~~~~~V~f~  402 (457)
T PLN02309        327 ----NGAANDNGNAAVADIFNSQNVVALSRAGIENLLKLENRKEPWLVVLYAPWCPFCQAMEASYEELAEKLAGSGVKVA  402 (457)
T ss_pred             ----ccccccccccccccccCCCCcEECCHHHHHHHHHhhcCCCeEEEEEECCCChHHHHHHHHHHHHHHHhccCCeEEE
Confidence                2223344566678888889999999999999986667899999999999999999999999999999987679999


Q ss_pred             EEEcC-CCcHHHHHHhcCCCCCCeEEEEeCCCCCeeecCCCCCCHHHHHHHHHHhC
Q 022560          241 KFRAD-GDQKEYAKQKLQLGSFPTILFFPKHSSKPIKYPSERRDVDSLMAFVDALR  295 (295)
Q Consensus       241 ~vd~~-~~~~~l~~~~~~V~~~Pti~~~~~g~~~~~~~~gg~~~~e~l~~fi~~l~  295 (295)
                      +||++ .+ ..+++++|+|+++||+++|++|....+.|.++.++.++|++||++++
T Consensus       403 kVD~d~~~-~~la~~~~~I~~~PTil~f~~g~~~~v~Y~~~~R~~~~L~~fv~~~~  457 (457)
T PLN02309        403 KFRADGDQ-KEFAKQELQLGSFPTILLFPKNSSRPIKYPSEKRDVDSLLSFVNSLR  457 (457)
T ss_pred             EEECCCcc-hHHHHhhCCCceeeEEEEEeCCCCCeeecCCCCcCHHHHHHHHHHhC
Confidence            99999 65 78883369999999999999988778899876799999999999885

>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent	Back alignment and domain information

>KOG0189 consensus Phosphoadenosine phosphosulfate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02057 PAPS_reductase phosphoadenosine phosphosulfate reductase, thioredoxin dependent	Back alignment and domain information

>TIGR02055 APS_reductase thioredoxin-dependent adenylylsulfate APS reductase	Back alignment and domain information

>TIGR00434 cysH phosophoadenylyl-sulfate reductase (thioredoxin)	Back alignment and domain information

>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional	Back alignment and domain information

>PRK12563 sulfate adenylyltransferase subunit 2; Provisional	Back alignment and domain information

>TIGR02039 CysD sulfate adenylyltransferase, small subunit	Back alignment and domain information

>PRK05253 sulfate adenylyltransferase subunit 2; Provisional	Back alignment and domain information

>PRK08557 hypothetical protein; Provisional	Back alignment and domain information

>PF01507 PAPS_reduct: Phosphoadenosine phosphosulfate reductase family; InterPro: IPR002500 This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase	Back alignment and domain information

>PRK13794 hypothetical protein; Provisional	Back alignment and domain information

>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention	Back alignment and domain information

>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases	Back alignment and domain information

>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms	Back alignment and domain information

>PRK08576 hypothetical protein; Provisional	Back alignment and domain information

>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle	Back alignment and domain information

>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX	Back alignment and domain information

>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain	Back alignment and domain information

>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain)	Back alignment and domain information

>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44	Back alignment and domain information

>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains	Back alignment and domain information

>PRK10996 thioredoxin 2; Provisional	Back alignment and domain information

>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein	Back alignment and domain information

>PHA02278 thioredoxin-like protein	Back alignment and domain information

>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain	Back alignment and domain information

>PRK09381 trxA thioredoxin; Provisional	Back alignment and domain information

>PTZ00443 Thioredoxin domain-containing protein; Provisional	Back alignment and domain information

>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein	Back alignment and domain information

>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1	Back alignment and domain information

>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif	Back alignment and domain information

>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5	Back alignment and domain information

>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related)	Back alignment and domain information

>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library	Back alignment and domain information

>TIGR01126 pdi_dom protein disulfide-isomerase domain	Back alignment and domain information

>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus	Back alignment and domain information

>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells	Back alignment and domain information

>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO	Back alignment and domain information

>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions	Back alignment and domain information

>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif	Back alignment and domain information

>PLN00410 U5 snRNP protein, DIM1 family; Provisional	Back alignment and domain information

>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1	Back alignment and domain information

>TIGR01068 thioredoxin thioredoxin	Back alignment and domain information

>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD	Back alignment and domain information

>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus	Back alignment and domain information

>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase	Back alignment and domain information

>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein	Back alignment and domain information

>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes	Back alignment and domain information

>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions	Back alignment and domain information

>PTZ00051 thioredoxin; Provisional	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains	Back alignment and domain information

>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation	Back alignment and domain information

>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding	Back alignment and domain information

>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative	Back alignment and domain information

>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis	Back alignment and domain information

>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only]	Back alignment and domain information

>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains	Back alignment and domain information

>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion]	Back alignment and domain information

>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1	Back alignment and domain information

>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1	Back alignment and domain information

>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain	Back alignment and domain information

>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC	Back alignment and domain information

>PRK06850 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00062 glutaredoxin; Provisional	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional	Back alignment and domain information

>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03147 thiol-disulfide oxidoreductase; Provisional	Back alignment and domain information

>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif	Back alignment and domain information

>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional	Back alignment and domain information

>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02125 thioredoxin-like protein	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	Back alignment and domain information

>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2	Back alignment and domain information

>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A	Back alignment and domain information

>TIGR02740 TraF-like TraF-like protein	Back alignment and domain information

>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors	Back alignment and domain information

>PRK15412 thiol:disulfide interchange protein DsbE; Provisional	Back alignment and domain information

>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX	Back alignment and domain information

>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A	Back alignment and domain information

>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif	Back alignment and domain information

>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif	Back alignment and domain information

>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily	Back alignment and domain information

>KOG2644 consensus 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)	Back alignment and domain information

>cd02958 UAS UAS family; UAS is a domain of unknown function	Back alignment and domain information

>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins	Back alignment and domain information

>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain	Back alignment and domain information

>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source	Back alignment and domain information

>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides	Back alignment and domain information

>PRK11509 hydrogenase-1 operon protein HyaE; Provisional	Back alignment and domain information

>PRK13728 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus	Back alignment and domain information

>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins	Back alignment and domain information

>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A	Back alignment and domain information

>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD	Back alignment and domain information

>smart00594 UAS UAS domain	Back alignment and domain information

>PTZ00056 glutathione peroxidase; Provisional	Back alignment and domain information

>PLN02399 phospholipid hydroperoxide glutathione peroxidase	Back alignment and domain information

>KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion]	Back alignment and domain information

>PLN02412 probable glutathione peroxidase	Back alignment and domain information

>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only]	Back alignment and domain information

>TIGR02540 gpx7 putative glutathione peroxidase Gpx7	Back alignment and domain information

>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin	Back alignment and domain information

>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626	Back alignment and domain information

>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate	Back alignment and domain information

>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides	Back alignment and domain information

>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family	Back alignment and domain information

>PTZ00256 glutathione peroxidase; Provisional	Back alignment and domain information

>TIGR03137 AhpC peroxiredoxin	Back alignment and domain information

>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells	Back alignment and domain information

>PF13728 TraF: F plasmid transfer operon protein	Back alignment and domain information

>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold	Back alignment and domain information

>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides	Back alignment and domain information

>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle []	Back alignment and domain information

>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only]	Back alignment and domain information

>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed	Back alignment and domain information

>TIGR02200 GlrX_actino Glutaredoxin-like protein	Back alignment and domain information

>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional	Back alignment and domain information

>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion]	Back alignment and domain information

>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional	Back alignment and domain information

>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A	Back alignment and domain information

>PRK13190 putative peroxiredoxin; Provisional	Back alignment and domain information

>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE	Back alignment and domain information

>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like	Back alignment and domain information

>PRK15000 peroxidase; Provisional	Back alignment and domain information

>KOG3425 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins	Back alignment and domain information

>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals	Back alignment and domain information

>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF	Back alignment and domain information

>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A	Back alignment and domain information

>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx)	Back alignment and domain information

>PTZ00137 2-Cys peroxiredoxin; Provisional	Back alignment and domain information

>TIGR02180 GRX_euk Glutaredoxin	Back alignment and domain information

>PRK13703 conjugal pilus assembly protein TraF; Provisional	Back alignment and domain information

>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ]	Back alignment and domain information

>KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified	Back alignment and domain information

>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine	Back alignment and domain information

>PRK13191 putative peroxiredoxin; Provisional	Back alignment and domain information

>PRK13189 peroxiredoxin; Provisional	Back alignment and domain information

>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention	Back alignment and domain information

>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold	Back alignment and domain information

>PRK13599 putative peroxiredoxin; Provisional	Back alignment and domain information

>KOG3414 consensus Component of the U4/U6	Back alignment and domain information

>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B	Back alignment and domain information

>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain)	Back alignment and domain information

>PTZ00253 tryparedoxin peroxidase; Provisional	Back alignment and domain information

>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile	Back alignment and domain information

>PRK11200 grxA glutaredoxin 1; Provisional	Back alignment and domain information

>PRK10606 btuE putative glutathione peroxidase; Provisional	Back alignment and domain information

>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI	Back alignment and domain information

>PRK10877 protein disulfide isomerase II DsbC; Provisional	Back alignment and domain information

>KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms]	Back alignment and domain information

>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>TIGR02183 GRXA Glutaredoxin, GrxA family	Back alignment and domain information

>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol	Back alignment and domain information

>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A	Back alignment and domain information

>PRK10329 glutaredoxin-like protein; Provisional	Back alignment and domain information

>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH	Back alignment and domain information

>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>TIGR02190 GlrX-dom Glutaredoxin-family domain	Back alignment and domain information

>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related)	Back alignment and domain information

>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional	Back alignment and domain information

>TIGR02181 GRX_bact Glutaredoxin, GrxC family	Back alignment and domain information

>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1	Back alignment and domain information

>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A	Back alignment and domain information

>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>TIGR02189 GlrX-like_plant Glutaredoxin-like family	Back alignment and domain information

>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long	Back alignment and domain information

>PHA03050 glutaredoxin; Provisional	Back alignment and domain information

>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins	Back alignment and domain information

>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria	Back alignment and domain information

>TIGR00365 monothiol glutaredoxin, Grx4 family	Back alignment and domain information

>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins	Back alignment and domain information

>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain	Back alignment and domain information

>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds	Back alignment and domain information

>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle	Back alignment and domain information

>PRK10638 glutaredoxin 3; Provisional	Back alignment and domain information

>KOG2640 consensus Thioredoxin [Function unknown]	Back alignment and domain information

>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti	Back alignment and domain information

>PRK10824 glutaredoxin-4; Provisional	Back alignment and domain information

>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol	Back alignment and domain information

>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional	Back alignment and domain information

>PTZ00062 glutaredoxin; Provisional	Back alignment and domain information

>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold	Back alignment and domain information

>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds	Back alignment and domain information

>PRK10954 periplasmic protein disulfide isomerase I; Provisional	Back alignment and domain information

>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs	Back alignment and domain information

>cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA	Back alignment and domain information

>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs	Back alignment and domain information

>cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides	Back alignment and domain information

>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional	Back alignment and domain information

>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx	Back alignment and domain information

>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK09301 circadian clock protein KaiB; Provisional	Back alignment and domain information

>PHA03075 glutaredoxin-like protein; Provisional	Back alignment and domain information

>TIGR02654 circ_KaiB circadian clock protein KaiB	Back alignment and domain information

>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins	Back alignment and domain information

>PF10281 Ish1: Putative stress-responsive nuclear envelope protein; InterPro: IPR018803 This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []	Back alignment and domain information

>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		295
2goy_A		275	Crystal Structure Of Assimilatory Adenosine 5'- Pho		1e-54
2oq2_A		261	Crystal Structure Of Yeast Paps Reductase With Pap,		3e-13
2o8v_A		252	Paps Reductase In A Covalent Complex With Thioredox		4e-08
2dj3_A		133	The Solution Structure Of The Third Thioredoxin Dom		2e-07
2dml_A		130	The Solution Structure Of The First Thioredoxin Dom		1e-06
2b5e_A		504	Crystal Structure Of Yeast Protein Disulfide Isomer		4e-06
1mek_A		120	Human Protein Disulfide Isomerase, Nmr, 40 Structur		4e-06
1sur_A		215	Phospho-Adenylyl-Sulfate Reductase Length = 215		3e-05
2dmm_A		142	The Solution Structure Of The Second Thioredoxin Do		2e-04
3f8u_A		481	TapasinERP57 HETERODIMER Length = 481		2e-04
2diz_A		117	The Solution Structure Of The Third Thioredoxin Dom		4e-04
3uvt_A		111	Crystal Structure Of The Third Catalytic Domain Of		4e-04
3apo_A		780	Crystal Structure Of Full-Length Erdj5 Length = 780		5e-04
3uj1_A		110	Crystal Structure Of The Third Thioredoxin Domain O		5e-04
2ppt_A		155	Crystal Structure Of Thioredoxin-2 Length = 155		7e-04
3ed3_A		298	Crystal Structure Of The Yeast DithiolDISULFIDE Oxi		9e-04

>pdb|2GOY|A Chain A, Crystal Structure Of Assimilatory Adenosine 5'- Phosphosulfate Reductase With Bound Aps Length = 275