Citrus Sinensis ID: 022704
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 293 | 2.2.26 [Sep-21-2011] | |||||||
| P19866 | 401 | Glyceraldehyde-3-phosphat | N/A | no | 0.815 | 0.596 | 0.924 | 1e-122 | |
| P25856 | 396 | Glyceraldehyde-3-phosphat | no | no | 0.815 | 0.603 | 0.945 | 1e-118 | |
| P12858 | 405 | Glyceraldehyde-3-phosphat | N/A | no | 0.815 | 0.590 | 0.937 | 1e-115 | |
| P09315 | 403 | Glyceraldehyde-3-phosphat | N/A | no | 0.815 | 0.593 | 0.924 | 1e-114 | |
| P09043 | 392 | Glyceraldehyde-3-phosphat | N/A | no | 0.815 | 0.609 | 0.924 | 1e-113 | |
| P09672 | 233 | Glyceraldehyde-3-phosphat | N/A | no | 0.795 | 1.0 | 0.935 | 1e-112 | |
| P34919 | 414 | Glyceraldehyde-3-phosphat | N/A | no | 0.812 | 0.574 | 0.733 | 1e-102 | |
| P25857 | 447 | Glyceraldehyde-3-phosphat | no | no | 0.812 | 0.532 | 0.813 | 1e-102 | |
| P30724 | 416 | Glyceraldehyde-3-phosphat | N/A | no | 0.812 | 0.572 | 0.733 | 1e-102 | |
| P12860 | 451 | Glyceraldehyde-3-phosphat | N/A | no | 0.812 | 0.527 | 0.821 | 1e-101 |
| >sp|P19866|G3PA_SPIOL Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 439 bits (1129), Expect = e-122, Method: Compositional matrix adjust.
Identities = 221/239 (92%), Positives = 230/239 (96%)
Query: 55 GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC 114
GTGVFVDR+GAGKH+QAGAKKVLITAPGKGDIPTYVVGVN + Y + IISNASCTTNC
Sbjct: 163 GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNC 222
Query: 115 LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV 174
LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct: 223 LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV 282
Query: 175 ALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC 234
ALVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC
Sbjct: 283 ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC 342
Query: 235 DEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 293
DEPLVS+DFRC+DVSST+DSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN W+
Sbjct: 343 DEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ 401
|
Spinacia oleracea (taxid: 3562) EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 3 |
| >sp|P25856|G3PA_ARATH Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Arabidopsis thaliana GN=GAPA PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P12858|G3PA_PEA Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P09315|G3PA_MAIZE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P09043|G3PA_TOBAC Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P09672|G3PA_SINAL Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Sinapis alba GN=GAPA PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P34919|G3PA_CHOCR Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Chondrus crispus GN=GAPA PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P25857|G3PB_ARATH Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P30724|G3PA_GRAGA Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Gracilaria gracilis GN=GAPA PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P12860|G3PB_SPIOL Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 293 | ||||||
| 145323880 | 317 | glyceraldehyde-3-phosphate dehydrogenase | 0.986 | 0.911 | 0.82 | 1e-122 | |
| 20455487 | 401 | RecName: Full=Glyceraldehyde-3-phosphate | 0.815 | 0.596 | 0.924 | 1e-121 | |
| 66026 | 337 | glyceraldehyde-3-phosphate dehydrogenase | 0.815 | 0.709 | 0.924 | 1e-120 | |
| 51247294 | 337 | Chain O, Crystal Structure Of Mutant T33 | 0.815 | 0.709 | 0.924 | 1e-120 | |
| 31615655 | 337 | Chain O, The Dual Coenzyme Specificity O | 0.815 | 0.709 | 0.924 | 1e-120 | |
| 150261397 | 365 | Chain O, Crystal Structure Of (A+cte)4 C | 0.815 | 0.654 | 0.924 | 1e-120 | |
| 51247300 | 337 | Chain O, Crystal Structure Of Mutant S18 | 0.815 | 0.709 | 0.920 | 1e-120 | |
| 17942958 | 335 | Chain O, Crystal Structure Of The Non-Re | 0.815 | 0.713 | 0.920 | 1e-120 | |
| 334813895 | 405 | glyceraldehyde-3-phosphate dehydrogenase | 0.815 | 0.590 | 0.966 | 1e-118 | |
| 255543455 | 404 | glyceraldehyde 3-phosphate dehydrogenase | 0.815 | 0.591 | 0.966 | 1e-118 |
| >gi|145323880|ref|NP_001077529.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) [Arabidopsis thaliana] gi|332190824|gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 444 bits (1141), Expect = e-122, Method: Compositional matrix adjust.
Identities = 246/300 (82%), Positives = 260/300 (86%), Gaps = 11/300 (3%)
Query: 5 VSSRPLTSSSTTPPSASLKPMLNQLVLMASLLMARSSRLFLTATPSISPGG--------- 55
V ++ SS+TT SL M N SLLM RSSRL+L T ISPGG
Sbjct: 18 VLNKHHISSNTTQLLESLTLMSNLQETQLSLLMERSSRLYLIVTHLISPGGKELGIDLVI 77
Query: 56 --TGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTN 113
TGVFVDR+GAGKH+QAGAKKVLITAPGKGDIPTYVVGVNA+ Y ++ IISNASCTTN
Sbjct: 78 EGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTN 137
Query: 114 CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA 173
CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct: 138 CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA 197
Query: 174 VALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSV 233
VALVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A+ ELKGIL V
Sbjct: 198 VALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDV 257
Query: 234 CDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 293
CDEPLVSVDFRCSDVSST+DSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK
Sbjct: 258 CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 317
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|20455487|sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate dehydrogenase subunit A; Flags: Precursor gi|2529370|gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit A [Spinacia oleracea] | Back alignment and taxonomy information |
|---|
| >gi|66026|pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP) (phosphorylating) (EC 1.2.1.13) A, chloroplast - spinach | Back alignment and taxonomy information |
|---|
| >gi|51247294|pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp gi|51247295|pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp gi|51247296|pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp | Back alignment and taxonomy information |
|---|
| >gi|31615655|pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad gi|31615656|pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad gi|31615657|pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad gi|51247297|pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp gi|51247298|pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp gi|51247299|pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp gi|119389903|pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate Dehydrogenase A4 Isoform gi|150261392|pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp gi|150261394|pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp gi|150261395|pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp | Back alignment and taxonomy information |
|---|
| >gi|150261397|pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261398|pdb|2PKR|R Chain R, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261399|pdb|2PKR|P Chain P, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261400|pdb|2PKR|Q Chain Q, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261401|pdb|2PKR|A Chain A, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261402|pdb|2PKR|B Chain B, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261403|pdb|2PKR|C Chain C, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261404|pdb|2PKR|D Chain D, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261405|pdb|2PKR|H Chain H, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261406|pdb|2PKR|I Chain I, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261407|pdb|2PKR|L Chain L, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp gi|150261408|pdb|2PKR|M Chain M, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp | Back alignment and taxonomy information |
|---|
| >gi|51247300|pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp gi|51247301|pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp gi|51247302|pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp | Back alignment and taxonomy information |
|---|
| >gi|17942958|pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp gi|17942959|pdb|1JN0|A Chain A, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp gi|17942960|pdb|1JN0|B Chain B, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp | Back alignment and taxonomy information |
|---|
| >gi|334813895|gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea] | Back alignment and taxonomy information |
|---|
| >gi|255543455|ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] gi|223547801|gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 293 | ||||||
| TAIR|locus:2090802 | 396 | GAPA "glyceraldehyde 3-phospha | 0.815 | 0.603 | 0.719 | 2.9e-87 | |
| TAIR|locus:2010361 | 399 | GAPA-2 "glyceraldehyde 3-phosp | 0.815 | 0.598 | 0.694 | 2.1e-84 | |
| TAIR|locus:2009864 | 447 | GAPB "glyceraldehyde-3-phospha | 0.812 | 0.532 | 0.597 | 1.4e-69 | |
| TIGR_CMR|CHY_0280 | 335 | CHY_0280 "glyceraldehyde-3-pho | 0.798 | 0.698 | 0.463 | 2.2e-50 | |
| TIGR_CMR|BA_4827 | 342 | BA_4827 "glyceraldehyde 3-phos | 0.802 | 0.687 | 0.444 | 9.8e-48 | |
| TIGR_CMR|GSU_1629 | 333 | GSU_1629 "glyceraldehyde 3-pho | 0.802 | 0.705 | 0.444 | 5.4e-47 | |
| UNIPROTKB|Q829W3 | 335 | gap2 "Glyceraldehyde-3-phospha | 0.802 | 0.701 | 0.419 | 3e-46 | |
| UNIPROTKB|P64178 | 339 | gap "Glyceraldehyde-3-phosphat | 0.802 | 0.693 | 0.427 | 2.1e-45 | |
| TIGR_CMR|BA_5369 | 334 | BA_5369 "glyceraldehyde 3-phos | 0.784 | 0.688 | 0.432 | 2.7e-45 | |
| TIGR_CMR|SPO_0701 | 341 | SPO_0701 "glyceraldehyde-3-pho | 0.778 | 0.668 | 0.416 | 2.4e-44 |
| TAIR|locus:2090802 GAPA "glyceraldehyde 3-phosphate dehydrogenase A subunit" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 872 (312.0 bits), Expect = 2.9e-87, P = 2.9e-87
Identities = 172/239 (71%), Positives = 176/239 (73%)
Query: 55 GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC 114
GTGVFVDREGAGKHI+AGAKKV+ITAPGKGDIPTYVVGVNADAY DEPIISNASCTTNC
Sbjct: 158 GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC 217
Query: 115 LAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXX 174
LAPFVKVLDQKFGIIKGTMTTTHSYTGDQ NIVPTST
Sbjct: 218 LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV 277
Query: 175 XXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVC 234
NGIALRVPTPN SKKTFAEEVNAAFR+SA+ ELKGIL VC
Sbjct: 278 ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC 337
Query: 235 DEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 293
DEPLVSVDFRC MGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK
Sbjct: 338 DEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 396
|
|
| TAIR|locus:2010361 GAPA-2 "glyceraldehyde 3-phosphate dehydrogenase A subunit 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009864 GAPB "glyceraldehyde-3-phosphate dehydrogenase B subunit" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0280 CHY_0280 "glyceraldehyde-3-phosphate dehydrogenase, type I" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4827 BA_4827 "glyceraldehyde 3-phosphate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1629 GSU_1629 "glyceraldehyde 3-phosphate dehydrogenase 1" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q829W3 gap2 "Glyceraldehyde-3-phosphate dehydrogenase" [Streptomyces avermitilis MA-4680 (taxid:227882)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P64178 gap "Glyceraldehyde-3-phosphate dehydrogenase" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5369 BA_5369 "glyceraldehyde 3-phosphate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0701 SPO_0701 "glyceraldehyde-3-phosphate dehydrogenase, type I" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q4MQ58 | G3P1_BACCE | 1, ., 2, ., 1, ., 1, 2 | 0.6103 | 0.7849 | 0.6886 | yes | no |
| P09315 | G3PA_MAIZE | 1, ., 2, ., 1, ., 1, 3 | 0.9246 | 0.8156 | 0.5930 | N/A | no |
| P09043 | G3PA_TOBAC | 1, ., 2, ., 1, ., 1, 3 | 0.9246 | 0.8156 | 0.6096 | N/A | no |
| P09316 | G3P_ZYMMO | 1, ., 2, ., 1, ., 1, 2 | 0.5689 | 0.7849 | 0.6824 | yes | no |
| P50362 | G3PA_CHLRE | 1, ., 2, ., 1, ., 1, 3 | 0.8117 | 0.8122 | 0.6363 | N/A | no |
| P12858 | G3PA_PEA | 1, ., 2, ., 1, ., 1, 3 | 0.9372 | 0.8156 | 0.5901 | N/A | no |
| P17721 | G3P_THEMA | 1, ., 2, ., 1, ., 1, 2 | 0.5922 | 0.7952 | 0.6996 | yes | no |
| P94915 | G3P_MYCAV | 1, ., 2, ., 1, ., 1, 2 | 0.5811 | 0.7952 | 0.6873 | yes | no |
| P50322 | G3PP_CUPNH | 1, ., 2, ., 1, ., 1, 2 | 0.5466 | 0.7986 | 0.6964 | yes | no |
| P58554 | G3P2_NOSS1 | 1, ., 2, ., 1, ., 1, 2 | 0.7226 | 0.8088 | 0.7032 | yes | no |
| P64178 | G3P_MYCTU | 1, ., 2, ., 1, ., 1, 2 | 0.5940 | 0.7952 | 0.6873 | yes | no |
| P64179 | G3P_MYCBO | 1, ., 2, ., 1, ., 1, 2 | 0.5940 | 0.7952 | 0.6873 | yes | no |
| P09124 | G3P1_BACSU | 1, ., 2, ., 1, ., 1, 2 | 0.6297 | 0.7986 | 0.6985 | yes | no |
| O67161 | G3P_AQUAE | 1, ., 2, ., 1, ., 1, 2 | 0.5375 | 0.8395 | 0.7192 | yes | no |
| Q8VXQ9 | G3PA_SCEVA | 1, ., 2, ., 1, ., 1, 3 | 0.8430 | 0.7576 | 0.7070 | N/A | no |
| P09672 | G3PA_SINAL | 1, ., 2, ., 1, ., 1, 3 | 0.9356 | 0.7952 | 1.0 | N/A | no |
| A0QWW2 | G3P_MYCS2 | 1, ., 2, ., 1, ., 1, 2 | 0.5683 | 0.7952 | 0.6852 | yes | no |
| P46713 | G3P_MYCLE | 1, ., 2, ., 1, ., 1, 2 | 0.5683 | 0.7952 | 0.6873 | yes | no |
| P34917 | G3P2_ANAVT | 1, ., 2, ., 1, ., 1, 2 | 0.7184 | 0.8088 | 0.7032 | yes | no |
| P46795 | G3P_BORBU | 1, ., 2, ., 1, ., 1, 2 | 0.5611 | 0.7849 | 0.6865 | yes | no |
| P23722 | G3P_BACMD | 1, ., 2, ., 1, ., 1, 2 | 0.6170 | 0.7986 | 0.6985 | yes | no |
| P19866 | G3PA_SPIOL | 1, ., 2, ., 1, ., 1, 3 | 0.9246 | 0.8156 | 0.5960 | N/A | no |
| Q9Z518 | G3P_STRCO | 1, ., 2, ., 1, ., 1, 2 | 0.5882 | 0.8054 | 0.7023 | yes | no |
| P25856 | G3PA_ARATH | 1, ., 2, ., 1, ., 1, 3 | 0.9456 | 0.8156 | 0.6035 | no | no |
| P80505 | G3P2_SYNY3 | 1, ., 2, ., 1, ., 5, 9 | 0.7875 | 0.8122 | 0.7062 | N/A | no |
| Q6BMK0 | G3P_DEBHA | 1, ., 2, ., 1, ., 1, 2 | 0.5531 | 0.7952 | 0.6955 | yes | no |
| P50321 | G3PC_CUPNH | 1, ., 2, ., 1, ., 1, 2 | 0.5466 | 0.7986 | 0.6964 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.2.1 | 0.963 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 293 | |||
| PLN03096 | 395 | PLN03096, PLN03096, glyceraldehyde-3-phosphate deh | 1e-179 | |
| PLN02237 | 442 | PLN02237, PLN02237, glyceraldehyde-3-phosphate deh | 1e-155 | |
| PRK07403 | 337 | PRK07403, PRK07403, glyceraldehyde-3-phosphate deh | 1e-145 | |
| TIGR01534 | 326 | TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh | 1e-134 | |
| COG0057 | 335 | COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog | 1e-129 | |
| PRK07729 | 343 | PRK07729, PRK07729, glyceraldehyde-3-phosphate deh | 1e-125 | |
| pfam02800 | 157 | pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh | 6e-88 | |
| PTZ00023 | 337 | PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh | 1e-87 | |
| PRK08955 | 334 | PRK08955, PRK08955, glyceraldehyde-3-phosphate deh | 8e-86 | |
| PRK08289 | 477 | PRK08289, PRK08289, glyceraldehyde-3-phosphate deh | 2e-83 | |
| PLN02272 | 421 | PLN02272, PLN02272, glyceraldehyde-3-phosphate deh | 6e-82 | |
| PLN02358 | 338 | PLN02358, PLN02358, glyceraldehyde-3-phosphate deh | 1e-79 | |
| PRK13535 | 336 | PRK13535, PRK13535, erythrose 4-phosphate dehydrog | 1e-78 | |
| PTZ00434 | 361 | PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho | 9e-76 | |
| TIGR01532 | 325 | TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de | 1e-74 | |
| PRK15425 | 331 | PRK15425, gapA, glyceraldehyde-3-phosphate dehydro | 2e-73 | |
| pfam00044 | 148 | pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh | 8e-26 | |
| PTZ00353 | 342 | PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph | 1e-25 | |
| smart00846 | 149 | smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de | 1e-22 |
| >gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
Score = 499 bits (1285), Expect = e-179
Identities = 224/239 (93%), Positives = 232/239 (97%)
Query: 55 GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC 114
GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAD YK +PIISNASCTTNC
Sbjct: 157 GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYKHSDPIISNASCTTNC 216
Query: 115 LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV 174
LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct: 217 LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV 276
Query: 175 ALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC 234
ALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFR++A+ ELKGIL+VC
Sbjct: 277 ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDAAEKELKGILAVC 336
Query: 235 DEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 293
DEPLVSVDFRCSDVSST+DSSLT+VMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct: 337 DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANKWK 395
|
Length = 395 |
| >gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
| >gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I | Back alignment and domain information |
|---|
| >gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 293 | |||
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 100.0 | |
| PTZ00434 | 361 | cytosolic glyceraldehyde 3-phosphate dehydrogenase | 100.0 | |
| PRK15425 | 331 | gapA glyceraldehyde-3-phosphate dehydrogenase A; P | 100.0 | |
| PLN02237 | 442 | glyceraldehyde-3-phosphate dehydrogenase B | 100.0 | |
| PRK07403 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 100.0 | |
| PRK08955 | 334 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 100.0 | |
| PLN02358 | 338 | glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| PLN02272 | 421 | glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| PTZ00023 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 100.0 | |
| PRK13535 | 336 | erythrose 4-phosphate dehydrogenase; Provisional | 100.0 | |
| PRK07729 | 343 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 100.0 | |
| TIGR01534 | 327 | GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, | 100.0 | |
| TIGR01532 | 325 | E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas | 100.0 | |
| PTZ00353 | 342 | glycosomal glyceraldehyde-3-phosphate dehydrogenas | 100.0 | |
| PRK08289 | 477 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 100.0 | |
| COG0057 | 335 | GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt | 100.0 | |
| KOG0657 | 285 | consensus Glyceraldehyde 3-phosphate dehydrogenase | 100.0 | |
| PF02800 | 157 | Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, | 100.0 | |
| PRK06901 | 322 | aspartate-semialdehyde dehydrogenase; Provisional | 100.0 | |
| COG0136 | 334 | Asd Aspartate-semialdehyde dehydrogenase [Amino ac | 100.0 | |
| TIGR01745 | 366 | asd_gamma aspartate-semialdehyde dehydrogenase, ga | 100.0 | |
| PRK06728 | 347 | aspartate-semialdehyde dehydrogenase; Provisional | 100.0 | |
| TIGR01296 | 339 | asd_B aspartate-semialdehyde dehydrogenase (peptid | 100.0 | |
| TIGR01546 | 333 | GAPDH-II_archae glyceraldehyde-3-phosphate dehydro | 100.0 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 100.0 | |
| PRK06598 | 369 | aspartate-semialdehyde dehydrogenase; Reviewed | 100.0 | |
| PRK04207 | 341 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 100.0 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 100.0 | |
| PRK05671 | 336 | aspartate-semialdehyde dehydrogenase; Reviewed | 100.0 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 99.98 | |
| TIGR00978 | 341 | asd_EA aspartate-semialdehyde dehydrogenase (non-p | 99.96 | |
| PRK08664 | 349 | aspartate-semialdehyde dehydrogenase; Reviewed | 99.95 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 99.92 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 99.92 | |
| KOG4777 | 361 | consensus Aspartate-semialdehyde dehydrogenase [Am | 99.91 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 99.9 | |
| smart00846 | 149 | Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, | 99.8 | |
| PF00044 | 151 | Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, | 99.79 | |
| PRK11863 | 313 | N-acetyl-gamma-glutamyl-phosphate reductase; Provi | 99.77 | |
| TIGR01851 | 310 | argC_other N-acetyl-gamma-glutamyl-phosphate reduc | 99.68 | |
| PRK08300 | 302 | acetaldehyde dehydrogenase; Validated | 99.44 | |
| PF02774 | 184 | Semialdhyde_dhC: Semialdehyde dehydrogenase, dimer | 99.36 | |
| TIGR03215 | 285 | ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati | 98.97 | |
| COG0002 | 349 | ArgC Acetylglutamate semialdehyde dehydrogenase [A | 98.62 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 98.53 | |
| smart00859 | 122 | Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin | 97.36 | |
| KOG4354 | 340 | consensus N-acetyl-gamma-glutamyl-phosphate reduct | 95.7 | |
| COG4569 | 310 | MhpF Acetaldehyde dehydrogenase (acetylating) [Sec | 91.96 |
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.3e-94 Score=694.23 Aligned_cols=273 Identities=83% Similarity=1.198 Sum_probs=263.2
Q ss_pred CCCCceeEECCEEEEEEEeecccccccCC--CCCcEEEeccCCCCCHhhHHHHHHcCCCcEEecCCCCCCCCeEEecCCc
Q 022704 18 PSASLKPMLNQLVLMASLLMARSSRLFLT--ATPSISPGGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNA 95 (293)
Q Consensus 18 ~s~g~~~~f~g~~~~v~~~~~~~~~~f~~--~~~DivlestG~~~s~~~a~~hl~aGakkVVIs~ps~~dvPlvVpgVN~ 95 (293)
.++|+.|.|+|+.+.| .++.+++.++| .|+||||||||.|.++++|++|+++|||||+||+|+++++||||||||+
T Consensus 120 ~~~g~~l~v~gk~I~v--~~~~dp~~~~w~~~gvDiVie~TG~f~s~~~a~~hl~aGAkkV~iSap~~~~~ptvV~GVN~ 197 (395)
T PLN03096 120 PVGDDAISVDGKVIKV--VSDRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNA 197 (395)
T ss_pred EecCCEEEECCEEEEE--EEcCCcccccccccCCCEEEECcchhhhHHHHHHHHHCCCEEEEeCCCCCCCCCeEeCccCH
Confidence 3679999999999877 56677788889 6999999999999999999999999999999999987789999999999
Q ss_pred CCCCCCCCeeeCCCcchhhhhhHHHHHhhhcCccEEEEeeecccccchhhhccchhhHHhhhhcccccccCCCchHHHHH
Q 022704 96 DAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVA 175 (293)
Q Consensus 96 ~~~~~~~~IISn~sCtTn~lap~lk~L~~~fgI~~~~~TT~havsg~q~~~d~~~~d~r~~r~~a~NIIP~~tGa~k~~~ 175 (293)
+.|+++++||||||||||||+|++|+|||+|||++++|||||+||++|+++|++++|+||+|++++||||++||++++++
T Consensus 198 ~~l~~~~~IISnaSCTTn~LAp~lkvL~~~fGI~~g~mTTiHa~T~~Q~llD~~~~d~rr~Raaa~NiIPtsTGaakav~ 277 (395)
T PLN03096 198 DDYKHSDPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVA 277 (395)
T ss_pred HHhccCCCEEECCchHHHHHHHHHHHHHHhcCeeEEEEEEEEccccccccccCCCCccccchhhhccccccCCCcchhhh
Confidence 99987789999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHccccCCCeeEEEEecCCCeeeEEEEEEEecCcCcHHHHHHHHHHcccccccCcccccCCCceeccCCCCCceeeEeCC
Q 022704 176 LVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDSS 255 (293)
Q Consensus 176 kvlPeL~gkv~~tavRVPV~~gs~~dltv~~~k~v~~eei~~~l~~a~~~~lkgil~~te~~~VS~D~~~~~~s~i~d~~ 255 (293)
||||+|+||++++||||||++||++||++++++++++||||++|+++++|+|||||+|+++|+||+||+|++||+|||+.
T Consensus 278 kVlP~L~gkl~g~avRVPv~~gs~~dltv~~~~~~t~eev~~al~~aa~~~l~gil~~~~~p~VS~Df~~~~~Ssi~d~~ 357 (395)
T PLN03096 278 LVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDAAEKELKGILAVCDEPLVSVDFRCSDVSSTIDSS 357 (395)
T ss_pred hcccccCCcEEEEEEEccccceEEEEEEEEECCCCCHHHHHHHHHhhhhccccceEEEeCCCEeeeeecCCCCceEEEcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CceeeCCceEEEEEEeCCCCchhhhHHHHHHHHhccC
Q 022704 256 LTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW 292 (293)
Q Consensus 256 ~t~~~~~~~vkl~~WyDNE~gys~r~~dl~~~~~~~~ 292 (293)
+|++++++++|+++||||||||||||+|+++||.+..
T Consensus 358 ~t~v~~~~~vKv~~WYDNE~Gys~r~~dl~~~~~~~~ 394 (395)
T PLN03096 358 LTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANKW 394 (395)
T ss_pred cCEEeCCCEEEEEEEecCchhHHHHHHHHHHHHHhhc
Confidence 9999999999999999999999999999999998754
|
|
| >PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PLN02237 glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
| >PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02358 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02272 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13535 erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I | Back alignment and domain information |
|---|
| >TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >PRK06901 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial | Back alignment and domain information |
|---|
| >PRK06728 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form | Back alignment and domain information |
|---|
| >PRK08300 acetaldehyde dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF02774 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimerisation domain; InterPro: IPR012280 This domain contains N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) | Back alignment and domain information |
|---|
| >COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >KOG4354 consensus N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 293 | ||||
| 3k2b_A | 337 | Crystal Structure Of Photosynthetic A4 Isoform Glyc | 4e-94 | ||
| 1rm3_O | 337 | Crystal Structure Of Mutant T33a Of Photosynthetic | 1e-91 | ||
| 1rm5_O | 337 | Crystal Structure Of Mutant S188a Of Photosynthetic | 1e-91 | ||
| 1nbo_O | 337 | The Dual Coenzyme Specificity Of Photosynthetic Gly | 2e-91 | ||
| 2pkr_O | 365 | Crystal Structure Of (A+cte)4 Chimeric Form Of Phot | 3e-91 | ||
| 1jn0_O | 335 | Crystal Structure Of The Non-Regulatory A4 Isoform | 5e-91 | ||
| 2pkq_O | 368 | Crystal Structure Of The Photosynthetic A2b2-Glycer | 2e-72 | ||
| 3b1j_A | 339 | Crystal Structure Of Dehydrogenese Length = 339 | 3e-61 | ||
| 2d2i_A | 380 | Crystal Structure Of Nadp-Dependent Glyceraldehyde- | 2e-59 | ||
| 1dbv_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 1e-54 | ||
| 3dbv_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 1e-54 | ||
| 1gd1_O | 334 | Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr | 2e-54 | ||
| 1npt_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 2e-53 | ||
| 1nq5_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 2e-53 | ||
| 1hdg_O | 332 | The Crystal Structure Of Holo-glyceraldehyde-3-phos | 6e-50 | ||
| 4dib_A | 345 | The Crystal Structure Of Glyceraldehyde-3-Phosphate | 1e-47 | ||
| 3doc_A | 335 | Crystal Structure Of Trka Glyceraldehyde-3-Phosphat | 1e-47 | ||
| 1cer_O | 331 | Determinants Of Enzyme Thermostability Observed In | 1e-44 | ||
| 1vc2_A | 331 | Crystal Structure Of Glyceraldehyde 3-Phosphate Deh | 5e-44 | ||
| 2ep7_A | 342 | Structural Study Of Project Id Aq_1065 From Aquifex | 1e-43 | ||
| 3l0d_A | 356 | Crystal Structure Of Glyceraldehyde-3-phosphate Deh | 1e-43 | ||
| 2g82_O | 331 | High Resolution Structures Of Thermus Aquaticus Gly | 2e-43 | ||
| 3e5r_O | 337 | Crystal Structure And Functional Analysis Of Glycer | 1e-42 | ||
| 3e6a_O | 336 | Crystal Structure And Functional Analysis Of Glycer | 1e-42 | ||
| 3gnq_A | 344 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 2e-42 | ||
| 1vsu_A | 359 | Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate | 2e-41 | ||
| 3cps_A | 354 | Crystal Structure Of Cryptosporidium Parvum Glycera | 2e-41 | ||
| 1ywg_O | 337 | The Structure Of Glyceraldehyde-3-Phosphate Dehydro | 2e-41 | ||
| 1obf_O | 335 | The Crystal Structure Of Glyceraldehyde 3-Phosphate | 6e-41 | ||
| 1s7c_A | 331 | Crystal Structure Of Mes Buffer Bound Form Of Glyce | 1e-40 | ||
| 1gad_O | 330 | Comparison Of The Structures Of Wild Type And A N31 | 1e-40 | ||
| 2b4r_O | 345 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 2e-40 | ||
| 3cif_A | 359 | Crystal Structure Of C153s Mutant Glyceraldehyde 3- | 3e-40 | ||
| 1gae_O | 330 | Comparison Of The Structures Of Wild Type And A N31 | 8e-40 | ||
| 3hja_A | 356 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 1e-39 | ||
| 2vyn_A | 331 | Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet | 2e-39 | ||
| 4iq8_A | 340 | Crystal Structure Of Glyceraldehyde-3-phosphate Deh | 2e-39 | ||
| 3pym_A | 332 | Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res | 2e-39 | ||
| 1znq_O | 338 | Crsytal Structure Of Human Liver Gapdh Length = 338 | 4e-39 | ||
| 1szj_G | 333 | Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr | 4e-39 | ||
| 1u8f_O | 335 | Crystal Structure Of Human Placental Glyceraldehyde | 5e-39 | ||
| 3sth_A | 361 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 5e-39 | ||
| 1ihx_A | 333 | Crystal Structure Of Two D-Glyceraldehyde-3-Phospha | 5e-39 | ||
| 1k3t_A | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 7e-39 | ||
| 1a7k_A | 360 | Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase | 8e-39 | ||
| 1gyp_A | 358 | Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph | 8e-39 | ||
| 2i5p_O | 342 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 2e-38 | ||
| 1j0x_O | 332 | Crystal Structure Of The Rabbit Muscle Glyceraldehy | 2e-38 | ||
| 3h9e_B | 346 | Crystal Structure Of Human Sperm-Specific Glycerald | 3e-38 | ||
| 2x0n_A | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 5e-38 | ||
| 1gpd_G | 334 | Studies Of Asymmetry In The Three-Dimensional Struc | 8e-38 | ||
| 4gpd_1 | 333 | The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho | 8e-38 | ||
| 1dss_G | 333 | Structure Of Active-Site Carboxymethylated D-Glycer | 8e-38 | ||
| 3dmt_C | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 1e-37 | ||
| 3gpd_R | 334 | Twinning In Crystals Of Human Skeletal Muscle D-Gly | 2e-37 | ||
| 2vyn_D | 334 | Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet | 8e-37 | ||
| 1dc4_A | 330 | Structural Analysis Of Glyceraldehyde 3-Phosphate D | 1e-35 | ||
| 2xf8_A | 338 | Structure Of The D-Erythrose-4-Phosphate Dehydrogen | 2e-35 | ||
| 2x5j_O | 339 | Crystal Structure Of The Apoform Of The D-Erythrose | 2e-35 | ||
| 2x5k_O | 339 | Structure Of An Active Site Mutant Of The D-Erythro | 3e-33 | ||
| 3lc7_O | 339 | Crystal Structure Of Apo Glyceraldehyde-3-Phosphate | 1e-28 | ||
| 3k73_Q | 336 | Crystal Structure Of Phosphate Bound Holo Glycerald | 1e-28 | ||
| 3vaz_P | 344 | Crystal Structure Of Staphylococcal Gapdh1 In A Hex | 1e-28 | ||
| 3lvf_P | 338 | Crystal Structure Of Holo Glyceraldehyde-3-Phosphat | 1e-28 | ||
| 3lc1_P | 336 | Crystal Structure Of H178n Mutant Of Glyceraldehyde | 1e-27 | ||
| 3hq4_R | 336 | Crystal Structure Of C151s Mutant Of Glyceraldehyde | 1e-27 | ||
| 3k9q_Q | 336 | Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde | 2e-27 | ||
| 3ksd_Q | 336 | Crystal Structure Of C151s+h178n Mutant Of Glyceral | 1e-26 |
| >pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 | Back alignment and structure |
|
| >pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 | Back alignment and structure |
| >pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 | Back alignment and structure |
| >pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 | Back alignment and structure |
| >pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 | Back alignment and structure |
| >pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 | Back alignment and structure |
| >pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 | Back alignment and structure |
| >pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 | Back alignment and structure |
| >pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 | Back alignment and structure |
| >pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 | Back alignment and structure |
| >pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 | Back alignment and structure |
| >pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 | Back alignment and structure |
| >pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 | Back alignment and structure |
| >pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 | Back alignment and structure |
| >pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 | Back alignment and structure |
| >pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 | Back alignment and structure |
| >pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 | Back alignment and structure |
| >pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 | Back alignment and structure |
| >pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 | Back alignment and structure |
| >pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 | Back alignment and structure |
| >pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 | Back alignment and structure |
| >pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 | Back alignment and structure |
| >pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 | Back alignment and structure |
| >pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 | Back alignment and structure |
| >pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 | Back alignment and structure |
| >pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 | Back alignment and structure |
| >pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 | Back alignment and structure |
| >pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 | Back alignment and structure |
| >pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 | Back alignment and structure |
| >pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 | Back alignment and structure |
| >pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 | Back alignment and structure |
| >pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 | Back alignment and structure |
| >pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 | Back alignment and structure |
| >pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 | Back alignment and structure |
| >pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 | Back alignment and structure |
| >pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 | Back alignment and structure |
| >pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 | Back alignment and structure |
| >pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 | Back alignment and structure |
| >pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 | Back alignment and structure |
| >pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 | Back alignment and structure |
| >pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 | Back alignment and structure |
| >pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 | Back alignment and structure |
| >pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 | Back alignment and structure |
| >pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 | Back alignment and structure |
| >pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 | Back alignment and structure |
| >pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 | Back alignment and structure |
| >pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 | Back alignment and structure |
| >pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 | Back alignment and structure |
| >pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 | Back alignment and structure |
| >pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 | Back alignment and structure |
| >pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 | Back alignment and structure |
| >pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 | Back alignment and structure |
| >pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 | Back alignment and structure |
| >pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 | Back alignment and structure |
| >pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 | Back alignment and structure |
| >pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 | Back alignment and structure |
| >pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 | Back alignment and structure |
| >pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 | Back alignment and structure |
| >pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 | Back alignment and structure |
| >pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 | Back alignment and structure |
|---|
Score = 487 bits (1257), Expect = e-176
Identities = 220/238 (92%), Positives = 229/238 (96%)
Query: 56 TGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNCL 115
TGVFVDR+GAGKH+QAGAKKVLITAPGKGDIPTYVVGVN + Y + IISNASCTTNCL
Sbjct: 99 TGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCL 158
Query: 116 APFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVA 175
APFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAVA
Sbjct: 159 APFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVA 218
Query: 176 LVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCD 235
LVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCD
Sbjct: 219 LVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCD 278
Query: 236 EPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 293
EPLVS+DFRC+DVSST+DSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN W+
Sbjct: 279 EPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ 336
|
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 | Back alignment and structure |
|---|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 | Back alignment and structure |
|---|
| >3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 | Back alignment and structure |
|---|
| >4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 | Back alignment and structure |
|---|
| >2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 | Back alignment and structure |
|---|
| >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 | Back alignment and structure |
|---|
| >3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 | Back alignment and structure |
|---|
| >3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 | Back alignment and structure |
|---|
| >2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 | Back alignment and structure |
|---|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 293 | |||
| 4dib_A | 345 | GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n | 100.0 | |
| 3doc_A | 335 | Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, | 100.0 | |
| 3h9e_O | 346 | Glyceraldehyde-3-phosphate dehydrogenase, testis-; | 100.0 | |
| 3pym_A | 332 | GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| 3v1y_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 100.0 | |
| 3ids_C | 359 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g | 100.0 | |
| 1obf_O | 335 | Glyceraldehyde 3-phosphate dehydrogenase; glycolyt | 100.0 | |
| 3hja_A | 356 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n | 100.0 | |
| 3lvf_P | 338 | GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| 2b4r_O | 345 | Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st | 100.0 | |
| 2ep7_A | 342 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o | 100.0 | |
| 2g82_O | 331 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G | 100.0 | |
| 2d2i_A | 380 | Glyceraldehyde 3-phosphate dehydrogenase; rossmann | 100.0 | |
| 1rm4_O | 337 | Glyceraldehyde 3-phosphate dehydrogenase A; rossma | 100.0 | |
| 3b1j_A | 339 | Glyceraldehyde 3-phosphate dehydrogenase (NADP+); | 100.0 | |
| 3cmc_O | 334 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m | 100.0 | |
| 1hdg_O | 332 | Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o | 100.0 | |
| 3cps_A | 354 | Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g | 100.0 | |
| 2x5j_O | 339 | E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid | 100.0 | |
| 1gad_O | 330 | D-glyceraldehyde-3-phosphate dehydrogenase; oxidor | 100.0 | |
| 3e5r_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 100.0 | |
| 1u8f_O | 335 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l | 100.0 | |
| 2yv3_A | 331 | Aspartate-semialdehyde dehydrogenase; aspartate pa | 100.0 | |
| 2yyy_A | 343 | Glyceraldehyde-3-phosphate dehydrogenase; glyceral | 100.0 | |
| 2hjs_A | 340 | USG-1 protein homolog; aspartate-semialdehyde dehy | 100.0 | |
| 2r00_A | 336 | Aspartate-semialdehyde dehydrogenase; conformation | 100.0 | |
| 1t4b_A | 367 | Aspartate-semialdehyde dehydrogenase; asadh, HOSR, | 100.0 | |
| 3tz6_A | 344 | Aspartate-semialdehyde dehydrogenase; asadh, ASD, | 100.0 | |
| 1cf2_P | 337 | Protein (glyceraldehyde-3-phosphate dehydrogenase) | 100.0 | |
| 3pwk_A | 366 | Aspartate-semialdehyde dehydrogenase; NADP binding | 100.0 | |
| 3uw3_A | 377 | Aspartate-semialdehyde dehydrogenase; structural g | 100.0 | |
| 3pzr_A | 370 | Aspartate-semialdehyde dehydrogenase; NADP, oxidor | 100.0 | |
| 4dpk_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 100.0 | |
| 4dpl_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 100.0 | |
| 1b7g_O | 340 | Protein (glyceraldehyde 3-phosphate dehydrogenase; | 100.0 | |
| 1xyg_A | 359 | Putative N-acetyl-gamma-glutamyl-phosphate reduct; | 100.0 | |
| 2ep5_A | 350 | 350AA long hypothetical aspartate-semialdehyde deh | 100.0 | |
| 3hsk_A | 381 | Aspartate-semialdehyde dehydrogenase; candida albi | 100.0 | |
| 3dr3_A | 337 | N-acetyl-gamma-glutamyl-phosphate reductase; csgid | 100.0 | |
| 2czc_A | 334 | Glyceraldehyde-3-phosphate dehydrogenase; glycolys | 100.0 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 100.0 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 100.0 | |
| 2nqt_A | 352 | N-acetyl-gamma-glutamyl-phosphate reductase; apopr | 99.97 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 99.94 | |
| 1nvm_B | 312 | Acetaldehyde dehydrogenase (acylating), 4-hydroxy- | 97.78 |
| >4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-99 Score=721.37 Aligned_cols=270 Identities=52% Similarity=0.808 Sum_probs=249.1
Q ss_pred CCceeEECCEEEEEEEeecccccccCCC--CCcEEEeccCCCCCHhhHHHHHHcCCCcEEecCCCCCCCCeEEecCCcCC
Q 022704 20 ASLKPMLNQLVLMASLLMARSSRLFLTA--TPSISPGGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADA 97 (293)
Q Consensus 20 ~g~~~~f~g~~~~v~~~~~~~~~~f~~~--~~DivlestG~~~s~~~a~~hl~aGakkVVIs~ps~~dvPlvVpgVN~~~ 97 (293)
.|++|.|+|++++| +++++++.++|. |+||||||||.|+++++|++|+++||||||||+|+++|+||||||||++.
T Consensus 63 ~~~~l~inGk~I~v--~~e~dp~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViISaps~~d~p~vV~gVN~~~ 140 (345)
T 4dib_A 63 FEDHLLVDGKMIRL--LNNRDPKELPWTDLGVEVVIEATGKFNSKEKAILHVEAGAKKVILTAPGKNEDVTIVVGVNEDQ 140 (345)
T ss_dssp CSSEEEETTEEEEE--ECCSCGGGSCTTTTTEEEEEECSSSCCBHHHHTHHHHTTCSEEEESSCCBSCSEECCTTTTGGG
T ss_pred cCCEEEECCEEEEE--eecCChhhCCccccCccEEEEeccCcCCHHHHHHHHHCCCCEEEECCCCCCCCCEEEecCCHHH
Confidence 58899999999877 566778888888 99999999999999999999999999999999999768999999999999
Q ss_pred CCC-CCCeeeCCCcchhhhhhHHHHHhhhcCccEEEEeeecccccchhhhccchhhHHhhhhcccccccCCCchHHHHHH
Q 022704 98 YKP-DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL 176 (293)
Q Consensus 98 ~~~-~~~IISn~sCtTn~lap~lk~L~~~fgI~~~~~TT~havsg~q~~~d~~~~d~r~~r~~a~NIIP~~tGa~k~~~k 176 (293)
|++ +++||||||||||||+|++|+|||+|||++++||||||+|++|+++|+++++||++|++++||||++||++|+++|
T Consensus 141 ~~~~~~~IISNaSCTTn~Lap~lkvL~d~fGI~~g~mTTvhA~T~~Q~~~D~p~kd~r~~r~aa~NIIP~~tGaakav~k 220 (345)
T 4dib_A 141 LDITKHTVISNASCTTNCLAPVVKVLDEQFGIENGLMTTVHAYTNDQKNIDNPHKDLRRARACGQSIIPTTTGAAKALAK 220 (345)
T ss_dssp CCTTTCSEEECCCHHHHHHHHHHHHHHHHHCEEEEEEEEEECC-------------CCTTSCTTTCCEEECCTHHHHHHH
T ss_pred cCcccCeEEECCchhhhhhHHHHHHHHHhcCeEEEEEEeeeeccCCceeccccccccccchhhhhceecCCCchHHHHhh
Confidence 987 6899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HccccCCCeeEEEEecCCCeeeEEEEEEEecCcCcHHHHHHHHHHcccccccCcccccCCCceeccCCCCCceeeEeCCC
Q 022704 177 VLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDSSL 256 (293)
Q Consensus 177 vlPeL~gkv~~tavRVPV~~gs~~dltv~~~k~v~~eei~~~l~~a~~~~lkgil~~te~~~VS~D~~~~~~s~i~d~~~ 256 (293)
+||+|+||++|+|+||||++||++||+++++|++++|||+++|++|+||+|||||+|+|+|+||+||+||+||+|||+.+
T Consensus 221 VlPeL~gkltg~avRVPv~~~s~~dlt~~lek~~t~eei~~~lk~As~g~lkgil~yte~~~VS~Df~~~~~ssi~d~~~ 300 (345)
T 4dib_A 221 VLPHLNGKLHGMALRVPTPNVSLVDLVVDVKRDVTVEAINDAFKTVANGALKGIVEFSEEPLVSIDFNTNTHSAIIDGLS 300 (345)
T ss_dssp HCGGGTTTEEEEEEECCCSSEEEEEEEEEESSCCCHHHHHHHHHHHHTTTTTTTEEEECSCCCGGGGTTCCCSEEEEGGG
T ss_pred hccccCCcEEEEEEEccCcccEEEEEEEEECCCCCHHHHHHHHHHhhcCcccceeeeEcCcEeeeecCCCCcchhhhhhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceeeCCceEEEEEEeCCCCchhhhHHHHHHHHhcc
Q 022704 257 TLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN 291 (293)
Q Consensus 257 t~~~~~~~vkl~~WyDNE~gys~r~~dl~~~~~~~ 291 (293)
|++++++++||++||||||||||||+||+.||+++
T Consensus 301 t~~~~~~~vk~~~WYDNE~Gys~r~~dl~~~~~~~ 335 (345)
T 4dib_A 301 TMVMGDRKVKVLAWYDNEWGYSRRVVDLVTLVVDE 335 (345)
T ss_dssp CEEETTTEEEEEEEEETTHHHHHHHHHHHHHHHHH
T ss_pred cEEECCCEEEEEEEECCCcchHHHHHHHHHHHHhh
Confidence 99999999999999999999999999999999874
|
| >3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* | Back alignment and structure |
|---|
| >3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* | Back alignment and structure |
|---|
| >3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O | Back alignment and structure |
|---|
| >3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} | Back alignment and structure |
|---|
| >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* | Back alignment and structure |
|---|
| >2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* | Back alignment and structure |
|---|
| >2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* | Back alignment and structure |
|---|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A | Back alignment and structure |
|---|
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* | Back alignment and structure |
|---|
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* | Back alignment and structure |
|---|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 | Back alignment and structure |
|---|
| >2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* | Back alignment and structure |
|---|
| >1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* | Back alignment and structure |
|---|
| >3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A | Back alignment and structure |
|---|
| >3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A | Back alignment and structure |
|---|
| >4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* | Back alignment and structure |
|---|
| >4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A | Back alignment and structure |
|---|
| >2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} | Back alignment and structure |
|---|
| >3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 293 | ||||
| d1rm4a2 | 163 | d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de | 5e-79 | |
| d3cmco2 | 163 | d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de | 2e-77 | |
| d1u8fo2 | 164 | d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de | 3e-73 | |
| d1obfo2 | 162 | d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de | 6e-69 | |
| d2g82a2 | 162 | d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de | 3e-65 | |
| d1k3ta2 | 169 | d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de | 2e-59 | |
| d1b7go2 | 162 | d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de | 4e-37 | |
| d1cf2o2 | 165 | d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de | 1e-35 | |
| d1cf2o1 | 171 | c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp | 3e-26 | |
| d1dssg1 | 169 | c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp | 2e-23 | |
| d2czca2 | 172 | c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp | 4e-23 | |
| d1rm4a1 | 172 | c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp | 2e-22 | |
| d1u8fo1 | 169 | c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp | 6e-22 | |
| d1k3ta1 | 190 | c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp | 4e-21 | |
| d1hdgo1 | 169 | c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp | 2e-20 | |
| d3cmco1 | 171 | c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp | 3e-20 | |
| d1gado1 | 166 | c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp | 7e-20 | |
| d2g82a1 | 168 | c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp | 9e-19 | |
| d1obfo1 | 173 | c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp | 5e-18 | |
| d2b4ro1 | 166 | c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp | 6e-18 | |
| d1b7go1 | 178 | c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp | 1e-17 | |
| d2czca1 | 162 | d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate de | 1e-04 |
| >d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FwdE/GAPDH domain-like superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain family: GAPDH-like domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) species: Spinach (Spinacia oleracea) [TaxId: 3562]
Score = 234 bits (599), Expect = 5e-79
Identities = 157/163 (96%), Positives = 161/163 (98%)
Query: 110 CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG 169
CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTG
Sbjct: 1 CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTG 60
Query: 170 AAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKG 229
AAKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKG
Sbjct: 61 AAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKG 120
Query: 230 ILSVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYD 272
ILSVCDEPLVS+DFRC+DVSST+DSSLT+VMGDDMVKVIAWYD
Sbjct: 121 ILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYD 163
|
| >d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 | Back information, alignment and structure |
|---|
| >d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 | Back information, alignment and structure |
|---|
| >d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 | Back information, alignment and structure |
|---|
| >d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 | Back information, alignment and structure |
|---|
| >d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 | Back information, alignment and structure |
|---|
| >d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 | Back information, alignment and structure |
|---|
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 | Back information, alignment and structure |
|---|
| >d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 | Back information, alignment and structure |
|---|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 | Back information, alignment and structure |
|---|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 | Back information, alignment and structure |
|---|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 | Back information, alignment and structure |
|---|
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 | Back information, alignment and structure |
|---|
| >d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 162 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 293 | |||
| d3cmco2 | 163 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1rm4a2 | 163 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1u8fo2 | 164 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2g82a2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1obfo2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1k3ta2 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1dssg1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.96 | |
| d3cmco1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.95 | |
| d1cf2o2 | 165 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.95 | |
| d1k3ta1 | 190 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.95 | |
| d1mb4a2 | 222 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 99.95 | |
| d1t4ba2 | 221 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 99.95 | |
| d1gado1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.94 | |
| d1b7go2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.94 | |
| d1rm4a1 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.94 | |
| d2g82a1 | 168 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.93 | |
| d1u8fo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.93 | |
| d2b4ro1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.93 | |
| d1hdgo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.93 | |
| d2hjsa2 | 190 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 99.92 | |
| d1obfo1 | 173 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.91 | |
| d2gz1a2 | 202 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 99.91 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.86 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.86 | |
| d1cf2o1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.86 | |
| d2czca1 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.78 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 99.7 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 99.67 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 99.38 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 99.34 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 99.16 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 98.9 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 98.84 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 98.73 | |
| d2g17a2 | 155 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 96.58 | |
| d2cvoa2 | 165 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 95.36 | |
| d1vkna2 | 163 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 89.28 |
| >d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FwdE/GAPDH domain-like superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain family: GAPDH-like domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) species: Bacillus stearothermophilus, nca 1503 [TaxId: 1422]
Probab=100.00 E-value=1.1e-63 Score=428.79 Aligned_cols=163 Identities=67% Similarity=1.040 Sum_probs=162.2
Q ss_pred cchhhhhhHHHHHhhhcCccEEEEeeecccccchhhhccchhhHHhhhhcccccccCCCchHHHHHHHccccCCCeeEEE
Q 022704 110 CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIA 189 (293)
Q Consensus 110 CtTn~lap~lk~L~~~fgI~~~~~TT~havsg~q~~~d~~~~d~r~~r~~a~NIIP~~tGa~k~~~kvlPeL~gkv~~ta 189 (293)
||||||||++|+||++|||++++|||+||||++|+++|++|+|+||+|++++||||++||++|+++++||+|+||++|++
T Consensus 1 CTTNclaP~~kvl~~~fgI~~g~mTTvHa~T~~Q~l~D~~~~d~Rr~Raa~~niIPtsTgAakav~~vlP~L~gkl~g~a 80 (163)
T d3cmco2 1 CTTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDQRILDLPHKDLRRARAAAESIIPTTTGAAKAVALVLPELKGKLNGMA 80 (163)
T ss_dssp HHHHHHHHHHHHHHHHHCEEEEEEEEEEECCTTSBSSSCCCSSTTTTSBTTTCCEEEECSHHHHHHHHCGGGTTTEEEEE
T ss_pred ChhHHHHHHHHHHHhhcCeeEEEEEeeccccCcccCCCCCCcchhccchHhhCCCCccccHHHHHHHhhHHhCCCcceEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EecCCCeeeEEEEEEEecCcCcHHHHHHHHHHcccccccCcccccCCCceeccCCCCCceeeEeCCCceeeCCceEEEEE
Q 022704 190 LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIA 269 (293)
Q Consensus 190 vRVPV~~gs~~dltv~~~k~v~~eei~~~l~~a~~~~lkgil~~te~~~VS~D~~~~~~s~i~d~~~t~~~~~~~vkl~~ 269 (293)
+||||++||++||+++++|++++||||++|+++++++|||||+|++||+||+||+|++||+|||+.+|++++++++|+++
T Consensus 81 ~RVPt~~vS~vDlt~~l~k~~t~e~in~~~k~as~~~lkgil~~t~~plVSsDf~g~~~SsI~D~~~t~v~~~~~vKv~a 160 (163)
T d3cmco2 81 MRVPTPNVSVVDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEEPLVSRDYNGSTVSSTIDALSTMVIDGKMVKVVS 160 (163)
T ss_dssp EEESCSSCEEEEEEEEESSCCCHHHHHHHHHHHHHTTTTTTEEEECSCCCGGGGTTCCSSEEEEGGGCEEETTTEEEEEE
T ss_pred EecCCCcceeEEEEEEecCcCCHHHHHHHHHHHhcCCccCcceeeecccchhhccCCCccEEEEcccCEEECCCEEEEEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EeC
Q 022704 270 WYD 272 (293)
Q Consensus 270 WyD 272 (293)
|||
T Consensus 161 WYD 163 (163)
T d3cmco2 161 WYD 163 (163)
T ss_dssp EEC
T ss_pred EeC
Confidence 998
|
| >d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} | Back information, alignment and structure |
|---|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2cvoa2 d.81.1.1 (A:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|