Citrus Sinensis ID: 022776

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MKSEIVAQELIHLLDAAKSDMVVGLKLREASLLKLMLEYTDDQLADFMAWFDLLRQKPKDGEPKSIEVSAFLDERAFLWNQYKVMENDLTSKINSKRAEVDRANERIEKLLASTEQLQLSNNEKDETIAKLKTQIAQMETGSKKWNTEISRLTQELELLRKSRTASDTPVLNRCTRIAGATTSNAGDSVQNRSSTAGIKGRLRKSGSSSVTPLSNYSTTTAQSLGGKNGDNVVVNKQMPAAQVPLHVDSEKGTRSSKRKAVDVIPILDTPKLFSSKFKVPKLKNSFPHLNVR
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccEcccccccccccccc
MKSEIVAQELIHLLDAAKSDMVVGLKLREASLLKLMLEYTDDQLADFMAWFDLLrqkpkdgepksiEVSAFLDERAFLWNQYKVMENDLTSKINSKRAEVDRANERIEKLLASTEQLQLSNNEKDETIAKLKTQIAQMETGSKKWNTEISRLTQELELLRksrtasdtpvlnrctriagattsnagdsvqnrsstagikgrlrksgsssvtplsnystttaqslggkngdnvvvnkqmpaaqvplhvdsekgtrsskrkavdvipildtpklfsskfkvpklknsfphlnvr
MKSEIVAQELIHlldaaksdmVVGLKLREASLLKLMLEYTDDQLADFMAWFDLLRQKPKDGEPKSIEVSAFLDERAFLWNQYKVmendltskinskraevDRANERIEKLLAsteqlqlsnnekDETIAKLKTQIAqmetgskkwntEISRLTQELELLrksrtasdtpvlnrCTRIagattsnagdsvqnrsstagikgrlrksgsssvtplsnystttaqslggkNGDNVVVNKQMpaaqvplhvdsekgtrsskrkavdvipildtpklfsskfkvpklknsfphlnvr
MKSEIVAQELIHLLDAAKSDMVVGLKLREASLLKLMLEYTDDQLADFMAWFDLLRQKPKDGEPKSIEVSAFLDERAFLWNQYKVMENDLTSKINSKRAEVDRANERIEKLLASTEQLQLSNNEKDETIAKLKTQIAQMETGSKKWNTEISRLTQELELLRKSRTASDTPVLNRCTRIAGATTSNAGDSVQNRSSTAGIKGRLRKSGSSSVTPLSNYSTTTAQSLGGKNGDNVVVNKQMPAAQVPLHVDSEKGTRSSKRKAVDVIPILDTPKLFSSKFKVPKLKNSFPHLNVR
*****VAQELIHLLDAAKSDMVVGLKLREASLLKLMLEYTDDQLADFMAWFDLLRQ*********IEVSAFLDERAFLWNQYKVMEND****************************************************************************************************************************************************************************VDVIPILDTPKLF*******************
******************************************************************************WNQYKVME**************************************************************************************************************************************************************************************************************
MKSEIVAQELIHLLDAAKSDMVVGLKLREASLLKLMLEYTDDQLADFMAWFDLLRQKPKDGEPKSIEVSAFLDERAFLWNQYKVMENDLTSKINSKRAEVDRANERIEKLLASTEQLQLSNNEKDETIAKLKTQIAQMETGSKKWNTEISRLTQELELLRKSRTASDTPVLNRCTRIAGATT***********STAG****************SNYSTTTAQSLGGKNGDNVVVNKQMPAAQVPLH*************AVDVIPILDTPKLFSSKFKVPKLKNSFPHLNVR
**SEIVAQELIHLLDAAKSDMVVGLKLREASLLKLMLEYTDDQLADFMAWFDLLRQKPKDGEPKSIEVSAFLDERAFLWNQYKVMENDLTSKINSKRAEVDRANERIEKLLASTEQLQLSNNEKDETIAKLKTQIAQMETGSKKWNTEISRLTQEL*L***************************************IKG*****************************************************************ILDTPKLFSSKFKVPKLKNSF******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSEIVAQELIHLLDAAKSDMVVGLKLREASLLKLMLEYTDDQLADFMAWFDLLRQKPKDGEPKSIEVSAFLDERAFLWNQYKVMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNEKDETIAKLKTQIAQMETGxxxxxxxxxxxxxxxxxxxxxRTASDTPVLNRCTRIAGATTSNAGDSVQNRSSTAGIKGRLRKSGSSSVTPLSNYSTTTAQSLGGKNGDNVVVNKQMPAAQVPLHVDSEKGTRSSKRKAVDVIPILDTPKLFSSKFKVPKLKNSFPHLNVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
359492238379 PREDICTED: uncharacterized protein LOC10 0.845 0.651 0.377 4e-50
224083008357 predicted protein [Populus trichocarpa] 0.825 0.675 0.388 2e-46
118484708357 unknown [Populus trichocarpa] 0.808 0.661 0.394 4e-46
255538940354 conserved hypothetical protein [Ricinus 0.842 0.694 0.408 2e-45
356558093383 PREDICTED: uncharacterized protein LOC10 0.845 0.644 0.375 7e-40
224065885277 predicted protein [Populus trichocarpa] 0.787 0.830 0.368 2e-39
449437422365 PREDICTED: uncharacterized protein LOC10 0.808 0.646 0.346 1e-36
15223725342 cytomatrix protein-like protein [Arabido 0.804 0.687 0.342 5e-34
356533159226 PREDICTED: uncharacterized protein LOC10 0.619 0.800 0.428 2e-33
297844962 656 hypothetical protein ARALYDRAFT_312926 [ 0.801 0.356 0.335 3e-33
>gi|359492238|ref|XP_002279957.2| PREDICTED: uncharacterized protein LOC100259217 [Vitis vinifera] gi|302142661|emb|CBI19864.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 182/352 (51%), Gaps = 105/352 (29%)

Query: 1   MKSEIVAQELIHLLDAAKSDMVVGLKLREASLLKLMLEYTDDQLADFMAWFDLLRQKPKD 60
           M+ +   QE   L++AAKSD+++GLK RE SL KL LE TDD+L DF    D L  +  D
Sbjct: 69  MEMKFTVQEKERLVEAAKSDLLMGLKKREVSLCKLKLESTDDELVDFKVLIDFLSHECLD 128

Query: 61  -------------------------------------GEPK-------------SIEVSA 70
                                                GE +             S EVSA
Sbjct: 129 PNGISKVGDKEKGSRGDNNLKSVKTTKEEEQCAKRLEGEVRKLKWEYENLASRNSAEVSA 188

Query: 71  FLDERAFLWNQYKVMENDLTSKINSKRAEVDRANERIEKLLASTEQLQLSNNEKDETIAK 130
            L E+ F+WNQYK+ME++ ++K+NSK  EV++ANE+I+ LL   EQL+  NNEKD+ I K
Sbjct: 189 LLAEQNFVWNQYKIMESNYSNKLNSKHVEVEQANEKIDNLLVGMEQLESLNNEKDDKIVK 248

Query: 131 LKTQIAQMETGSKKWNTEISRLTQELELLRKSRTASDTPVLNRCTRIAGATTSNAGDSVQ 190
           LKT +A+MET +KK N EISRL++E+ELLRKSR+AS TP+LNRCT               
Sbjct: 249 LKTDLAKMETETKKKNEEISRLSKEVELLRKSRSASVTPILNRCTE-------------- 294

Query: 191 NRSSTAGIKGRLRKSGSSSVTPLSNYSTTTAQSLGGKN----GDNVVVNKQMPAAQVPL- 245
            +  T+G                            GKN    G N+ + K+ PA++    
Sbjct: 295 -KQKTSG---------------------------QGKNKSWIGRNISIKKETPASEKNTE 326

Query: 246 --------HVDSEKGTRSSKRKAVDVIPILDTPKLFSSKFKVPKLKNSFPHL 289
                     ++EK +R SKRK ++V P  +TP+LF+S FK+PKLKNS P +
Sbjct: 327 KKKESSVSEKNTEKKSRGSKRKEINVTPTSETPRLFTSTFKIPKLKNSSPQI 378

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224083008|ref|XP_002306928.1| predicted protein [Populus trichocarpa] gi|222856377|gb|EEE93924.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118484708|gb|ABK94224.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255538940|ref|XP_002510535.1| conserved hypothetical protein [Ricinus communis] gi|223551236|gb|EEF52722.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356558093|ref|XP_003547342.1| PREDICTED: uncharacterized protein LOC100802663 [Glycine max] Back     alignment and taxonomy information
>gi|224065885|ref|XP_002301978.1| predicted protein [Populus trichocarpa] gi|222843704|gb|EEE81251.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449437422|ref|XP_004136491.1| PREDICTED: uncharacterized protein LOC101222062 [Cucumis sativus] gi|449505782|ref|XP_004162567.1| PREDICTED: uncharacterized LOC101222062 [Cucumis sativus] Back     alignment and taxonomy information
>gi|15223725|ref|NP_173427.1| cytomatrix protein-like protein [Arabidopsis thaliana] gi|28392994|gb|AAO41932.1| unknown protein [Arabidopsis thaliana] gi|28827278|gb|AAO50483.1| unknown protein [Arabidopsis thaliana] gi|332191798|gb|AEE29919.1| cytomatrix protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356533159|ref|XP_003535135.1| PREDICTED: uncharacterized protein LOC100812121 [Glycine max] Back     alignment and taxonomy information
>gi|297844962|ref|XP_002890362.1| hypothetical protein ARALYDRAFT_312926 [Arabidopsis lyrata subsp. lyrata] gi|297336204|gb|EFH66621.1| hypothetical protein ARALYDRAFT_312926 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
TAIR|locus:2198586342 AT1G19980 "AT1G19980" [Arabido 0.510 0.435 0.408 2.9e-25
UNIPROTKB|Q9X0R4 1170 smc "Chromosome partition prot 0.476 0.118 0.25 0.00055
TAIR|locus:2198586 AT1G19980 "AT1G19980" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 287 (106.1 bits), Expect = 2.9e-25, P = 2.9e-25
 Identities = 65/159 (40%), Positives = 100/159 (62%)

Query:    64 KSIEVSAFLDERAFLWNQYKVMENDLTSKINSKRAEVDRANERIEKLLASTEQLQLSNNE 123
             K  EVS  L E  F WNQ+K +E++ T K+  K  E+ +AN +I  L++  EQLQ SN E
Sbjct:   161 KKCEVSDLLRENGFAWNQFKCIESEFTDKLKRKDDEIVQANTKISSLISYQEQLQSSNQE 220

Query:   124 KDETIAKLKTQIAQMETGSKKWNTEISRLTQELELLRKSRTASDTPVLNRCTRIAGATTS 183
             KDETI++LK ++A+MET S K + EIS+LT++LE  +KSR    TPVL RCT++   +  
Sbjct:   221 KDETISRLKAKMAEMETNSTKKDEEISKLTRDLESAKKSR--GFTPVLTRCTKLEKRSNG 278

Query:   184 NA-GDSV---QNRSSTAGIKGRLRKSG----SSSVTPLS 214
             N  G  +   +++S+ +    ++ KS     + ++TP+S
Sbjct:   279 NTVGSHISTKKDKSAASTTNEKVSKSSKRKRAKNMTPVS 317
GO:0003674 "molecular_function" evidence=ND
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|Q9X0R4 smc "Chromosome partition protein Smc" [Thermotoga maritima MSB8 (taxid:243274)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_V1787
SubName- Full=Putative uncharacterized protein; (357 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 292
KOG4673 961 consensus Transcription factor TMF, TATA element m 95.15
PHA02562562 46 endonuclease subunit; Provisional 93.78
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 93.69
PRK11637428 AmiB activator; Provisional 93.42
KOG0996 1293 consensus Structural maintenance of chromosome pro 93.15
COG2433652 Uncharacterized conserved protein [Function unknow 92.77
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 92.57
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 92.2
PF13863126 DUF4200: Domain of unknown function (DUF4200) 91.29
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 91.28
KOG0963 629 consensus Transcription factor/CCAAT displacement 90.3
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 90.27
PHA02562 562 46 endonuclease subunit; Provisional 90.16
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 90.11
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 89.92
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 89.89
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 89.63
PRK11637 428 AmiB activator; Provisional 89.01
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 88.18
PF05010207 TACC: Transforming acidic coiled-coil-containing p 87.89
COG3883265 Uncharacterized protein conserved in bacteria [Fun 87.64
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 87.58
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 87.48
PRK09039343 hypothetical protein; Validated 87.26
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 87.15
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 86.28
KOG4807593 consensus F-actin binding protein, regulates actin 85.63
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 85.46
KOG0933 1174 consensus Structural maintenance of chromosome pro 85.22
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 85.06
PF05701522 WEMBL: Weak chloroplast movement under blue light; 84.8
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 84.68
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 84.35
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 84.21
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 84.06
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 83.82
PF00038312 Filament: Intermediate filament protein; InterPro: 83.66
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 83.42
PF09403126 FadA: Adhesion protein FadA; InterPro: IPR018543 F 83.29
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 82.81
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 82.77
KOG2751447 consensus Beclin-like protein [Signal transduction 82.4
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 82.24
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 81.93
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 81.88
PF10186302 Atg14: UV radiation resistance protein and autopha 81.64
smart0033865 BRLZ basic region leucin zipper. 80.9
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 80.49
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information 
Probab=95.15  E-value=0.13  Score=54.77  Aligned_cols=99  Identities=25%  Similarity=0.313  Sum_probs=83.5

Q ss_pred             ccchhhhhhhhhhhhhhhhHHhhhhhHHHhhhhhHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhHHHHHHHHHHhhhhcc
Q 022776           63 PKSIEVSAFLDERAFLWNQYKVMENDLTSKINSKRAEVDRANERIEKLLASTEQLQLSNNEKDETIAKLKTQIAQMETGS  142 (292)
Q Consensus        63 eK~kEVsALLaEKdFVWNQ~k~ME~Dyt~~LK~K~~EvaQAnE~iqKLlq~~E~LQs~nqeKDdeI~RLqaKlaeMe~~~  142 (292)
                      .-.+-|+|+.+|+|-+--|.|.+-..++..|.+  .|.+--+|-|.-|...=|.|--.----..+|.+|.||..+-+++.
T Consensus       413 ~lEkKvqa~~kERDalr~e~kslk~ela~~l~~--DeLaEkdE~I~~lm~EGEkLSK~ql~qs~iIkKLRAk~ke~etl~  490 (961)
T KOG4673|consen  413 TLEKKVQALTKERDALRREQKSLKKELAAALLK--DELAEKDEIINQLMAEGEKLSKKQLAQSAIIKKLRAKIKEAETLE  490 (961)
T ss_pred             HHHHHHHHHHHhHHHHHHHHHHHHHHHHHhhhh--HHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhhhhhHHH
Confidence            456779999999999999999998888888877  788888888888888877764222222578999999999999999


Q ss_pred             cchhhHHHHHHHHHHHHHhhc
Q 022776          143 KKWNTEISRLTQELELLRKSR  163 (292)
Q Consensus       143 Kkk~eEIs~L~~ELe~lrksr  163 (292)
                      +++.+-|.+|.-|++.|+.+-
T Consensus       491 ~K~ge~i~~L~sE~~~lk~il  511 (961)
T KOG4673|consen  491 EKKGELITKLQSEENKLKSIL  511 (961)
T ss_pred             HHhhhHHHHHHHHHHHHHHHh
Confidence            999999999999999998764

>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 52.9 bits (126), Expect = 5e-08
 Identities = 37/253 (14%), Positives = 70/253 (27%), Gaps = 72/253 (28%)

Query: 1   MKSEIVAQE------LIHLLDAAKSDMVVG-----LK--LREASLLKLMLEYTDDQLADF 47
           M  E    +      L    DA   +          K  L +  +  +++          
Sbjct: 7   MDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLR 66

Query: 48  MAWFDLLRQKPKDGEPKSIEVSAFLDER-----AFLWNQYKVMEND---LTSKINSKRAE 99
           +  F  L  K ++       V  F++E       FL +  K  +     +T     +R  
Sbjct: 67  L--FWTLLSKQEEM------VQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDR 118

Query: 100 VDRANERIEKLLASTEQLQLSNNEKDETIAKLKTQIAQME----------TGSKKWNTEI 149
           +   N+   K           N  + +   KL+  + ++            GS K     
Sbjct: 119 LYNDNQVFAKY----------NVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGK----- 163

Query: 150 SRLT----QELELLRK----------SRTASDTPVL----NRCTRIAGATTSNAGDSVQN 191
           + +        ++  K              S   VL        +I    TS +  S   
Sbjct: 164 TWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNI 223

Query: 192 RSSTAGIKGRLRK 204
           +     I+  LR+
Sbjct: 224 KLRIHSIQAELRR 236
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 95.5
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.13
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 94.61
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 94.06
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 91.92
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 91.26
1zxa_A67 CGMP-dependent protein kinase 1, alpha isozyme; pa 91.25
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 91.08
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 87.72
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 87.4
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 86.79
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 86.12
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 85.68
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 85.61
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 85.0
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 84.93
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 84.78
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 83.51
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 83.31
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 82.11
2p2u_A171 HOST-nuclease inhibitor protein GAM, putative; str 82.08
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 81.9
3htk_A60 Structural maintenance of chromosomes protein 5; S 81.45
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 81.07
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 80.89
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 80.15
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
Probab=95.50  E-value=0.015  Score=44.65  Aligned_cols=49  Identities=27%  Similarity=0.279  Sum_probs=42.6

Q ss_pred             HHHHHhhhhhhhhhHHHHHHHHHHhhhhcccchhhHHHHHHHHHHHHHh
Q 022776          113 STEQLQLSNNEKDETIAKLKTQIAQMETGSKKWNTEISRLTQELELLRK  161 (292)
Q Consensus       113 ~~E~LQs~nqeKDdeI~RLqaKlaeMe~~~Kkk~eEIs~L~~ELe~lrk  161 (292)
                      ++.+||..-++|+++|...++.+.+++....+++++|..|..+|-.+|+
T Consensus        20 ti~eLq~~L~~K~eELr~kd~~I~eLEk~L~ekd~eI~~LqseLDKfrS   68 (72)
T 3nmd_A           20 SLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQMLQNELDKYRS   68 (72)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            3678888888999999999989998998889999999999999887754
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>1zxa_A CGMP-dependent protein kinase 1, alpha isozyme; parallel coiled coil dimer, transferase; NMR {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2p2u_A HOST-nuclease inhibitor protein GAM, putative; structural genomics, unknown function, PSI-2, protein structure initiative; 2.75A {Desulfovibrio vulgaris} SCOP: h.4.18.1 Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 80.63
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Prefoldin
family: Prefoldin
domain: Prefoldin beta subunit
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=80.63  E-value=4.2  Score=29.33  Aligned_cols=82  Identities=13%  Similarity=0.229  Sum_probs=53.2

Q ss_pred             hhHHhhhhhHHHhhhhhHHHHHHHHHHHHHHHHHHHHHhh------------hhhhhhhHHHHHHHHHHhhhhcccchhh
Q 022776           80 NQYKVMENDLTSKINSKRAEVDRANERIEKLLASTEQLQL------------SNNEKDETIAKLKTQIAQMETGSKKWNT  147 (292)
Q Consensus        80 NQ~k~ME~Dyt~~LK~K~~EvaQAnE~iqKLlq~~E~LQs------------~nqeKDdeI~RLqaKlaeMe~~~Kkk~e  147 (292)
                      ++|..+..++... ......+...-..+...+..++.+-.            .-+.+++-+..|+.++..++...+..+.
T Consensus         8 ~~~q~lq~el~~~-~~q~~~le~q~~E~~~vl~eL~~l~~d~~vyk~vG~vLv~~~~~e~~~~l~~~~e~l~~~i~~l~~   86 (107)
T d1fxka_           8 AQFQQLQQQAQAI-SVQKQTVEMQINETQKALEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIER   86 (107)
T ss_dssp             HHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHSCTTCCEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHcCCcccHHHHHhcchhhcCcHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4555555555522 22223333333334444555554442            1367889999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhh
Q 022776          148 EISRLTQELELLRKS  162 (292)
Q Consensus       148 EIs~L~~ELe~lrks  162 (292)
                      .+..|..+++.+++.
T Consensus        87 q~~~l~~~l~~~~~~  101 (107)
T d1fxka_          87 QEERVMKKLQEMQVN  101 (107)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
Confidence            999999999888764