Citrus Sinensis ID: 023810


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MASRYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPGPVDDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSGRPHGKVDVKVAVRESRYAPPGAYHTPPYGVPPSGSRDYPAPPPYGYPYGRPPQDPYYATAPPPSGYPYGAYNAPPAYGQPSYGAYGAAPPGGYYGQVEEKKKSKFGGMGTGLAVGAVGGILGGLALAEGVDALEDHIADEAAEKVEDDLGYDGDDF
ccccEEEEEEEEEccccccccccccccccEEEEEEcccccEEcccccccccccccccEEEEEccccccccccEEEEEEEcccccccccEEEEEEEEcccccccccccccEEEEEEEEcccccccEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
cccEEEEEEEEEEcccccccccccccccEEEEEEEccccccccccccccccccccccEEEEEcccHHccccEEEEEEEEccccccccccEEEEEEEHHHHccccccccccEEEEEEEcccccccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MASRYEVEVTITSAkdlknvnwrhgpnrpyavlwvdpnkkcstkvddegdtcpywdetlaiplpgpvdddttLIIDVVHAGNEEDTKKLIGSAKLKLKDVindvglgeraSLTLklkrpsgrphgkvdVKVAVresryappgayhtppygvppsgsrdypapppygypygrppqdpyyatapppsgypygaynappaygqpsygaygaappggyygqveekkkskfggmgtGLAVGAVGGILGGLALAEGVDALEDHIADEAAEKveddlgydgddf
MASRYEVEVTItsakdlknvnwrhgpnrpyavlwvdpnKKCSTKVDDEGDTCPYWDETLAIPLPGPVDDDTTLIIDVVHagneedtkkligsaklklkdvindvglgerasltlklkrpsgrphgkvdvkVAVRESRYAPPGAYHTPPYGVPPSGSRDYPAPPPYGYPYGRPPQDPYYATAPPPSGYPYGAYNAPPAYGQPSYGAYGAAPPGGYYGQVEEKKKSKFGGMGTGLAVGAVGGILGGLALAEGVDALEDHIADEAaekveddlgydgddf
MASRYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPGPvdddttliidvvHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSGRPHGKVDVKVAVRESRYAPPGAYHTPPYGVPPSGSrdypapppygypygrppqdpyyatapppsgypygaynappaygqpsygaygaappggyygQVEEKKKSKFggmgtglavgavggilgglalaegvDALEDHIADEAAEKVEDDLGYDGDDF
*******EVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPGPVDDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASL*******************************************************************************Y*************************************GTGLAVGAVGGILGGLALAEGVDALEDHI*******************
**SRYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPGPVDDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSGRPHGKVDVKVAVRESRYAPPGAYHTPPYG***********************************************************************************AVGAVGGILGGLALAEGVDALEDHIADEAAEKVEDDL*******
********VTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPGPVDDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLK*********VDVKVAVRESRYAPPGAYHTPPYGVPPSGSRDYPAPPPYGYPYGRPPQDPYYATAPPPSGYPYGAYNAPPAYGQPSYGAYGAAPPGGYYGQVEEKKKSKFGGMGTGLAVGAVGGILGGLALAEGVDALEDHIADEAAEKVEDDLGYDGDDF
**SRYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPGPVDDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSGRPHGKVDVKVAVRESRYAPPGAYHTPPYGVPPSGSRDYPAPPPYGYPYGRPPQDPYYATAPPPSGYPYGAYNAPPAYGQPSYGAYGAAPPGGYYGQVEEKKKSKFGGMGTGLAVGAVGGILGGLALAEGVDALEDHIADEAAEKVEDDLGY*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPGPVDDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSGRPHGKVDVKVAVRESRYAPPGAYHTPPYGVPPSGSRDYPAPPPYGYPYGRPPQDPYYATAPPPSGYPYGAYNAPPAYGQPSYGAYGAAPPGGYYGQVEEKKKSKFGGMGTGLAVGAVGGILGGLALAEGVDALEDHIADEAAEKVEDDLGYDGDDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
356530838281 PREDICTED: uncharacterized protein LOC10 0.956 0.943 0.627 1e-87
449485509291 PREDICTED: uncharacterized protein LOC10 0.989 0.941 0.608 1e-82
217073077301 unknown [Medicago truncatula] gi|3885143 0.956 0.880 0.618 6e-82
225464535286 PREDICTED: uncharacterized protein LOC10 0.942 0.912 0.593 7e-77
359490466268 PREDICTED: uncharacterized protein LOC10 0.920 0.951 0.587 3e-75
147836228286 hypothetical protein VITISV_006805 [Viti 0.942 0.912 0.593 1e-73
356561526256 PREDICTED: uncharacterized protein LOC10 0.924 1.0 0.555 9e-71
147859725268 hypothetical protein VITISV_002549 [Viti 0.884 0.914 0.583 4e-70
225464609268 PREDICTED: uncharacterized protein LOC10 0.884 0.914 0.583 1e-69
297808401239 hypothetical protein ARALYDRAFT_910412 [ 0.823 0.953 0.559 9e-68
>gi|356530838|ref|XP_003533986.1| PREDICTED: uncharacterized protein LOC100817630 [Glycine max] Back     alignment and taxonomy information
 Score =  329 bits (843), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 184/293 (62%), Positives = 210/293 (71%), Gaps = 28/293 (9%)

Query: 1   MASRYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLA 60
           M SRYEVE+ ++SA+ LKNVNWRHGPNRPY V+WVDP+ K ST+VD+ GDT   WD+TL 
Sbjct: 1   MGSRYEVELKLSSARALKNVNWRHGPNRPYVVVWVDPSNKLSTRVDESGDTDANWDQTLT 60

Query: 61  IPLPGPVDDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPS 120
           IPLP    +D TL IDVVHAG+EEDTK LIGSA+LKL D+++DVG+GER S TL LKRPS
Sbjct: 61  IPLPPKPLEDQTLYIDVVHAGSEEDTKPLIGSARLKLVDILDDVGIGERVSRTLSLKRPS 120

Query: 121 GRPHGKVDVKVAVRESRYAPPGAYHTPPYGVPPSGSRDYPAPPPYGY----PYGRPPQDP 176
           GRPHGKV+V V +RE  Y   G Y+ PPYGV     RDY +P P GY    PYG PPQ  
Sbjct: 121 GRPHGKVEVSVTIREPSYRAQGGYNAPPYGV-----RDY-SPAPQGYGGYPPYGAPPQQA 174

Query: 177 YYATAPPPSGYPYGA----YNAPPAYGQPSYGAYGAAPPGGYYGQ--------VEEKKKS 224
           YY+   PPSGYPY A    YNAPP   Q  YG Y A P    YGQ         EEKKKS
Sbjct: 175 YYSA--PPSGYPYNAPPQPYNAPP---QSGYG-YNALPQTASYGQGSGYGYAPQEEKKKS 228

Query: 225 KFGGMGTGLAVGAVGGILGGLALAEGVDALEDHIADEAAEKVEDDLGYDGDDF 277
           KFGGMGTGLAVGAV G LGG+AL EG + +ED I D+ AE+VEDDLGYDGDDF
Sbjct: 229 KFGGMGTGLAVGAVAGALGGIALVEGAEYVEDKIEDDVAERVEDDLGYDGDDF 281




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449485509|ref|XP_004157192.1| PREDICTED: uncharacterized protein LOC101224685 [Cucumis sativus] Back     alignment and taxonomy information
>gi|217073077|gb|ACJ84898.1| unknown [Medicago truncatula] gi|388514313|gb|AFK45218.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225464535|ref|XP_002271267.1| PREDICTED: uncharacterized protein LOC100249100 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490466|ref|XP_003634095.1| PREDICTED: uncharacterized protein LOC100852496 [Vitis vinifera] gi|147821140|emb|CAN62171.1| hypothetical protein VITISV_014432 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147836228|emb|CAN68775.1| hypothetical protein VITISV_006805 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356561526|ref|XP_003549032.1| PREDICTED: uncharacterized protein LOC100805876 [Glycine max] Back     alignment and taxonomy information
>gi|147859725|emb|CAN78886.1| hypothetical protein VITISV_002549 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225464609|ref|XP_002275480.1| PREDICTED: uncharacterized protein LOC100242355 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297808401|ref|XP_002872084.1| hypothetical protein ARALYDRAFT_910412 [Arabidopsis lyrata subsp. lyrata] gi|297317921|gb|EFH48343.1| hypothetical protein ARALYDRAFT_910412 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
TAIR|locus:2172828219 AT5G23950 "AT5G23950" [Arabido 0.516 0.652 0.585 4.1e-43
TAIR|locus:2025002352 AT1G07310 "AT1G07310" [Arabido 0.501 0.394 0.365 1e-20
TAIR|locus:2124933250 AT4G01200 "AT4G01200" [Arabido 0.476 0.528 0.235 4.2e-06
TAIR|locus:2041654 401 AT2G13350 "AT2G13350" [Arabido 0.440 0.304 0.251 6.2e-06
TAIR|locus:2036004324 SRC2 "AT1G09070" [Arabidopsis 0.505 0.432 0.227 0.00035
TAIR|locus:2172828 AT5G23950 "AT5G23950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 437 (158.9 bits), Expect = 4.1e-43, Sum P(2) = 4.1e-43
 Identities = 86/147 (58%), Positives = 104/147 (70%)

Query:     6 EVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPG 65
             EVEVTI+SAKD+KNVNWR+GPN+PYAV+W+DP  K ST+VD++G+TC  W+ET  I LP 
Sbjct:     7 EVEVTISSAKDIKNVNWRNGPNKPYAVVWIDPKFKSSTRVDEDGNTCTTWNETFVIALPP 66

Query:    66 PXXXXXXXXXXXXHAGNEEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSGRPHG 125
                          HAG EE+TK LIGSA L L+DVI+DVG G     TLKLKRPSGRP G
Sbjct:    67 ANDDDDKVYINIVHAGREENTKPLIGSAHLSLRDVIDDVGFGVPFMKTLKLKRPSGRPQG 126

Query:   126 KVDVKVAVRESRYAPPGAYHTPPYGVP 152
             K+DV V VRE+    PG+ +  PYG P
Sbjct:   127 KLDVTVTVRET----PGSNYALPYGDP 149


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2025002 AT1G07310 "AT1G07310" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124933 AT4G01200 "AT4G01200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041654 AT2G13350 "AT2G13350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036004 SRC2 "AT1G09070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 2e-35
cd00030102 cd00030, C2, C2 domain 2e-12
pfam0016885 pfam00168, C2, C2 domain 1e-09
smart00239101 smart00239, C2, Protein kinase C conserved region 4e-09
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 7e-08
cd04021125 cd04021, C2_E3_ubiquitin_ligase, C2 domain present 4e-05
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 1e-04
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 2e-04
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 0.003
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
 Score =  123 bits (310), Expect = 2e-35
 Identities = 52/127 (40%), Positives = 74/127 (58%), Gaps = 5/127 (3%)

Query: 6   EVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPG 65
            +E+TI SA+DLKNVN   G  + YAV+W+DP+ K ST VD +G T P W+ETL  PL  
Sbjct: 1   TLEITIISAEDLKNVNLF-GKMKVYAVVWIDPSHKQSTPVDRDGGTNPTWNETLRFPLDE 59

Query: 66  PV--DDDTTLIIDVVHAGNEEDTKKLIGSAKLKLKDVINDVG-LGERASLTLKLKRPSGR 122
            +       L I+V          KLIG  ++ LKD+++     GE   L+ +L+RPSG+
Sbjct: 60  RLLQQGRLALTIEVYCERP-SLGDKLIGEVRVPLKDLLDGASPAGELRFLSYQLRRPSGK 118

Query: 123 PHGKVDV 129
           P G ++ 
Sbjct: 119 PQGVLNF 125


SRC2 production is a response to pathogen infiltration. The initial response of increased Ca2+ concentrations are coupled to downstream signal transduction pathways via calcium binding proteins. SRC2 contains a single C2 domain which localizes to the plasma membrane and is involved in Ca2+ dependent protein binding. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Length = 125

>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 277
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.88
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.86
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.85
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.84
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.84
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.84
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.83
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.82
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.82
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.82
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.82
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.82
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.81
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.81
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.81
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.8
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.8
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.8
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.8
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.79
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.79
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.79
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.79
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.79
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.78
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.78
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.78
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.77
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.77
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.77
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.77
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.77
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.77
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.76
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.76
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.76
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.75
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.75
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.75
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.75
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.75
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.75
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.74
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.74
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.74
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.74
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.74
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.74
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.73
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.73
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.73
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.73
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.73
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.72
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.72
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.71
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.71
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.7
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.7
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.7
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.69
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.69
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.69
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.68
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.68
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.68
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.66
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.66
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.65
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.65
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.65
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.64
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.64
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.64
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.64
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.63
PLN03008 868 Phospholipase D delta 99.63
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.63
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.63
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.63
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.62
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.62
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.62
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.61
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.61
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.61
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.6
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.6
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.6
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.59
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.56
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.56
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.56
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.48
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.48
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.47
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.46
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.35
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.35
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.32
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 99.31
PLN02270 808 phospholipase D alpha 99.3
PLN02223537 phosphoinositide phospholipase C 99.3
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.3
PLN02952599 phosphoinositide phospholipase C 99.23
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.19
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.17
PLN02230598 phosphoinositide phospholipase C 4 99.12
PLN02222581 phosphoinositide phospholipase C 2 99.07
PLN02228567 Phosphoinositide phospholipase C 99.06
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 99.06
KOG0169746 consensus Phosphoinositide-specific phospholipase 99.01
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 98.99
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.99
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.96
PLN02352 758 phospholipase D epsilon 98.82
KOG3837523 consensus Uncharacterized conserved protein, conta 98.66
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.63
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 98.4
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 98.38
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.35
KOG10111283 consensus Neurotransmitter release regulator, UNC- 98.32
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 98.31
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.18
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 97.99
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 97.64
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 97.64
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 97.56
smart00157217 PRP Major prion protein. The prion protein is a ma 97.48
PLN02964 644 phosphatidylserine decarboxylase 97.48
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.42
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.35
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 97.3
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.23
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 97.18
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 97.14
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 97.13
PF15627156 CEP76-C2: CEP76 C2 domain 97.11
PF11618107 DUF3250: Protein of unknown function (DUF3250); In 97.1
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 97.08
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 97.05
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 96.9
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 96.87
cd08397159 C2_PI3K_class_III C2 domain present in class III p 96.8
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 96.62
KOG1452 442 consensus Predicted Rho GTPase-activating protein 96.47
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 96.33
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 96.22
KOG1327 529 consensus Copine [Signal transduction mechanisms] 95.79
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 95.73
PF09849247 DUF2076: Uncharacterized protein conserved in bact 95.45
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 95.18
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 95.04
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 94.9
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 94.21
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 92.54
KOG1327 529 consensus Copine [Signal transduction mechanisms] 89.98
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 86.33
PF14924112 DUF4497: Protein of unknown function (DUF4497) 85.36
PTZ00447 508 apical membrane antigen 1-like protein; Provisiona 85.29
KOG3294261 consensus WW domain binding protein WBP-2, contain 84.06
PF07162168 B9-C2: Ciliary basal body-associated, B9 protein; 83.87
PF09849247 DUF2076: Uncharacterized protein conserved in bact 81.0
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
Probab=99.88  E-value=7.4e-22  Score=155.55  Aligned_cols=118  Identities=19%  Similarity=0.282  Sum_probs=96.4

Q ss_pred             eEEEEEEEEeeCCCCCCCCCCCCCcEEEEEECCCCeEEeeecCCCCCCCccceeEEEecCCCCCCCceEEEEEEEccCCC
Q 023810            5 YEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPGPVDDDTTLIIDVVHAGNEE   84 (277)
Q Consensus         5 ~~L~V~v~~A~~L~~~~~~~g~~dpYv~v~ld~~~~~~T~v~~~~~~nP~WnE~f~f~v~~~~l~~~~L~v~V~d~~~~~   84 (277)
                      .+|+|+|++|++|++.+ + +++||||++++. +.+++|+++.+++.||+|||+|.|.|...   ...|.|+|||++. +
T Consensus         2 g~L~v~v~~Ak~l~~~~-~-g~sDPYv~i~lg-~~~~kT~v~~~~~~nP~WNe~F~f~v~~~---~~~l~~~V~d~d~-~   74 (121)
T cd04016           2 GRLSITVVQAKLVKNYG-L-TRMDPYCRIRVG-HAVYETPTAYNGAKNPRWNKTIQCTLPEG---VDSIYIEIFDERA-F   74 (121)
T ss_pred             cEEEEEEEEccCCCcCC-C-CCCCceEEEEEC-CEEEEeEEccCCCCCCccCeEEEEEecCC---CcEEEEEEEeCCC-C
Confidence            47999999999998877 4 899999999994 67789999656689999999999999752   3579999999997 4


Q ss_pred             CCCceeEEEEEecce-eccccCCCceeeEEEEeecCC-CCCceEEEEEEEE
Q 023810           85 DTKKLIGSAKLKLKD-VINDVGLGERASLTLKLKRPS-GRPHGKVDVKVAV  133 (277)
Q Consensus        85 ~~d~~iG~~~v~L~~-l~~~~~~~~~~~~~~~L~~~s-g~~~G~L~l~v~~  133 (277)
                      ++|++||++.|+|.+ +...    +....||.|...+ .+..|.|+|+++|
T Consensus        75 ~~dd~iG~~~i~l~~~~~~g----~~~~~W~~L~~~~~~~~~g~i~l~l~y  121 (121)
T cd04016          75 TMDERIAWTHITIPESVFNG----ETLDDWYSLSGKQGEDKEGMINLVFSY  121 (121)
T ss_pred             cCCceEEEEEEECchhccCC----CCccccEeCcCccCCCCceEEEEEEeC
Confidence            788999999999964 4433    3356788886543 3467999999985



Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice varian

>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>smart00157 PRP Major prion protein Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>PF09849 DUF2076: Uncharacterized protein conserved in bacteria (DUF2076); InterPro: IPR018648 This family of hypothetical prokaryotic proteins has no known function but includes putative perimplasmic ligand-binding sensor proteins Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14924 DUF4497: Protein of unknown function (DUF4497) Back     alignment and domain information
>PTZ00447 apical membrane antigen 1-like protein; Provisional Back     alignment and domain information
>KOG3294 consensus WW domain binding protein WBP-2, contains GRAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF07162 B9-C2: Ciliary basal body-associated, B9 protein; InterPro: IPR010796 Proteins in this entry include the MSK1 protein (Q9NXB0 from SWISSPROT) and other known or predicted flagellar basal body proteome components [] or cilia-containing species Back     alignment and domain information
>PF09849 DUF2076: Uncharacterized protein conserved in bacteria (DUF2076); InterPro: IPR018648 This family of hypothetical prokaryotic proteins has no known function but includes putative perimplasmic ligand-binding sensor proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 7e-12
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-10
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 6e-10
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 1e-09
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 3e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 7e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-04
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 4e-08
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 9e-08
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 1e-06
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 3e-06
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 4e-06
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 5e-06
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 7e-06
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 2e-05
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 8e-06
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 3e-05
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 5e-05
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 4e-04
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 5e-05
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 2e-04
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 6e-05
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 9e-05
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 3e-04
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 3e-04
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 7e-04
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-04
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
 Score = 61.1 bits (148), Expect = 7e-12
 Identities = 23/136 (16%), Positives = 45/136 (33%), Gaps = 22/136 (16%)

Query: 7   VEVTITSAKDLKNVNWRHGPNR---------PYAVLWVDPNKKCSTKVDDEGDTCPYWDE 57
           + V I  A  L+   W    +          PY  + VD  +   T    +    P ++E
Sbjct: 31  LRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTST-KQKTNKPTYNE 89

Query: 58  TLAIPLPGPVDDDTTLIIDVVHAGNEEDT---KKLIGSAKLKLKDVINDVGLGERASLTL 114
                    V D   L + V H    E        + +  L+ ++++   G  +     +
Sbjct: 90  EFCA----NVTDGGHLELAVFH----ETPLGYDHFVANCTLQFQELLRTTGASDTFEGWV 141

Query: 115 KLKRPSGRPHGKVDVK 130
            L+ P G+    + + 
Sbjct: 142 DLE-PEGKVFVVITLT 156


>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.86
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.85
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.85
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.84
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.84
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.83
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.83
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.82
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.82
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.81
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.8
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.8
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.77
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.76
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.76
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.76
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.75
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.75
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.75
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.74
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.74
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.74
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.74
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.74
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.73
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.73
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.73
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.73
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.73
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.72
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.72
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.72
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.72
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.72
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.72
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.71
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.68
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.68
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.65
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.59
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.58
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.55
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.46
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.46
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.44
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.36
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.32
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.31
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.27
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 99.22
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 99.13
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 98.44
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 97.18
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 96.74
3heq_A142 Major prion protein; cell membrane, disease mutati 95.97
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 93.19
2lbg_A27 Major prion protein; conserved hydrophobic region, 93.17
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 93.1
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 92.36
1tpx_A121 Prion protein, major prion protein; antibody, unkn 90.79
2y3a_A 1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 87.23
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 86.79
1xu0_A130 Prion protein, XLPRP; amphibian, polymorphism, gly 86.28
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
Probab=99.86  E-value=4.7e-21  Score=152.09  Aligned_cols=123  Identities=21%  Similarity=0.334  Sum_probs=104.3

Q ss_pred             ceEEEEEEEEeeCCCCCCCCCCCCCcEEEEEECCCCeEEeeecCC-CCCCCccceeEEEecCCCCCCCceEEEEEEEccC
Q 023810            4 RYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDE-GDTCPYWDETLAIPLPGPVDDDTTLIIDVVHAGN   82 (277)
Q Consensus         4 ~~~L~V~v~~A~~L~~~~~~~g~~dpYv~v~ld~~~~~~T~v~~~-~~~nP~WnE~f~f~v~~~~l~~~~L~v~V~d~~~   82 (277)
                      ...|+|+|++|++|...+.. +.+||||+++++ ..+.+|++ ++ ++.||+|||+|.|.+..   ....|.|+|||++.
T Consensus         9 ~~~L~v~v~~a~~L~~~d~~-g~~dpyv~v~~~-~~~~kT~~-~~~~~~nP~Wne~f~f~v~~---~~~~l~~~V~d~~~   82 (136)
T 1wfj_A            9 HGTLEVVLVSAKGLEDADFL-NNMDPYVQLTCR-TQDQKSNV-AEGMGTTPEWNETFIFTVSE---GTTELKAKIFDKDV   82 (136)
T ss_dssp             EEEEEEEEEEEEECSSCCSS-CSSCCCEEEESS-SCEEECCC-CTTCCSSCEEEEEEEEEEES---SCCEEEEEECCSSS
T ss_pred             cEEEEEEEEeccCCCCcccC-CCcCceEEEEEC-CccceeEe-ccCCCCCCccCcEEEEEECC---CCCEEEEEEEECCC
Confidence            36899999999999988865 899999999996 45779998 55 89999999999999975   35789999999986


Q ss_pred             CCCCCceeEEEEEecceeccccCCCceeeEEEEeecCCCCCceEEEEEEEEEecC
Q 023810           83 EEDTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSGRPHGKVDVKVAVRESR  137 (277)
Q Consensus        83 ~~~~d~~iG~~~v~L~~l~~~~~~~~~~~~~~~L~~~sg~~~G~L~l~v~~~~~~  137 (277)
                       ..+++|||++.|+|.++...   ++....||.|. +.++..|+|+|+++|.+..
T Consensus        83 -~~~d~~lG~~~i~l~~l~~~---~~~~~~w~~L~-~~~~~~G~i~l~l~~~p~~  132 (136)
T 1wfj_A           83 -GTEDDAVGEATIPLEPVFVE---GSIPPTAYNVV-KDEEYKGEIWVALSFKPSG  132 (136)
T ss_dssp             -CTTTCCSEEEEEESHHHHHH---SEEEEEEEEEE-ETTEEEEEEEEEEEEEECC
T ss_pred             -CCCCceEEEEEEEHHHhccC---CCCCcEEEEee-cCCccCEEEEEEEEEEeCC
Confidence             46889999999999998654   23456789987 5677899999999998763



>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>3heq_A Major prion protein; cell membrane, disease mutation, disulfide bond, glycoprotein, golgi apparatus, GPI-anchor, lipoprotein, membrane, polymorphism; 1.80A {Homo sapiens} PDB: 2lsb_A 2k1d_A 2lej_A 2lv1_A 2lft_A 1fkc_A 1fo7_A 3haf_A 3hj5_A 1qm0_A 1qm1_A 2kun_A 3hes_A 3her_A 1b10_A 2joh_A 2fj3_A 2jom_A 2l1h_A 2l39_A ... Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>2lbg_A Major prion protein; conserved hydrophobic region, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>1tpx_A Prion protein, major prion protein; antibody, unknown function; 2.56A {Ovis aries} SCOP: d.6.1.1 Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>1xu0_A Prion protein, XLPRP; amphibian, polymorphism, glycoprotein, membrane protein; NMR {Xenopus laevis} SCOP: d.6.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 277
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 1e-10
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 3e-09
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 2e-08
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 7e-08
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 1e-06
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 3e-06
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 5e-06
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 6e-06
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 8e-06
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 4e-04
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 7e-04
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: E3 ubiquitin-protein ligase Itchy
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 55.9 bits (134), Expect = 1e-10
 Identities = 24/136 (17%), Positives = 53/136 (38%), Gaps = 13/136 (9%)

Query: 1   MASRYEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLA 60
           +  + ++++T+ SAK  +N     GP+ PY  + VD   K + K ++          T+ 
Sbjct: 2   LTMKSQLQITVISAKLKENKKNWFGPS-PYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVI 60

Query: 61  IPLPGPVDDDTTLIIDVVHAGNEEDTKK--LIGSAKLKLKDVI-NDVGLGERASLTLKLK 117
           +                    + +  K   L+G+A L + + + ++    E   +TL+L 
Sbjct: 61  VTPV---------SKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLG 111

Query: 118 RPSGRPHGKVDVKVAV 133
                     D+ + +
Sbjct: 112 GDKEPTETIGDLSICL 127


>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.88
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.86
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.82
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.82
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.82
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.79
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.76
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.75
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.74
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.72
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.71
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.7
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.7
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.67
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.66
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.66
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.65
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.64
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.59
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.55
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 96.24
d2yrba1142 Fantom {Human (Homo sapiens) [TaxId: 9606]} 94.5
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.88  E-value=2.3e-22  Score=158.38  Aligned_cols=123  Identities=20%  Similarity=0.337  Sum_probs=102.0

Q ss_pred             eEEEEEEEEeeCCCCCCCCCCCCCcEEEEEECCCCeEEeeecCCCCCCCccceeEEEecCCCCCCCceEEEEEEEccCCC
Q 023810            5 YEVEVTITSAKDLKNVNWRHGPNRPYAVLWVDPNKKCSTKVDDEGDTCPYWDETLAIPLPGPVDDDTTLIIDVVHAGNEE   84 (277)
Q Consensus         5 ~~L~V~v~~A~~L~~~~~~~g~~dpYv~v~ld~~~~~~T~v~~~~~~nP~WnE~f~f~v~~~~l~~~~L~v~V~d~~~~~   84 (277)
                      .+|+|+|++|++|+..+.. +++||||+++++ ..+.+|++..+++.||+|||+|.|.+..   ....|+|+|||++. .
T Consensus        10 G~L~V~v~~a~~L~~~d~~-g~~Dpyv~v~~~-~~~~~t~~~~~~~~nP~Wne~f~f~v~~---~~~~L~v~V~d~d~-~   83 (136)
T d1wfja_          10 GTLEVVLVSAKGLEDADFL-NNMDPYVQLTCR-TQDQKSNVAEGMGTTPEWNETFIFTVSE---GTTELKAKIFDKDV-G   83 (136)
T ss_dssp             EEEEEEEEEEEECSSCCSS-CSSCCCEEEESS-SCEEECCCCTTCCSSCEEEEEEEEEEES---SCCEEEEEECCSSS-C
T ss_pred             EEEEEEEEEeeCCCCCCCC-CCCCccEEEEEe-eeeEEEEEEecCCCcEEEeeEEEEEEcC---ccceEEEEEEEecC-C
Confidence            6899999999999998865 899999999995 5677888755678999999999999975   24569999999986 4


Q ss_pred             CCCceeEEEEEecceeccccCCCceeeEEEEeecCCCCCceEEEEEEEEEecC
Q 023810           85 DTKKLIGSAKLKLKDVINDVGLGERASLTLKLKRPSGRPHGKVDVKVAVRESR  137 (277)
Q Consensus        85 ~~d~~iG~~~v~L~~l~~~~~~~~~~~~~~~L~~~sg~~~G~L~l~v~~~~~~  137 (277)
                      .+++|||++.|+|.++...   +.....|+.|.+ .++.+|+|+|+++|.+.+
T Consensus        84 ~~d~~iG~~~i~L~~l~~~---~~~~~~~~~l~~-~~~~~G~i~l~l~~~p~~  132 (136)
T d1wfja_          84 TEDDAVGEATIPLEPVFVE---GSIPPTAYNVVK-DEEYKGEIWVALSFKPSG  132 (136)
T ss_dssp             TTTCCSEEEEEESHHHHHH---SEEEEEEEEEEE-TTEEEEEEEEEEEEEECC
T ss_pred             CCCCEEEEEEEEhHHhccc---CCcCcEEEEecC-CCccCEEEEEEEEEEeCC
Confidence            6789999999999998764   333456777754 567789999999998753



>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2yrba1 b.7.1.1 (A:596-737) Fantom {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure